WO2017178653A2 - NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS - Google Patents
NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS Download PDFInfo
- Publication number
- WO2017178653A2 WO2017178653A2 PCT/EP2017/059071 EP2017059071W WO2017178653A2 WO 2017178653 A2 WO2017178653 A2 WO 2017178653A2 EP 2017059071 W EP2017059071 W EP 2017059071W WO 2017178653 A2 WO2017178653 A2 WO 2017178653A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antigen
- antibody
- sirpa
- binding
- Prior art date
Links
- 230000001225 therapeutic effect Effects 0.000 title description 16
- 101150036449 SIRPA gene Proteins 0.000 claims abstract description 223
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 claims abstract description 151
- 230000027455 binding Effects 0.000 claims description 486
- 238000009739 binding Methods 0.000 claims description 484
- 108091007433 antigens Proteins 0.000 claims description 365
- 102000036639 antigens Human genes 0.000 claims description 365
- 239000000427 antigen Substances 0.000 claims description 364
- 239000012634 fragment Substances 0.000 claims description 200
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 171
- 241000282414 Homo sapiens Species 0.000 claims description 152
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 119
- 210000004027 cell Anatomy 0.000 claims description 104
- 238000000034 method Methods 0.000 claims description 83
- 206010028980 Neoplasm Diseases 0.000 claims description 82
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 74
- 230000035755 proliferation Effects 0.000 claims description 67
- 239000003795 chemical substances by application Substances 0.000 claims description 37
- 150000007523 nucleic acids Chemical class 0.000 claims description 35
- 201000011510 cancer Diseases 0.000 claims description 34
- 238000011282 treatment Methods 0.000 claims description 33
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 32
- 239000003814 drug Substances 0.000 claims description 31
- 150000001413 amino acids Chemical class 0.000 claims description 27
- 230000014509 gene expression Effects 0.000 claims description 27
- 239000013598 vector Substances 0.000 claims description 20
- 208000035473 Communicable disease Diseases 0.000 claims description 18
- 108020004707 nucleic acids Proteins 0.000 claims description 18
- 102000039446 nucleic acids Human genes 0.000 claims description 18
- 208000015181 infectious disease Diseases 0.000 claims description 17
- 238000004519 manufacturing process Methods 0.000 claims description 17
- 239000005557 antagonist Substances 0.000 claims description 16
- 239000013066 combination product Substances 0.000 claims description 15
- 229940127555 combination product Drugs 0.000 claims description 15
- 210000002865 immune cell Anatomy 0.000 claims description 15
- 238000000338 in vitro Methods 0.000 claims description 14
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 claims description 14
- 229920001184 polypeptide Polymers 0.000 claims description 13
- 238000001565 modulated differential scanning calorimetry Methods 0.000 claims description 12
- 210000000066 myeloid cell Anatomy 0.000 claims description 12
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 11
- 102000044459 human CD47 Human genes 0.000 claims description 11
- 230000004044 response Effects 0.000 claims description 11
- 208000037976 chronic inflammation Diseases 0.000 claims description 10
- 208000037893 chronic inflammatory disorder Diseases 0.000 claims description 10
- 208000014674 injury Diseases 0.000 claims description 10
- 239000000523 sample Substances 0.000 claims description 10
- 229940124597 therapeutic agent Drugs 0.000 claims description 10
- 230000008733 trauma Effects 0.000 claims description 10
- 238000002255 vaccination Methods 0.000 claims description 10
- 208000023275 Autoimmune disease Diseases 0.000 claims description 9
- 206010016654 Fibrosis Diseases 0.000 claims description 9
- 239000000556 agonist Substances 0.000 claims description 9
- 238000002405 diagnostic procedure Methods 0.000 claims description 9
- 230000004761 fibrosis Effects 0.000 claims description 9
- 239000002955 immunomodulating agent Substances 0.000 claims description 9
- 201000001320 Atherosclerosis Diseases 0.000 claims description 8
- 208000018565 Hemochromatosis Diseases 0.000 claims description 8
- 208000028389 Nerve injury Diseases 0.000 claims description 8
- 208000008601 Polycythemia Diseases 0.000 claims description 8
- 241000589516 Pseudomonas Species 0.000 claims description 8
- 208000029028 brain injury Diseases 0.000 claims description 8
- 230000001684 chronic effect Effects 0.000 claims description 8
- 230000004064 dysfunction Effects 0.000 claims description 8
- 230000008764 nerve damage Effects 0.000 claims description 8
- 239000008194 pharmaceutical composition Substances 0.000 claims description 8
- 230000035939 shock Effects 0.000 claims description 8
- 208000008589 Obesity Diseases 0.000 claims description 7
- 230000003044 adaptive effect Effects 0.000 claims description 7
- 230000002757 inflammatory effect Effects 0.000 claims description 7
- 235000020824 obesity Nutrition 0.000 claims description 7
- 208000012902 Nervous system disease Diseases 0.000 claims description 6
- 239000012190 activator Substances 0.000 claims description 6
- 239000002253 acid Substances 0.000 claims description 5
- 239000012472 biological sample Substances 0.000 claims description 5
- 238000001514 detection method Methods 0.000 claims description 5
- 201000010099 disease Diseases 0.000 claims description 5
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 210000002966 serum Anatomy 0.000 claims description 5
- 101100422762 Homo sapiens SI gene Proteins 0.000 claims description 4
- 238000003745 diagnosis Methods 0.000 claims description 4
- 230000003053 immunization Effects 0.000 claims description 4
- 108010029697 CD40 Ligand Proteins 0.000 claims description 3
- 229940123189 CD40 agonist Drugs 0.000 claims description 3
- 102100032937 CD40 ligand Human genes 0.000 claims description 3
- 101100454808 Caenorhabditis elegans lgg-2 gene Proteins 0.000 claims description 3
- 101100217502 Caenorhabditis elegans lgg-3 gene Proteins 0.000 claims description 3
- 239000003242 anti bacterial agent Substances 0.000 claims description 3
- 229940088710 antibiotic agent Drugs 0.000 claims description 3
- 239000002246 antineoplastic agent Substances 0.000 claims description 3
- 239000000090 biomarker Substances 0.000 claims description 3
- 229940127089 cytotoxic agent Drugs 0.000 claims description 3
- 206010012601 diabetes mellitus Diseases 0.000 claims description 3
- 239000006041 probiotic Substances 0.000 claims description 3
- 235000018291 probiotics Nutrition 0.000 claims description 3
- 238000001959 radiotherapy Methods 0.000 claims description 3
- 239000000018 receptor agonist Substances 0.000 claims description 3
- 229940044601 receptor agonist Drugs 0.000 claims description 3
- 238000002659 cell therapy Methods 0.000 claims description 2
- 238000011002 quantification Methods 0.000 claims description 2
- 241001024304 Mino Species 0.000 claims 3
- 230000002265 prevention Effects 0.000 claims 1
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 abstract description 140
- 230000003993 interaction Effects 0.000 abstract description 29
- 241000699670 Mus sp. Species 0.000 description 60
- 210000002540 macrophage Anatomy 0.000 description 41
- 108090000623 proteins and genes Proteins 0.000 description 40
- 102000004169 proteins and genes Human genes 0.000 description 35
- 241000699666 Mus <mouse, genus> Species 0.000 description 33
- 238000004458 analytical method Methods 0.000 description 32
- 235000018102 proteins Nutrition 0.000 description 30
- 235000001014 amino acid Nutrition 0.000 description 25
- 230000000694 effects Effects 0.000 description 23
- 238000002347 injection Methods 0.000 description 22
- 239000007924 injection Substances 0.000 description 22
- 210000001616 monocyte Anatomy 0.000 description 22
- 108091028043 Nucleic acid sequence Proteins 0.000 description 19
- 238000010494 dissociation reaction Methods 0.000 description 18
- 230000005593 dissociations Effects 0.000 description 18
- 102100029948 Tyrosine-protein phosphatase non-receptor type substrate 1 Human genes 0.000 description 17
- 230000000875 corresponding effect Effects 0.000 description 17
- 230000001976 improved effect Effects 0.000 description 16
- 210000000952 spleen Anatomy 0.000 description 16
- 108010007127 Pulmonary Surfactant-Associated Protein D Proteins 0.000 description 15
- 102100027845 Pulmonary surfactant-associated protein D Human genes 0.000 description 15
- 210000004443 dendritic cell Anatomy 0.000 description 15
- 230000000770 proinflammatory effect Effects 0.000 description 15
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 14
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 14
- 230000006870 function Effects 0.000 description 14
- 238000012360 testing method Methods 0.000 description 14
- 210000001772 blood platelet Anatomy 0.000 description 13
- 230000010287 polarization Effects 0.000 description 13
- 230000008685 targeting Effects 0.000 description 13
- 238000002965 ELISA Methods 0.000 description 12
- 230000000735 allogeneic effect Effects 0.000 description 12
- 210000004988 splenocyte Anatomy 0.000 description 12
- 238000003556 assay Methods 0.000 description 11
- 239000004094 surface-active agent Substances 0.000 description 11
- 239000012636 effector Substances 0.000 description 10
- 238000009738 saturating Methods 0.000 description 10
- 230000006052 T cell proliferation Effects 0.000 description 9
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 9
- 238000012286 ELISA Assay Methods 0.000 description 8
- 241000283074 Equus asinus Species 0.000 description 8
- 101000863873 Homo sapiens Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 8
- 229960000074 biopharmaceutical Drugs 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 238000010348 incorporation Methods 0.000 description 8
- 238000011534 incubation Methods 0.000 description 8
- 229940104230 thymidine Drugs 0.000 description 8
- 238000005406 washing Methods 0.000 description 8
- 241000124008 Mammalia Species 0.000 description 7
- 230000000259 anti-tumor effect Effects 0.000 description 7
- 230000005764 inhibitory process Effects 0.000 description 7
- 230000007170 pathology Effects 0.000 description 7
- 230000037361 pathway Effects 0.000 description 7
- 238000006467 substitution reaction Methods 0.000 description 7
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 6
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 6
- 102100036049 T-complex protein 1 subunit gamma Human genes 0.000 description 6
- 230000002776 aggregation Effects 0.000 description 6
- 238000004220 aggregation Methods 0.000 description 6
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 6
- 239000011324 bead Substances 0.000 description 6
- 101150062912 cct3 gene Proteins 0.000 description 6
- 238000007796 conventional method Methods 0.000 description 6
- 230000007423 decrease Effects 0.000 description 6
- 238000000684 flow cytometry Methods 0.000 description 6
- 239000003112 inhibitor Substances 0.000 description 6
- 210000003071 memory t lymphocyte Anatomy 0.000 description 6
- 239000000203 mixture Substances 0.000 description 6
- 239000004033 plastic Substances 0.000 description 6
- 108020003175 receptors Proteins 0.000 description 6
- 102000005962 receptors Human genes 0.000 description 6
- 230000005748 tumor development Effects 0.000 description 6
- 206010003445 Ascites Diseases 0.000 description 5
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 5
- 102000001554 Hemoglobins Human genes 0.000 description 5
- 108010054147 Hemoglobins Proteins 0.000 description 5
- 101000835928 Homo sapiens Signal-regulatory protein gamma Proteins 0.000 description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 description 5
- 240000002390 Pandanus odoratissimus Species 0.000 description 5
- 235000005311 Pandanus odoratissimus Nutrition 0.000 description 5
- 206010057249 Phagocytosis Diseases 0.000 description 5
- 102100025795 Signal-regulatory protein gamma Human genes 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 5
- 231100000673 dose–response relationship Toxicity 0.000 description 5
- 210000003743 erythrocyte Anatomy 0.000 description 5
- 238000005534 hematocrit Methods 0.000 description 5
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 5
- 229940126533 immune checkpoint blocker Drugs 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 238000011081 inoculation Methods 0.000 description 5
- 230000008782 phagocytosis Effects 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 230000001173 tumoral effect Effects 0.000 description 5
- -1 CAR-T cells) Substances 0.000 description 4
- 102100034409 DNA helicase B Human genes 0.000 description 4
- 101001066825 Homo sapiens DNA helicase B Proteins 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- 206010033128 Ovarian cancer Diseases 0.000 description 4
- 102100024952 Protein CBFA2T1 Human genes 0.000 description 4
- 238000009825 accumulation Methods 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 230000004721 adaptive immunity Effects 0.000 description 4
- 239000002671 adjuvant Substances 0.000 description 4
- 230000009137 competitive binding Effects 0.000 description 4
- 230000002860 competitive effect Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 230000001506 immunosuppresive effect Effects 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 238000007912 intraperitoneal administration Methods 0.000 description 4
- 230000007774 longterm Effects 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 102000013415 peroxidase activity proteins Human genes 0.000 description 4
- 108040007629 peroxidase activity proteins Proteins 0.000 description 4
- 239000000546 pharmaceutical excipient Substances 0.000 description 4
- 210000004623 platelet-rich plasma Anatomy 0.000 description 4
- 238000000159 protein binding assay Methods 0.000 description 4
- 208000010110 spontaneous platelet aggregation Diseases 0.000 description 4
- 238000003756 stirring Methods 0.000 description 4
- 230000004083 survival effect Effects 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 208000001072 type 2 diabetes mellitus Diseases 0.000 description 4
- 229960005486 vaccine Drugs 0.000 description 4
- 241000894006 Bacteria Species 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- 108010087819 Fc receptors Proteins 0.000 description 3
- 102000009109 Fc receptors Human genes 0.000 description 3
- 101000709256 Homo sapiens Signal-regulatory protein beta-1 Proteins 0.000 description 3
- 108091008036 Immune checkpoint proteins Proteins 0.000 description 3
- 102000037982 Immune checkpoint proteins Human genes 0.000 description 3
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 3
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 3
- 108010007100 Pulmonary Surfactant-Associated Protein A Proteins 0.000 description 3
- 102000007615 Pulmonary Surfactant-Associated Protein A Human genes 0.000 description 3
- 102100034378 Signal-regulatory protein beta-1 Human genes 0.000 description 3
- 108010090804 Streptavidin Proteins 0.000 description 3
- 101000844753 Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) DNA-binding protein 7d Proteins 0.000 description 3
- 108700019146 Transgenes Proteins 0.000 description 3
- 102100023038 WD and tetratricopeptide repeats protein 1 Human genes 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 230000005540 biological transmission Effects 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- 201000008275 breast carcinoma Diseases 0.000 description 3
- 239000011248 coating agent Substances 0.000 description 3
- 238000000576 coating method Methods 0.000 description 3
- 238000012875 competitive assay Methods 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 239000003102 growth factor Substances 0.000 description 3
- 229960002725 isoflurane Drugs 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 210000005075 mammary gland Anatomy 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 230000015654 memory Effects 0.000 description 3
- 239000011325 microbead Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 239000013642 negative control Substances 0.000 description 3
- 230000002093 peripheral effect Effects 0.000 description 3
- 238000002823 phage display Methods 0.000 description 3
- 210000003240 portal vein Anatomy 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000002062 proliferating effect Effects 0.000 description 3
- 210000003289 regulatory T cell Anatomy 0.000 description 3
- 238000002702 ribosome display Methods 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 241000894007 species Species 0.000 description 3
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 2
- 108010082808 4-1BB Ligand Proteins 0.000 description 2
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 101001019455 Homo sapiens ICOS ligand Proteins 0.000 description 2
- 101000632467 Homo sapiens Pulmonary surfactant-associated protein D Proteins 0.000 description 2
- 102000008100 Human Serum Albumin Human genes 0.000 description 2
- 108091006905 Human Serum Albumin Proteins 0.000 description 2
- 102100034980 ICOS ligand Human genes 0.000 description 2
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 description 2
- 101710177940 IgG receptor FcRn large subunit p51 Proteins 0.000 description 2
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 2
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical group SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 102000015636 Oligopeptides Human genes 0.000 description 2
- 108010038807 Oligopeptides Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 230000006044 T cell activation Effects 0.000 description 2
- 229940046176 T-cell checkpoint inhibitor Drugs 0.000 description 2
- 239000012644 T-cell checkpoint inhibitor Substances 0.000 description 2
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 230000003042 antagnostic effect Effects 0.000 description 2
- 230000003110 anti-inflammatory effect Effects 0.000 description 2
- 239000000611 antibody drug conjugate Substances 0.000 description 2
- 229940049595 antibody-drug conjugate Drugs 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000000601 blood cell Anatomy 0.000 description 2
- 238000004820 blood count Methods 0.000 description 2
- 238000009566 cancer vaccine Methods 0.000 description 2
- 229940022399 cancer vaccine Drugs 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 229940000425 combination drug Drugs 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 150000001875 compounds Chemical class 0.000 description 2
- 239000000562 conjugate Substances 0.000 description 2
- 238000004163 cytometry Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 230000009977 dual effect Effects 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 231100000226 haematotoxicity Toxicity 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 229920002521 macromolecule Polymers 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 230000002611 ovarian Effects 0.000 description 2
- 230000000242 pagocytic effect Effects 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 230000008092 positive effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 230000009870 specific binding Effects 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 229940021747 therapeutic vaccine Drugs 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 229960001005 tuberculin Drugs 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- RMQHBNLAFHDMEN-UHFFFAOYSA-N (4,4,4-trifluoro-2-oxobutyl) dihydrogen phosphate Chemical compound OP(O)(=O)OCC(=O)CC(F)(F)F RMQHBNLAFHDMEN-UHFFFAOYSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- 238000010600 3H thymidine incorporation assay Methods 0.000 description 1
- 206010002091 Anaesthesia Diseases 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 208000025324 B-cell acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 108700031361 Brachyury Proteins 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 101100385576 Caenorhabditis elegans ctg-1 gene Proteins 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 108090000317 Chymotrypsin Proteins 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 101710096438 DNA-binding protein Proteins 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 102100040004 Gamma-glutamylcyclotransferase Human genes 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000886680 Homo sapiens Gamma-glutamylcyclotransferase Proteins 0.000 description 1
- 101000804764 Homo sapiens Lymphotactin Proteins 0.000 description 1
- 101100477531 Homo sapiens SIRPA gene Proteins 0.000 description 1
- 101000709188 Homo sapiens Signal-regulatory protein beta-1 isoform 3 Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101150106931 IFNG gene Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 206010062016 Immunosuppression Diseases 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- YQEZLKZALYSWHR-UHFFFAOYSA-N Ketamine Chemical compound C=1C=CC=C(Cl)C=1C1(NC)CCCCC1=O YQEZLKZALYSWHR-UHFFFAOYSA-N 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 241000408529 Libra Species 0.000 description 1
- 102000019298 Lipocalin Human genes 0.000 description 1
- 108050006654 Lipocalin Proteins 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 102100035304 Lymphotactin Human genes 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 206010027406 Mesothelioma Diseases 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 1
- 101100077241 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) mmaA3 gene Proteins 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- 102100029438 Nitric oxide synthase, inducible Human genes 0.000 description 1
- 101710089543 Nitric oxide synthase, inducible Proteins 0.000 description 1
- 206010067482 No adverse event Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 231100000742 Plant toxin Toxicity 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 108700033844 Pseudomonas aeruginosa toxA Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 101710168421 Signal-regulatory protein beta-1 Proteins 0.000 description 1
- 101710092332 Signal-regulatory protein gamma Proteins 0.000 description 1
- 241000205101 Sulfolobus Species 0.000 description 1
- 108091008035 T cell costimulatory receptors Proteins 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Natural products O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 101710183617 Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- MCRWZBYTLVCCJJ-DKALBXGISA-N [(1s,3r)-3-[[(3s,4s)-3-methoxyoxan-4-yl]amino]-1-propan-2-ylcyclopentyl]-[(1s,4s)-5-[6-(trifluoromethyl)pyrimidin-4-yl]-2,5-diazabicyclo[2.2.1]heptan-2-yl]methanone Chemical compound C([C@]1(N(C[C@]2([H])C1)C(=O)[C@@]1(C[C@@H](CC1)N[C@@H]1[C@@H](COCC1)OC)C(C)C)[H])N2C1=CC(C(F)(F)F)=NC=N1 MCRWZBYTLVCCJJ-DKALBXGISA-N 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000008186 active pharmaceutical agent Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000001270 agonistic effect Effects 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000037005 anaesthesia Effects 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000006023 anti-tumor response Effects 0.000 description 1
- 230000005888 antibody-dependent cellular phagocytosis Effects 0.000 description 1
- 239000013011 aqueous formulation Substances 0.000 description 1
- 210000004507 artificial chromosome Anatomy 0.000 description 1
- 235000006533 astragalus Nutrition 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000003306 cell dissemination Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000017455 cell-cell adhesion Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000001638 cerebellum Anatomy 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- WOWHHFRSBJGXCM-UHFFFAOYSA-M cetyltrimethylammonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCC[N+](C)(C)C WOWHHFRSBJGXCM-UHFFFAOYSA-M 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 229960002376 chymotrypsin Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 208000029742 colonic neoplasm Diseases 0.000 description 1
- 238000004737 colorimetric analysis Methods 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000006957 competitive inhibition Effects 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 230000000779 depleting effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000007865 diluting Methods 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 210000001320 hippocampus Anatomy 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 102000054510 human SIRPG Human genes 0.000 description 1
- 238000013415 human tumor xenograft model Methods 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000005746 immune checkpoint blockade Effects 0.000 description 1
- 229940127121 immunoconjugate Drugs 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 230000004957 immunoregulator effect Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 239000003018 immunosuppressive agent Substances 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 210000004969 inflammatory cell Anatomy 0.000 description 1
- 230000015788 innate immune response Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 229960003299 ketamine Drugs 0.000 description 1
- 238000002350 laparotomy Methods 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000003563 lymphoid tissue Anatomy 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000000074 matrix-assisted laser desorption--ionisation tandem time-of-flight detection Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 210000004738 parenchymal cell Anatomy 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 238000011170 pharmaceutical development Methods 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 239000003123 plant toxin Substances 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 210000003720 plasmablast Anatomy 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000000722 protumoral effect Effects 0.000 description 1
- 230000002685 pulmonary effect Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 206010039073 rheumatoid arthritis Diseases 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 229960004641 rituximab Drugs 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000011450 sequencing therapy Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- 210000004989 spleen cell Anatomy 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 231100000617 superantigen Toxicity 0.000 description 1
- 230000010955 surfactant homeostasis Effects 0.000 description 1
- 210000000225 synapse Anatomy 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 206010043554 thrombocytopenia Diseases 0.000 description 1
- 208000008732 thymoma Diseases 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- BPICBUSOMSTKRF-UHFFFAOYSA-N xylazine Chemical compound CC1=CC=CC(C)=C1NC1=NCCCS1 BPICBUSOMSTKRF-UHFFFAOYSA-N 0.000 description 1
- 229960001600 xylazine Drugs 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/74—Inducing cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/80—Immunoglobulins specific features remaining in the (producing) cell, i.e. intracellular antibodies or intrabodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
Definitions
- the invention pertains to the field of immunotherapy.
- the present invention provides new anti-SIRPa antibodies able to specifically decreases the interaction between SIRPa and CD47 without affecting the interaction between SIRPg and CD47.
- Immune checkpoint on myeloid cells (macrophages, dendritic cells, MDSC, P N) remain poorly studied while these cells represent the most abundant immune cell type in many solid tumors and are often associated with a poor outcome.
- SIRPa Signal reguiatory protein alpha or SIRPa (also designated as SIRPa, CD172a or SHPS-1), is expressed on monocytes, most subpopulations of tissue macrophages, granulocytes, subsets of dendritic cells in lymphoid tissues, some bone marrow progenitor cells, and to varying levels on neurons, with a notably high expression in synapse-rich areas of the brain, such as the granular layer of the cerebellum and the hippocampus.
- SIRPa is the prototypic member of the SIRP paired receptor family of closely related SiRP proteins.
- the gene coding for human SIRPa is a polymorphic gene and several variants were described in human population.
- SIRPa vl and v2 accession numbers NP_542970 (P78324) and CAA71403).
- the polymorphisms in human SIRP lead to changes in surface-exposed amino acids, but this does not affect binding to CD47.
- SIRPa Interaction of SIRPa, expressed by myeloid cells, with the ubiquitous receptor CD47 is an important immune checkpoint of the innate response, involved in the regulation of myeloid functions.
- the SIRPa interaction with CD47 is largely described and provides a downregulatory signal that inhibits host cell phagocytosis, CD47 is widely expressed at lower levels by most healthy cells but it is also overexpressed in some cancer ceils. Therefore, CD47 functions as a "don't-eat-me" signal. Both CD47 and SIRPa also engage in many other interactions.
- One of the best characterized physiological functions of the CD47-SfRPa interaction is its role in the homeostasis of hematopoietic cells, in particular red blood celts and platelets.
- the SIRPa/CD47 pathway is nowadays subject to different pharmaceutical developments to enhance macrophages phagocytosis.
- cancer celts carry aberrant cargo such as unfamiliar proteins or normal proteins at abnormal levels, yet these cells frequently subvert innate immune control mechanisms by concurrently over-expressing immunoregulatory molecules.
- CD47 a protein of "self expressed by norma! cells.
- CD47 interacts with SIRPa and leads to the transmission of a "don't eat me" signal to phagocytic macrophages, which then !eave target cells unaffected.
- agents targeting CD47 present hematological toxicity (anemia or thrombocytopenia) related to CD47 physiological role.
- SIRP-gamma also designated as SIRPg, S!RPy, CD172g or SIRP beta 2
- SIRPg is the result of a duplication of SIRPb gene in old-world primates nearly 35 million years ago and it is expressed in a restricted manner on T lymphocytes as opposed to SIRPa expression on myeloid cells.
- SfRPg is absent in mice.
- the purpose of the invention is to fulfill this need by providing new agents, in particular antibodies, which make it possible to solve in whole or part the problems mentioned-above.
- the Inventors provide new anti-SiRPa antibodies, in particular humanized antibodies, that antagonize the SiRPa-CD47 interaction but do not specifically bind SIRPg and, thus, do not affect the SiRPg-CD47 interaction.
- Red Biood Cells and platelets
- a "chimeric antibody” refers to an antibody in which the sequence of the variable domain derived from the germline of a mammalian species, such as a mouse, have been grafted onto the sequence of the constant domain derived from the germline of another mammalian species, such as a human.
- Fab fragments are monomeric fragments obtainable by papain digestion of an antibody; they comprise the entire L chain, a nd a VH-CH1 fragment of the H chain, bound together through a disulfide bond.
- the F(a b')2 fragment can be produced by pepsin digestion of an antibody below the hinge disulfide; it comprises two Fab' fragments, and additionally a portion of the hinge region of the immunoglobulin molecule.
- the Fab' fragments are obta inable from F ⁇ ab')2 fragments by cutting a disulfide bond in the hinge region.
- F(a b')2 fragments are divalent, i.e.
- Fv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv a VHVL dimmer constituting the variable part of Fab
- dsFv dsFv
- scFv Fab
- Fab a nd Fab' fragments
- These basic antigen-binding fragments of the invention can be combined together to obtain multivalent antigen-binding fragments, such as diabodies, tribodies or tetrabodies.
- These multivalent antigen-binding fragments are a lso part of the present invention.
- bispecific antibodies refers to antibodies that recognize two different antigens by virtue of possessing at least one region ⁇ e.g. derived from a variable region of a first a ntibody) that is specific for a first antigen, and at least a second region (e.g. derived from a variable region of a second antibody) that is specific for a second antigen.
- a bispecific antibody specifically binds to two target antigens and is thus one type of multispecific antibody, Multispecific antibodies, which recognize two or more different antigens, can be produced by recombinant DNA methods or include, but are not limited to, antibodies produced chemically by any convenient method.
- Bispecific antibodies include all antibodies or conjugates of antibodies, or polymeric forms of antibodies which are capable of recognizing two different antigens.
- Bispecific antibodies include antibodies that have been reduced and reformed so as to retain their bivalent characteristics and to antibodies that have been chemically coupled so that they can have several antigen recognition sites for each antigen such as BiME ⁇ Bispecific Macrophage Enhancing antibodies), BiTE (bispecific T cell engager), DART (Dual affinity retargeting); DNL (dock-and-lock), DVD-lg (dual variable domain immunoglobulins), HAS (human serum albumin), kih (knobs into holes).
- BiME ⁇ Bispecific Macrophage Enhancing antibodies biTE (bispecific T cell engager), DART (Dual affinity retargeting); DNL (dock-and-lock), DVD-lg (dual variable domain immunoglobulins), HAS (human serum albumin), kih (knobs into holes).
- the four human IgG isotypes bind the activating Fey receptors (FcyRI, FcyRlla, FcyRllla), the inhibitory FcyRllb receptor, and the first component of complement (Clq) with different affinities, yielding very different effector functions. Binding of IgG to the FcyRs or Clq depends on residues located in the hinge region and the CH2 domain. Two regions of the CH2 domain are critical for FcyRs and Clq binding, and have unique sequences in lgG2 and lgG4.
- a "modified antibody” corresponds to a molecule comprising an antibody or an antigen-binding fragment thereof, wherein said monoclonal antibody or functional fragment thereof is associated with a functionally different molecule.
- a modified antibody of the invention may be either a fusion chimeric protein or a conjugate resulting from any suitable form of attachment including covalent attachment, grafting, chemical bonding with a chemical or biological group or with a molecule, such as a PEG polymer or another protective group or molecule suitable for protection against proteases cleavage in vivo, for improvement of stability and/or half-life of the antibody or functional fragment.
- PEGyiation can be site specific to prevent interference with the recognition sites of the antibodies or functional fragments, and can be performed with high molecular weight PEG. PEGyiation can be achieved through free cysteine residues present in the sequence of the antibody or functional fragment or through added free Cysteine residues in the amino sequence of the antibody or functional fragment.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that is modified.
- an affitin library may be generated and subjecting the resulting protein library to rounds of ribosome display, the affinity can be directed towards various targets, such as peptides, proteins, viruses and bacteria.
- Affitins are antibody mimetics and are being developed as tools in biotechnology. They have also been used as specific inhibitors for various enzymes (Krehenbrink et al., i. mol. Biol., 383:5, 2008).
- Anticalins are artificial proteins that are able to bind to antigens, either to proteins or to small molecules. They are antibody mimetic derived from human lipocalins which are a family of naturally binding proteins. Anticatins are about eight times smaller with a size of about 180 amino acids and a mass of about 20 kDa (Skerra, Febs J., 275:11, 2008).
- Anticalin phage display libraries have been generated which allow for the screening and selection, in particular of anticaiins with specific binding properties.
- the skilled person may readily develop affitins with the required binding properties using methods know in the art, in particular as disclosed in EP patent EP1270725 Bl , US patent US8536307 B2, (Schlehuber and Skerra, Biophys. Chem., 96:2-3, 2002) and the above-cited publication, in particular the generation of phage display and/or ribosome display libraries and their screening using an antigen as dislosed herein.
- Anticaiins and affitins may both be produced in a number of expression system comprising bacterial expressin systems.
- the invention provides affitins, anticaiins and other similar antibody mimetics with the features of the antibodies described herein, in particular with regard to the binding to SIRPa, the inhibition of the interaction between SIRPa and CD47, the non-binding to SIRPg, the non binding to T cells, the non inhibition of the proliferation of T cells, the non inhibition of the interaction between SIRPg and CD47 all of which are contemplated as macromo!ecules of the invention.
- epitopes of protein antigens can be divided into two categories, conformational epitope and linear epitope.
- a conformational epitope corresponds to discontinuous sections of the antigen's amino acid sequence.
- a linear epitope corresponds to a continuous sequence of amino acids from the antigen.
- the peptides that are present within SIRPa and that are bound by the anti-SIRPa antibodies are constitutive of the epitope specifically recognized by these antibodies.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to the peptide comprising or consisting of amino acid sequence SEQ ID NO: 3 (KFRKGSPD[DV]/[T]E) within SIRPa and to at least one peptide comprising or consisting of amino acid sequence selected from the group consisting of SEQ ID NO: 1 (SLIPVGP), SEQ ID NO: 2 (G/ARELIYNQKEGH), SEQ ID NO: 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 ⁇ ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE) within SIRPa.
- SEQ ID NO: 1 SEQ ID NO: 1
- SEQ ID NO: 2 G/ARELIYNQKEGH
- SEQ ID NO: 4 QHTVSFTCESHGFSPRDITLKWF
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that specifically binds to the peptides of SEQ ID NO: 1 (SLIPVGP), SEQ ID NO: 7 (GREUYNQKEGH), SEQ ID NO: 8 (KFRKGSPDDVE), SEQ ID NO: 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE) within SIRPa.
- SEQ ID NO: 1 SEQ ID NO: 1
- SEQ ID NO: 7 GREUYNQKEGH
- SEQ ID NO: 8 KFRKGSPDDVE
- SEQ ID NO: 4 QHTVSFTCESHGFSPRDITLKWF
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO: 6 YPQRLQLTWLE
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to at least one peptide comprising or consisting of amino acid sequence selected from the group consisting of SEQ ID NO: 1 (SLIPVGP), SEQ ID NO: 9 (AREUYNQKEGH), SEQ ID NO: 10 (KFRKGSPDTE), SEQ ID NO: 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE).
- SEQ ID NO: 1 SEQ ID NO: 9
- SEQ ID NO: 10 KFRKGSPDTE
- SEQ ID NO: 4 QHTVSFTCESHGFSPRDITLKWF
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO: 6 YPQRLQLTWLE
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that specifically binds to the peptides of SEQ ID NO: 1 (SLIPVGP), SEQ ID NO: 9 (ARELIYNQKEGH), SEQ ID NO: 10 (KFRKGSPDTE), SEQ ID NO: 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE) within SIRPa.
- SEQ ID NO: 1 SEQ ID NO: 9
- SEQ ID NO: 10 KFRKGSPDTE
- SEQ ID NO: 4 QHTVSFTCESHGFSPRDITLKWF
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO: 6 YPQRLQLTWLE
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to at least one peptide comprising or consisting of amino acid sequence selected from the group consisting of SEQ ID NO: 1 (SLIPVGP), SEQ ID NO: 11 (GRELIYN), DVE, SEQ ID NO: 12 (HTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE) within SIRPa.
- SEQ ID NO: 1 SEQ ID NO: 1
- SEQ ID NO: 11 GRELIYN
- DVE SEQ ID NO: 12
- SEQ ID NO: 12 HTVSFTCESHGFSPRDITLKWF
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO: 6 YPQRLQLTWLE
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that specifically binds to the peptides of SEQ ID NO: 1 (SUPVGP), SEQ ID NO: 11 (G RELIYN), DVE, SEQ I D NO: 12 (HTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE) within SIRPa.
- SUPVGP SEQ ID NO: 11
- DVE SEQ I D NO: 12
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO: 6 YPQRLQLTWLE
- the invention relates to an a nti-SI RPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to at least one peptide com prising or consisting of amino acid sequence selected from the group consisting of SEQ ID NO: 1 (SUPVGP), SEQ ID NO: 13 (ARELIYN), SEQ I D NO: 12 ( HTVSFTCESHG FSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO : 6 (YPQRLQLTWLE) within SIRPa.
- SUPVGP SEQ ID NO: 1
- SEQ ID NO: 13 ARELIYN
- SEQ I D NO: 12 HTVSFTCESHG FSPRDITLKWF
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO : 6 YPQRLQLTWLE
- the invention relates to an anti-SIRPa a ntibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that specifically binds to the peptides of SEQ ID NO: 1 (SUPVGP), SEQ I D NO: 13 (ARELIYN), SEQ ID NO: 12 (HTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE) within SIRPa.
- SUPVGP SEQ I D NO: 13
- SEQ ID NO: 12 HTVSFTCESHGFSPRDITLKWF
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO: 6 YPQRLQLTWLE
- SEQ ID NO: 1 SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ I D NO: 12 and SEQ ID NO: 13 correspond to linear epitopes.
- linear epitopes have been identified by the inventors by array-based oligopeptide scanning (sometimes called overlapping peptide scan or pepscan a nalysis). This technique uses a libra ry of oligo-peptide sequences from overlapping and non-overlapping segments of a target protein and tests for their ability to bind the antibody of interest.
- discontinuous epitopes can be mapped with very high reliability and precision (Gaseitsiwe et a l., 2010 - Clin Vaccine Im munol. Ja n; 17(1): 168-175). All of the tested antibodies of the invention, including HEFLB, specifically bind to said epitopes.
- the invention relates to an anti-SIRPa a ntibody or a ntigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that specifically binds to a conformational epitope comprising at least one peptide selected from the group consisting of SEQ ID NO: 70 (ELIYNQKEGHFPR), SEQ ID NO: 71 ( RN N M DFSIRIGN) and SEQ ID NO: 72 (SPRDITLKW) within SIRPa .
- SEQ ID NO: 70 ELIYNQKEGHFPR
- SEQ ID NO: 71 RN N M DFSIRIGN
- SPRDITLKW SEQ ID NO: 72
- the invention in an em bodiment, relates to an a nti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding a ntibody mimetic as defined above that specifically binds to a conformational epitope comprising or consisting of the peptides of SEQ ID NO: 70 (ELIYNQKEGHFPR), SEQ ID NO: 71 (RNNMDFSIRIGN) and SEQ ID NO: 72 (SPRDITLKW) within SIRPa.
- SEQ ID NO: 70 ELIYNQKEGHFPR
- SEQ ID NO: 71 RNMDFSIRIGN
- SPRDITLKW SEQ ID NO: 72
- I n a n embodimen the invention relates to an a nti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that specifically binds to a conformational epitope comprising at least one peptide selected from the group consisting of SEQ ID NO: 70 (ELIYNQKEGHFPR) and SEQ ID NO: 71 (RNNMDFSIRIGN).
- the invention relates to an anti-S!RPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that specifically binds to a conformational epitope comprising at least one peptide selected from the group consisting of SEQ ID NO: 73 (YNQK) and "SI " within SIRPa.
- the peptides of SEQ ID NO: 70, SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73 and SIRP correspond to conformational epitopes. These conformational epitopes have been determined by the inventors using proteolysis protection procedures (enzymatic digestion: chymotrypsin, trypsin of the antibody- antigen complex immobilized on affinity chromatography) following by mass spectrometry analyses (MALDI-TOF/TOF) to detect and sequence such peptides of interest, as well known by one skilled in the art (Van de Water et a!., Clinical Immunology and Immunopatho!ogy, 1997, vol. 85).
- the antigen used was the human SIRPa ⁇ accession numbers NP_542970) and one of the antibodies of the invention used was the HEFLB variant.
- the anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic according to the invention specifically bind said conformational epitopes comprising or consisting of said peptides in their conformational arrangement within the native SIRPa.
- the peptide of amino acid sequence set forth in SEQ ID NO: 73 corresponds to the peptide consisting of amino acids at position 80 to 83 in the human SiRPa amino acid sequence referenced by the NP_542970 accession number.
- the peptide of SIR amino acid sequence corresponds to the peptide consisting of amino acids at position 105 to 107 in the human SIRPa amino acid sequence referenced by the NP_542970 accession number.
- SIRPa refers to a SIRPa protein from a mammal species, preferably a human SIRPa (e.g. accession numbers NP_542970 (P78324) and CAA71403).
- anti-SIRPa antibody refers to an antibody which specifically binds to SIRPa, in particular to a human SIRPa.
- the specific binding between the antibody or antigen-binding fragment thereof of the invention and the epitope (or the region comprising the epitope) implies that the antibody exhibits appreciable affinity for the epitope (the region comprising the epitope) on a particular protein or antigen (here Sl Pa ⁇ .
- Appreciable affinity includes binding with an affinity of about 10 9 (KD) or stronger.
- binding is considered specific when the binding affinity is between 10 "9 and 10 "12 M, optionally between 10 "9 M and 10 "10 M, in particular 10 10 M.
- Whether a binding domain specifically reacts with or binds to a target can be tested readily by, inter alia, comparing the reaction of said binding domain with a target protein or antigen with the reaction of said binding domain with proteins or antigens other than the target protein.
- the affinity can be determined by various methods well known from the one skilled in the art. These methods include, but are not limited to, Biacore Analysis, Blitz analysis and Scatchard plot.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that has a KD value inferior to 10 "9 M, preferably inferior to 10 '10 M for SlRPa, more preferably inferior to 1.10 "11 M, particularly by Biacore Analysis.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that decreases the interaction between SlRPa and CD47.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that partially or fully, in particular fully, inhibits the binding of CD47 to SlRPa, in particular of human CD47 to human SlRPa.
- Such an antibody of the invention specifically binds SlRPa and antagonizes the interaction between SlRPa and CD47.
- the anti-SIRPa antagonist antibody of the invention is capable of reducing or inhibiting the binding of CD47 to SlRPa by at least 50%, 60%, 70%, preferably 80%, more preferably 90% or most preferably 100%, as compared- to a negative control molecule, in a binding assay.
- the anti-SIRPa antagonist antibody of the invention is capable of reducing or inhibiting the binding of CD47 to SlRPa by from 50% to 100%, preferably from 60% to 90%, more preferably from 70% to 80%, as compared to a negative control molecule, in a binding assay.
- the invention relates to an anti-SIRPa antibody as defined above that has an !C50 lower than 500 ng/ml, in particular lower than 400 ng ml, 300 ng/ml, more particularly lower than 5 200 ng/ml, as determined in a competitive SIRPa binding assay between CD47 and the anti-SIRPa antibody by EUSA.
- Such an antibody of the invention does not affect or does not prevent the interaction between SIRPg and CD47.
- SIRPg relates to a signal regulatory protein gamma (also designated SIRP gamma, CD172g or SIRP beta 2), from a mammal species, preferably a human SIRPg.
- a reference sequence of the human SIRPg protein, used in the examples of the present application, corresponds to the sequence associated to the Accession number Q9P1W8.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that does not significantly inhibit, antagonize, the binding of CD47 to SIRP-g, that does not significantly compete with the binding of CD47 to SIRPg.
- This antagonist effect can be determined using the methods as defined the examples of the present application.
- an antibody does not antagonize the binding of CD47 to SIRPg if said antibody (or antigen-binding fragment thereof or antigen-binding antibody mimetic) induces no increase, or induces an increase inferior to 1 log, of the KD value of CD47 in a StRPg binding competitive assay by Blitz.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that does not specifically bind to T- cells, in particular to CD3+ T-cel!s.
- an anti-SIRPa antibody ⁇ or antigen-binding fragment thereof or antigen-binding antibody mimetic does not specifically bind to human T cells if, in a population of human T cells isolated from PB C from a healthy donor, less than 10%, preferably less than 5%, 10 more preferably less than 2%, most preferably less than 1% of the population of human T cells are recognized by said anti-SIRPa antibody (or antigen-binding fragment thereof or antigen-binding antibody mimetic).
- an anti-SIRPa antibody does not significantly inhibit the proliferation of T ⁇ cells if the proliferation of T-cells is reduced by less than 30%, preferably less than 20 20%, more preferably less than 10%, most preferably less than 5% as compared with a negative control.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that does not significantly inhibit, antagonize, the binding of the surfactant proteins to SIRP-a, that does not significantly compete with the binding of the surfactant proteins to SIRPa.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that does not antagonize the interaction between the surfactant proteins and SIRPa.
- SIRPa The competition between SIRPa and surfactant proteins can be determined by competitive assay using methods we!l known from the one skilled in the art. These methods include, but are not limited to, Biacore Analysis, Blitz analysis and ELiSA assay.
- the invention relates to an anti-S!RPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that weakly binds, or does not specifically bind to SIRPb.
- a reference sequence of the human SIRPb protein, used in the examples of the present application, corresponds to the sequence associated to the Accession number Q5TFQ8-1.
- the invention relates to an anti-S!RPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that has KD value superior to 10 "9 M, preferably superior to lfj s for SIRPb, in particular by Blitz analysis.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that comprises:
- a heavy chain comprising HCDR1, HCDR2 and HCDR3, and/or
- - HCDR3 comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 17 (GGTGTMAWFAY),
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that comprises:
- - HCDR2 comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 16 (NIDPSDSDTHYSPSFQG),
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that comprises:
- a heavy chain comprising HCDRl, HCDR2 and HCDR3, and/or
- - HCDR2 comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 16 (NIDPSDSDTHYSPSFQG),
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that comprises:
- a heavy chain comprising HCDRl, HCDR2 and HCDR3, and/or
- - HCDR2 comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 16 ( N I D SDSDTH YSPS FQG ⁇ ,
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that comprises:
- a heavy chain comprising HCDRl, HCDR2 and HCDR3, and/or
- - HCDR2 comprising or consisting of the amino acid sequence set forth in SEQ ID NO: 16 (N!DPSDSDTHYSPSFQG),
- the anti-SIRPa antibodies of the invention may have a heavy chain variable region comprising the amino acid sequence of HCDRl and/or HCDR2 and/or HCDR3 of the human antibodies as provided herein; and/or a light chain variable region comprising the amino acid sequence of LCDR1 and/or LCDR2 and/or LCDR3 of the human antibodies as provided herein.
- the antibody comprises an amino acid sequence variant of one or more of the CDRs of the provided human antibodies, which variant comprises one or more amino acid insertion(s) within or adjacent to a CDR residue and/or deietion(s) within or adjacent to a CDR residue and/or substitution(s) of CDR residue ⁇ s) (with substitution(s) being the preferred type of amino acid alteration for generating such variants).
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that comprises:
- a heavy chain variable domain comprising or consisting of the amino acid sequence selected from SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, and/or
- - a light chain variable domain comprising or consisting of the amino acid sequence selected from the group consisting of SEQ ID NO: 31, SEQ ID NO: 32 and SEQ ID NO: 33.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that comprises:
- a heavy chain variable domain comprising or consisting of the amino acid sequence selected from the group consisting of SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30, and
- - a light chain variable domain comprising or consisting of the amino acid sequence selected from the group consisting of SEQ ID NO: 31, SEQ ID NO: 32 and SEQ ID NO: 33.
- Table 1 Examples of heavy chain variable domains and light chain variable domains of antibodies according to the invention.
- the sequences of the variable domains of the antibodies exemplified in the present invention can be deduced from the combinations of the sequences shown in Table 2.
- the antibody or antigen-binding fragment or antigen-binding antibody mimetic has no substitution of the amino acid W at position 33 (W33) in the heavy chain variable domain, said position being identified with respect to SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 or SEQ ID NO: 30, and/or no substitution of the amino acids Y at position 39 (Y39), R at position 55 (R55) and/or F at position 60 (F60) in the light chain variable domain, said positions being identified with respect to SEQ ID NO: 31, SEQ ID NO: 32 or SEQ ID: 33, in particular has no substitution at position W33 in the heavy chain variable domain and no substitution at positions Y39, R55 and F60 in the light chain variable domain.
- the antibodies can be produced with any heavy chain and Iight chain constant domains.
- the anti-human SI Pa antibody of the invention is a humanized monoclonal antibody, in particular wherein the antibody light chain constant domain is derived from a human kappa Iight chain constant domain, more particularly wherein the light chain constant domain consists of the sequence of SEQ ID NO: 35, and wherein the antibody heavy chain constant domain is derived from a human IgGl, lgG2, lgG3, or lgG4 (wild type or mutated) heavy chain constant domain, in particular from a human lgG4 heavy chain constant domain, more particularly wherein the antibody heavy chain constant domain consists of the sequence with SEQ ID NO: 34.
- IgG isotypes of the heavy chain constant domain centers on whether specific functions are required and the need for a suitable in vivo ha!f-life.
- antibodies designed for selective eradication of cancer cells typically require an active isotype that permits complement activation and effector-mediated cell killing by antibody- dependent cell-mediated cytotoxicity.
- fragment crystallisable (Fc) region interacts with a variety of accessory molecules to mediate indirect effector functions such as antibody-dependent cellular cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP) and complement-dependent cytotoxicity (CDC).
- ADCC antibody-dependent cellular cytotoxicity
- ADCP antibody-dependent cellular phagocytosis
- CDC complement-dependent cytotoxicity
- the invention relates to an anti-SIRPa antibody as defined above that comprises:
- VPSSSLGTKTYTCN VDH KPSNTKVDKR VESKYG PP CPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSQEDPEVQFN WYVDGVEVHNAKTKPREE QF STYRVVSVLTVLHQD WLNG KEYKCKVSNKGL PSSIEKT!SKAKGQP EPQVYTLPPSQEEMTKNQVS
- HE humanized variant
- VVDVSQE DPEVQFNWYVDGVEVH NAKTKP REEQ FNSTYRVVSVLTVLHQD WLNG KEYKCKVS KG L S SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLT CLVKG FYPSDI AVE WESNGQPE N NYKTTPPVLDSD GSFFLYSRLTVDKSR WQEG NVFSCSVM H EALH H YTQKSLSLSPGK
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above that is able to induce the differentiation of monocytic myeloid-derived suppressor cells ( o-MDSC) into non suppressive cells.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, wherein said non suppressive cells secrete pro-inflammatory cytokines such as IL6, 1L12 and TNF, and no or low level of antiinflammatory cytokines such as IL10 and TGF .
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, wherein said non suppressive cells express iNOS.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, wherein said non suppressive cells do not express the M HC Class !! markers and express the markers CD80-CD86.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, wherein said non suppressive cells express at least one marker of the natural killer (NK) cells.
- NK natural killer
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, wherein said antibody or antigen- binding fragment thereof is able to inhibit 2 polarization of macrophages and/or favors pro- inflammatory M l-type macrophages.
- the antibodies of the invention can modify the macrophage polarization in order to induce a proinflammatory environment, i.e. they can inhibit the anti-inflammatory signal provided by M2-type macrophages and/or favor the pro-inflammatory signal provided by Ml-type macrophages This approach allows to reestablish an inflammatory environment favorable to the action of the T effector cells, in particular in eliminating the cancer ceils.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to a conformational epitope comprising at least one peptide selected from the group consisting of SEQ ID NO: 70 (EUYNQKEGHFPR), SEQ ID NO: 71 (RNNMDFSIRIGN) and SEQ ID NO: 72 (SPRDITLKW) within SIRPa.
- SEQ ID NO: 70 EUYNQKEGHFPR
- SEQ ID NO: 71 RNMDFSIRIGN
- SPRDITLKW SEQ ID NO: 72
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to a conformational epitope comprising or consisting of the peptides of SEQ ID NO: 70 (EUYNQKEGHFPR), SEQ ID NO: 71 (RNNMDFSIRIGN) and SEQ ID NO: 72 (SPRDITLKW) within SIRPa.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to a conformational epitope comprising at least one peptide selected from the group consisting of SEQ ID NO: 70 (EUYNQKEGHFPR) and SEQ ID NO: 71 (RNNMDFSIRIGN),
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to a conformational epitope comprising or consisting of the peptides of SEQ ID NO: 70 (EUYNQKEGHFPR ⁇ and SEQ ID NO: 71 (RNNMDFSIRIGN) within SIRPa.
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specifically binds to a conformational epitope comprising at least one peptide selected from the group consisting of SEQ ID NO: 73 (YNQK) and SIR.
- the invention relates to an anti-S!RPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that specificaliy binds to a conformational epitope comprising or consisting of the peptides of SEQ ID NO: 73 (YNQK) and SIR within SIRPa,
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic that comprises:
- a heavy chain comprising HCDR1, HCDR2 and HCDR3, and/or
- - HCDR1 comprising or consisting of a peptide of the amino acid sequence SEQ ID NO: 14 (SYWVH),
- - HCDR2 comprising or consisting of a peptide of the amino acid sequence SEQ ID NO: 15 (NIDPSDSDTHYNQKFKD) or SEQ ID NO: 16 (NiDPSDSDTHYSPSFQG),
- - HCDR3 comprising or consisting of a peptide of the amino acid sequence SEQ ID NO: 17 (GGTGTMAWFAY), SEQ ID NO: 18 (GGTGTLAWFAY), SEQ ID NO: 19 (GGTGTMAYFAY) or SEQ ID NO: 20 (GGTGTLAYFAY),
- - LCDR2 comprising or consisting of a peptide of the amino acid sequence SEQ ID NO: 22 (RVSNRFS), and
- the invention also relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen- binding antibody mimetic which inhibits the binding of CD47 to SI RPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg, in particular which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and which does not bind specifically to T-cells and which does not inhibit the proliferation of T-cells and which does not inhibit the binding of CD47 to SIRPg.
- the invention relates to:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SiRPg and/or which does not bind specifically to T-cel!s and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SiRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- the present invention also relates to the use of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-celis and/or which does not inhibit the binding of CD47 to SIRPg,
- the invention relates to:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- a condition susceptible of being improved or prevented by differentiating monocytic myeloid-derived suppressor celis corresponds to a cancer including inflammatory cancers and cancers with infiltrated myeloid cells (in particular with infiltrated MDSCs and/or TAM cells), an infectious disease, a trauma, an auto-immune disease (such as rheumatoid arthritis, type 1 diabetes, lupus, psoriasis), a vaccination, a chronic inflammatory diseases (such as Inflammatory bowel diseases including Crohn disease and Ulcerative colitis), a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV), fibrosis, atherosclerosis or a transplant dysfunctions.
- the present invention also relates to a method of treatment of any condition susceptible of being improved or prevented by differentiating monocytic myeloid-derived suppressor cells (Mo-MDSC) into non suppressive cells in a subject in need thereof comprising administering to said subject an effective amount of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- the present invention also relates to the use of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to S!RPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- SIRPg which does not bind specifically to T-cells and which does not inhibit the proliferation of T- cells and which does not inhibit the binding of CD47 to SIRPg
- Mo-MDSC monocytic myeloid-derived suppressor ceils
- the invention relates to:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- SIRPa acts as a checkpoint inhibitor and participates to macrophage polarization.
- M2 pro-inflammatory (IL4)
- an antagonist of SIRPa is able to inhibit M2 phenotypic polarization of macrophages and/or favors pro-inflammatory l-type macrophage function and can be used in therapeutic.
- a condition susceptible of being improved or prevented by modifying macrophage polarization to favor pro-inflammatory macrophages corresponds for example to a solid cancer, a liquid cancer, an infectious disease, a trauma, an auto-immune disease, a vaccination, a brain injury, a nerve injury, a polycythemia, a hemochromatosis or a chronic inflammatory disease.
- the present invention also relates to a method of treatment of any condition susceptible of being improved or prevented by modifying macrophage polarization to pro-inflammatory macrophages in a subject in need thereof comprising administering to said subject an effective amount of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- SIRPg which does not bind specifically to T-ceils and which does not inhibit the proliferation of T- cells and which does not inhibit the binding of CD47 to SIRPg.
- the invention also relates to the use of :
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- Modifying the polarization of macrophages to favor pro-inflammatory cells can be useful in a number of pathologies or situations. As described above, this modification is particularly useful in the context of cancers, to restore an anti-tumor activity of macrophages and/or prevent the pro-tumoral activity of M2-type macrophages. Inappropriate immune responses due to an excess of 2-type macrophage polarization also occur in infectious diseases, fibrosis, vaccination, trauma and chronic inflammatory diseases.
- anti-SIRPa antibody can be used to treat an individual who has a cancer selected from the group consisting of lung cancers, mesothelioma cancers, ovary cancers, liver cancers, bladder cancers, brain cancers, breast cancers, colon cancers, sarcomas, pancreas cancers, head and neck cancers, kidney cancers, thymomas, gliomas, melanomas and hematologic cancers such as lymphomas (Hodgkin's lymphoma and non-Hodgkin's lymphoma), ieukemias such as T and B Acute or Chronic Lymphoblastic Leukemia (ALL or CLL) or Acute or Chronic myeloid leukemia ⁇ AML or C L) and Myelomas.
- a cancer selected from the group consisting of lung cancers, mesothelioma cancers, ovary cancers, liver cancers, bladder cancers, brain cancers, breast cancers, colon cancers, s
- the invention relates to:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to S!RPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- a pathology selected from the group consisting of a cancer (tn particular inflammatory cancers and cancers with infiltrated myeloid cells particularly with infiltrated SvlDSCs and/or TAM cells), an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV), fibrosis, atherosclerosis, obesity, type I! diabetes and a transplant dysfunction.
- a cancer tumor necrosis, fibrosis, atherosclerosis, obesity, type I! diabetes and a transplant dysfunction.
- the invention relates to a method of treatment of a pathology selected from the group consisting of a cancer (in particular inflammatory cancers and cancers with infiltrated myeloid ceils particularly with infiltrated MDSCs and/or TAM cells), an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV), fibrosis, atherosclerosis, obesity, type II diabetes and a transplant dysfunction in a subject in need thereof comprising administering to said subject an effective amount of:
- a cancer in particular inflammatory cancers and cancers with infiltrated myeloid ceils particularly with infiltrated MDSCs and/or TAM cells
- an infectious disease a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury,
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, or - an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic, which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SiRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg
- the invention relates to the use of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- a cancer in particular inflammatory cancers and cancers with infiltrated myeloid cells particularly with infiltrated MDSCs and/or TAM cells
- an infectious disease a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV), fibrosis, atherosclerosis, obesity, type li diabetes and a transplant dysfunction.
- the invention relates to an anti-human SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, for its uses as defined above, wherein said anti-human SIRPa antibody or antigen-binding fragment thereof or antigen- binding antibody mimetic of the invention is administered to a patient presenting a SIRPa-positive tumor.
- the invention relates to:
- an antt-S!RPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- the invention relates to a method of vaccination of a subject comprising administering to said subject an effective amount of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-ceNs and/or which does not inhibit the binding of CD47 to SIRPg,
- the invention relates to the use of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- Suppressive myeloid cells limit the effectiveness of vaccination, especially in young children.
- an anti-SiRPa /g would limit the benefit provided by an anti-SIRPa on the vaccine response, preventing T lymphocytes from responding to vaccination.
- the antibody or antigen-binding fragment thereof of the invention can be administered in a variety of suitable routes, e.g., intravenously (IV), subcutaneously (SC), or, intramuscuiarly (IM) to the subject.
- IV intravenously
- SC subcutaneously
- IM intramuscuiarly
- the antibody or antigen-binding fragment thereof can be administered alone or in combination with another therapeutic agent, e.g., a second human monoclonal antibody or antigen binding fragment thereof, in another example, the antibody is administered together with another agent, for example, an immunosuppressive agent, an erythropoiesis-stimuiating agent (ESA), in combination with therapeutic cell compositions, and the like.
- ESA erythropoiesis-stimuiating agent
- the invention relates to an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic for its use as defined above, wherein the anti-SIRPa antibody or antigen-binding fragment is combined with a second therapeutic agent.
- anti-SIRPa antibodies of the present invention can be combined with some other potential strategies for overcoming tumor immune evasion mechanisms with agents in clinical development or already on the market (see table 1 from Antonia et al. Immuno-oncoiogy combinations: a review of clinica! experience and future prospects. Clin. Cancer Res. Off. J, Am. Assoc. Cancer Res. 20, 6258-6268, 2014):
- 2- Switching on adaptive immunity promoting T-cell costimulatory receptor signaling using agonist molecules, in particular antibodies
- agonist molecules including agonist anti ⁇ CD137 (anti-4-lBB) antibodies or CD137 (4-1BB) ligands ;
- the administration of the second therapeutic agent can be simultaneous or not with the administration of the anti-SIRPa antibody.
- a coadministration can be prepared in the form of a combination drug (product), also known as a "combo".
- a combo is a fixed-dose combination that includes two or more active pharmaceutical ingredients combined in a single dosage form, which is manufactured and distributed in fixed doses. But the dose regimen and/or the administration route can also differ.
- this second therapeutic agent is selected from the group consisting of chemotherapeutic agents, radiotherapy agents, immunotherapeutic agents, cell therapy agents (such as CAR-T cells), antibiotics and probiotics.
- immunotherapeutic agents useful in the context of the invention are selected from the group consisting of therapeutic vaccines (DNA, RNA or peptide vaccins), immune checkpoint blockers or activators, in particular of adaptive immune cells (T or B lymphocytes) or immunoconjugates such as antibody-drug conjugates.
- therapeutic vaccines DNA, RNA or peptide vaccins
- immune checkpoint blockers or activators in particular of adaptive immune cells (T or B lymphocytes) or immunoconjugates such as antibody-drug conjugates.
- T or B lymphocytes adaptive immune cells
- immunoconjugates such as antibody-drug conjugates.
- immunotherapeutic agents refers in particuiar to agents that could take cancer vaccines from interesting biological phenomena to effective therapeutic agents including: T- cell growth factors to increase number and repertoire of naive T cells, growth factors to increase the number of dendritic cells (DCs), agonists to activate DCs and other antigen-pre senting ceils (APCs), adjuvants to allow and augment cancer vaccines, agonists to activate and stimulate T cells, inhibitors of T-ce!l checkpoint blockade, T-cell growth factors to increase the growth and survival of immune T cells, agents to inhibit, block, or neutralize cancer cell and immune ce!l-derived immunosuppressive cytokine.
- T- cell growth factors to increase number and repertoire of naive T cells
- DCs dendritic cells
- APCs antigen-pre senting ceils
- adjuvants to allow and augment cancer vaccines
- agonists to activate and stimulate T cells inhibitors of T-ce!l checkpoint blockade
- T-cell growth factors to increase the growth and
- immune checkpoint blocker or activator examples of immune checkpoint blockers or activators of adaptive immune cells (8 or T lymphocytes) that could be useful are anti-PDLl, anti-PDl, anti-CTLA4, anti-CD137, anti-CD2, anti- CD28, anti-CD40, anti-HVE , anti-BTLA, anti-CD160, ants-TIGiT, anti ⁇ TIM-l/3, anti-LAG-3, anti-2B4, and anti-OX40, anti-CD40 agonist, CD40-L, TLR agonists, anti-ICOS, ICOS-L and B-celi receptor agonists, in particular anti-PDLl, anti-PDl, anti-CD137.
- Said immunotherapeutic agent can also be an antibody targeting tumoral antigen, particularly selected from the group consisting of anti-Her2, anti-EGFR, anti-CD20, anti-CD19, anti-CD52.
- the antibody may be provided at an effective dose from about 1 ng/kg body weight to about 30 mg/kg body weight, or more.
- the dosage may range from 1 ⁇ g/k to about 20 mg/kg, optionally from 10 g/kg up to 10 mg/kg or from 100 g/kg up to 5 mg/kg.
- an effective dose or “effective dosage” or “effective amount” is defined as an amount sufficient to achieve or at least partially achieve the desired effect.
- the term “effective dose” is meant to encompass an amount sufficient to cure or at least partially arrest the disease and its complications in a patient already suffering from the disease. Amounts or doses effective for this use will depend on the condition to be treated, the delivered antibody construct, the therapeutic context and objectives, the severity of the disease, prior therapy, the patient's clinical history and response to the therapeutic agent, the route of administration, the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient, and the general state of the patient's own immune system. The proper dose can be adjusted such that it can be administered to the patient once or over a series of administrations, and in order to obtain the optimal therapeutic effect.
- Dosing for such purposes may be repeated as required, e.g. daily, semi-weekly, weekly, semimonthly, monthly, or as required during relapses.
- the invention also relates to:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above, or - an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SiRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-ceils and/or which does not inhibit the proliferation of T-ceils and/or which does not inhibit the binding of CD47 to SIRPg
- a diagnostic test for use in a diagnostic test, particularly in personalized medicine, more particularly in a companion diagnostic test.
- the invention relates to a method of diagnostic, particularly in personalized medicine, more particularly in a companion diagnostic test, using:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SIRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- the invention relates to the use of:
- an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic which inhibits the binding of CD47 to SfRPa and which does not bind specifically to SIRPg and/or which does not bind specifically to T-cells and/or which does not inhibit the proliferation of T-cells and/or which does not inhibit the binding of CD47 to SIRPg,
- the invention also relates to an in vitro or ex vivo method of diagnosis, in particular a method of diagnostic suitable for use in personalized medicine, more particularly in a companion diagnosis, wherein an anti-SIRPa antibody or an antigen-binding fragment thereof or an antigen- binding mimetic thereof of the invention is used for the detection of SIRPa+ ceils in a sample previously obtained from a subject and optionally for the quantification of the expression of SIRPa.
- the invention also relates to the use of an anti-SiRPa antibody or an antigen-binding fragment thereof or an antigen-binding mimetic of the invention, in the manufacture of a medicament suitable for use in a diagnostic test, in particular for use in personalized medicine, or in a companion diagnostic test.
- the invention also relates to the use of at least one anti-human SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic of the invention, as a means for determination of the expression and/or level of expression of SIRPa in a biological sample previously obtained from an individual.
- the invention also relates to an in vitro or ex vivo method to determine a SIRPa positive cells in a subject from a biological sample previously obtained from said subject, comprising:
- SIRPa in vitro the expression and/or the level of expression of SIRPa, in a biological sample previously obtained from said subject using the anti-human SIRPa antibody or antigen- binding fragment thereof or antigen-binding antibody mimetic of the invention.
- the invention also relates to the use, in particular in vitro or ex vivo, of at least one anti- human SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic of the invention in a method wherein SIRPa is used as a biomarker that is predictive for the response to a treatment in a subject, in particular in a cancer subject.
- the invention also relates to an in vitro or ex vivo method of predicting the response of a cancer subject to a treatment, in particular with anti-human SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic of the invention, comprising:
- the invention also relates to a method of in vitro or ex vivo determining the presence of SIRPa+ cells in a sample previously obtained from a subject which comprises determining presence of SIRPa as a biomarker that is predictive for the response of a subject to a treatment, in particular a response of a subject diagnosed with a cancer, wherein said method comprises: - determining the expression levef of SIRPa in a tumor sample previously obtained from a subject, in particular with anti-human SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined in any one of claims 1 to 13, and
- the invention in another aspect, relates to a pharmaceutical composition
- a pharmaceutical composition comprising an antibody or antigen-binding fragment thereof as defined above and a pharmaceutically acceptable carrier.
- a "pharmaceutical composition” is meant to encompass a composition suitable for administration to a subject or patient, such as a mammal, especially a human.
- a “pharmaceutical composition” is sterile and is usually free of contaminants that are capable of eliciting an undesirable response within the subject ⁇ e.g., the compound(s) in the pharmaceutical composition is pharmaceutical grade).
- Pharmaceutical compositions can be designed for administration to subjects or patients in need thereof via a number of different routes of administration including oral, buccal, rectal, parenteral, intraperitoneal, intradermal, intracheal and the like.
- a "pharmaceutically acceptable carrier” is meant to encompass an excipient, diluent, carrier, and adjuvant that are useful in preparing a pharmaceutical composition that are generally safe, non-toxic and neither biologically nor otherwise undesirable, and include an excipient, diluent, carrier, and adjuvant that are acceptable for veterinary use as well as human pharmaceutical use.
- a pharmaceutically acceptable carrier includes both one and more than one such excipient, diluent, carrier, and adjuvant.
- the invention relates to a pharmaceutical composition which comprises as an active ingredient an antibody or antigen-binding fragment thereof as defined above and a pharmaceutically acceptable carrier.
- the invention relates to a therapeutic means, in particular a combination product means, which comprises as active ingredients: an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above and a second therapeutic agent, wherein said active ingredients are formulated for separate, sequential or combined therapy, in particular for combined or sequential use.
- a combination product comprising an anti-SIRPa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic as defined above and a second therapeutic agent for simultaneous, separate or sequential use a medicament.
- the invention relates to a combination product as defined above, wherein the second therapeutic agent is selected from the group consisting of chemotherapeutic agents, radiotherapy agents, ceil therapy agents, immunotherapeutic agents, antibiotics and probiotics.
- the invention relates to a combination product as defined above, wherein said immunotherapeutic agent is selected from the group consisting of therapeutic vaccines, immune checkpoint blockers or activators, in particular of adaptive immune cells (T and B lymphocytes ⁇ and antibody-drug conjugates.
- the invention relates to a combination product as defined above, wherein said immune checkpoint blocker or activator of adaptive immune cells (T and B lymphocytes) is selected from the group consisting of anti-PDLl, anti-PDl, anti-CTLA4, anti-CD137, anti-CD2, anti-CD28, anti- CD40, anti-HVESvl, anti-BTLA, anti-CD160, anti-TIGIT, anti-TIM-1/3, anti-LAG-3, anti-2B4, and anti- 0X40, anti-CD40 agonist, CD40-L, TLR agonists, anti-ICOS, ICOS-L and B-cell receptor agonists, in particular selected from the group consisting of anti-PDLl, anti-PDl and anti-CD137,
- said immunotherapeutic agent is an antibody targeting tumoral antigen, particularly selected from the group consisting of anti-Her2, anti-EGFR, anti-CD20, anti-CD19, anti- CD52.
- the invention relates to a combination product as defined above, for simultaneous, separate or sequential use in the treatment of any condition susceptible of being improved or prevented by differentiating monocytic mye!oid-derived suppressor ceils (Mo-MDSC) into non suppressive cells.
- Mo-MDSC monocytic mye!oid-derived suppressor ceils
- the invention relates to a method of treatment of any condition susceptible of being improved or prevented by differentiating monocytic myeioid-derived suppressor cetts (Mo- MDSC) into non suppressive cells in a subject in need thereof comprising administering simultaneously, separately or sequentially to said subject an effective amount of a combination product as defined above.
- Mo- MDSC monocytic myeioid-derived suppressor cetts
- the invention relates to the use of a combination product as defined above in the manufacture of a medicament for the treatment any condition susceptible of being improved or prevented by differentiating monocytic myeioid-derived suppressor ceils (Mo-MDSC) into non suppressive cells.
- Mo-MDSC monocytic myeioid-derived suppressor ceils
- the invention relates to a combination product as defined above, for simultaneous, separate or sequential use in the treatment of any condition susceptible of being improved or prevented by modifying macrophage polarization to pro-inf!ammatory macrophages.
- the invention relates to a method of treatment of any condition susceptible of being improved or prevented by modifying macrophage polarization to pro-inflammatory macrophages in a subject in need thereof comprising administering simultaneously, separately or sequentially to said subject an effective amount of a combination product as defined above.
- the invention relates to the use of a combination product as defined above in the manufacture of a medicament for the treatment any condition susceptible of being improved or prevented by modifying macrophage polarization to pro-inflammatory macrophages.
- the invention relates to a combination product as defined above, for simu!taneous, separate or sequential use in the treatment of a pathology selected from the group consisting of a cancer, an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neuroiogic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV), fibrosis, atherosclerosis, obesity, type II diabetes and a transplant dysfunction or for use in vaccination.
- a pathology selected from the group consisting of a cancer, an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neuroiogic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pse
- the invention relates to a method of treatment of a pathology selected from the group consisting of a cancer, an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV ⁇ , fibrosis, atherosclerosis, obesity, type II diabetes and a transplant dysfunction of a subject in need thereof comprising administering simultaneously, separately or sequentially to said subject an effective amount of a combination product as defined above.
- a pathology selected from the group consisting of a cancer, an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Ps
- the invention relates to the use of a combination product as defined above, in the manufacture of a medicament for the treatment of a pathology selected from the group consisting of a cancer, an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV), fibrosis, atherosclerosis, obesity, type II diabetes and a transplant dysfunction or for use in vaccination.
- a pathology selected from the group consisting of a cancer, an infectious disease, a chronic inflammatory disease, an auto-immune disease, a neurologic disease, a brain injury, a nerve injury, a polycythemia, a hemochromatosis, a trauma, a sceptic shock, a chronic infectious disease (such as with Pseudomonas or CMV),
- the invention relates to an isolated nucleic acid molecule encoding an antibody or antigen-binding fragment thereof as defined above.
- a nucleic acid molecule can be double stranded and single stranded, linear and circular. It is preferably comprised in a vector which is preferably comprised in a host cell.
- the invention relates to an isolated nucleic acid molecule encoding an antibody or antigen-binding fragment thereof as defined above, said nucleic acid molecule comprising or consisting of at least one sequence selected from SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, SEQ iD NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68 and SEQ ID NO: 69.
- the invention relates to an isolated nucleic acid molecule encoding an antibody or antigen-binding fragment thereof as defined above, said nucleic acid molecule comprising:
- the invention relates to a nucleic acid molecule comprising or consisting of a sequence selected from SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54 and SEQ ID NO: 55.
- variable domain of the G CG GCC A ATCCAG G GCCTG G AG TG G ATCGG C AACATCG
- CTACTCCTTC ACC AGCTATTG GG TG C ACTG GGTGCGGCA variable domain of G ATGCCAG G CAAGG G CCTG G AG TG G ATGG G C A AC ATCG
- variable domain of G ATG CCAGG CAAG GG CCTG GAG TG G ATGG G CAACATCG
- the invention in another aspect, relates to a vector comprising the nucleic acid molecule as defined above.
- a "vector” is a nucleic acid molecule used as a vehicle to transfer genetic material into a ceil.
- the term “vector” encompasses plasmids, viruses, cosmids and artificial chromosomes.
- engineered vectors comprise an origin of replication, a mu!tic!oning site and a selectable marker.
- the vector itself is generally a nucleotide sequence, commonly a DNA sequence, that comprises an insert (transgene) and a larger sequence that serves as the "backbone” of the vector.
- Modern vectors may encompass additional features besides the transgene insert and a backbone: promoter, genetic marker, antibiotic resistance, reporter gene, targeting sequence, protein purification tag.
- Vectors called expression vectors (expression constructs) specifically are for the expression of the transgene in the target cell, and generally have control sequences.
- the invention in another aspect, relates to an isolated host cell comprising a vector as defined above.
- host celt is intended to include any individual cell or cell culture that can be or has been recipient of vectors, exogenous nucleic acid molecules, and polynucleotides encoding the antibody construct of the present invention; and/or recipients of the antibody construct itself.
- the introduction of the respective material into the cell can be carried out by way of transformation, transfection and the like.
- host cell is also intended to include progeny or potential progeny of a single ceil.
- Suitable host cells include prokaryotic or eukaryotic cells, and also include but are not limited to bacteria, yeast cells, fungi celts, plant celts, and animal ceils such as insect cells and mammalian cells, e.g., murine, rat, rabbit, macaque or human.
- the invention in another aspect, relates to a kit comprising:
- nucleic acid molecule coding said antibody or antigen-binding
- the antibody of the present invention can be provided in a kit, i.e., a packaged combination of reagents.
- kit means two or more components (one of which corresponding to the antibody or antigen-binding thereof, the nucleic acid molecule, the vector or the celt of the invention) packaged together in a container, recipient or otherwise.
- a kit can hence be described as a set of products and/or utensils that are sufficient to achieve a certain goal, which can be marketed as a single unit.
- the kit may comprise one or more recipients (such as vials, ampoules, containers, syringes, bottles, bags) of any appropriate shape, size and material containing the antibody construct of the present invention in an appropriate dosage for administration.
- the kit may additionally contain directions for use (e.g. in the form of a leaflet or instruction manual), means for administering the antibody construct of the present invention such as a syringe, pump, infuser or the like, means for reconstituting the antibody construct of the invention and/or means for diluting the antibody construct of the invention.
- kits containing single-chambered and multi-chambered pre-filled syringes are provided.
- the invention relates to a polypeptide, in particular an antigen, comprising or consisting of the epitope sequence of human SIRPa consisting of SEQ iD NO: 3 ⁇ KFRKGSPD[DV]/[T]E).
- the invention relates to a polypeptide, in particular an antigen, comprising or consisting of the epitope sequence of human SIRPa consisting of SEQ ID NO: 3 (KFRKGSPD[DV]/p " ]E), 5 said polypeptide having a size up to 300 amino acids.
- the polypeptide of the invention has a size between 50 and 300, preferably between 100 and 250 amino acids.
- the polypeptide of the invention has a size up to 50, 100, 150, 200, 250 or 300 amino acids.
- the invention relates to a polypeptide, in particular an antigen, comprising or consisting of the epitope sequence of human SIRPa consisting of SEQ ID NO: 3 (KFRKGSPD[DV]/[T]E) and at Ieast one epitope sequence of human SIRPa consisting of SEQ ID NO: 1 (SLIPVGP), SEQ ID NO: 2 (G/ARELIYNQKEGH), SEQ ID NO: 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (iCEVAHVTLQG) or SEQ ID NO: 6 (YPQRLQLTWLE).
- SEQ ID NO: 3 KFRKGSPD[DV]/[T]E
- SEQ ID NO: 1 SEQ ID NO: 1
- SEQ ID NO: 2 G/ARELIYNQKEGH
- SEQ ID NO: 4 QHTVSFTCESHGFSPRDITLKWF
- SEQ ID NO: 5 iCEVAHVTLQG
- the invention relates to a polypeptide, in particular an antigen, comprising or consisting of the epitope sequences of human SIRPa consisting of SEQ ID NO: 1 (SLIPVGP), SEQ ID NO: 2 (G/AREUYNQKEGH), SEQ ID NO: 3 (KFRKGSPD[DV]/[T]E), SEQ ID NO: 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) and SEQ ID NO: 6 (YPQRLQLTWLE).
- the invention relates to a polypeptide, in particular an antigen, comprising or
- 20 consisting of at ieast one peptide selected from the group consisting of SEQ ID NO: 70, SEQ ID NO: 71 and SEQ ID NO: 72, said polypeptide consisting of a sequence of up to 300 amino acids.
- the invention relates to a polypeptide, in particular an antigen, comprising or consisting of the peptide of amino acid sequence set forth in SEQ ID NO: 73 (YNQK) and/or the peptide of SIR amino acid sequence within SIRPa, said polypeptide consisting of a sequence of up to
- the invention also relates to a method of manufacturing an antibody, in particular an antibody of the invention, comprising immunizing a non-human animal, in particular a non-human mammal, against at least one antigen as defined above, and in particular collecting the resulting
- the invention also relates to a method of manufacturing an antibody comprising immunizing a non-human animal against an antigen comprising or consisting of the epitope sequence of human SIRPa consisting of SEQ ID NO: 3 (KFRKGSPD[DV]/[T]E), and in particular collecting the resulting serum from said immunised non-human animal to obtain antibodies directed against said
- the invention also relates to a method of manufacturing a n antibody comprising immunizing a non-human animal against an antigen comprising or consisting of the epitope sequence of huma n SI Pa consisting of SEQ.
- SEQ ID NO: 3 ( FRKGSPD[DV]/[T]E) and at least one epitope sequence of human SIRPa selected from the group consisting of SEQ I D NO : 1 (SLIPVGP), SEQ I D NO: 2 (G/ARELIYNQKEGH), SEQ ID NO : 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) or SEQ ID NO: 6 (YPQRLQLTWLE), and in particular collecting the resulting serum from said immunised non-human an imal to obta in antibodies directed against sa id antigen.
- SEQ I D NO: 1 SEQ I D NO: 1
- SEQ I D NO: 2 G/ARELIYNQKEGH
- SEQ ID NO: 4 QHTVSFTCESHGFSPRDITLKWF
- SEQ ID NO: 5 ICEVAHVTLQG
- SEQ ID NO: 6 YPQRLQLTWLE
- the invention a lso relates to a method of manufacturing an a ntibody com prising im munizing a non-human animal against a n a ntigen comprising or consisting of the epitope sequences of human SiRPa consisting of SEQ !D NO: 1 (SLIPVGP), SEQ ID NO: 2 (G/ARELIYNQKEG H), SEQ ID NO: 3 (KFRKGSPD[DV]/[T] E), SEQ ID NO : 4 (QHTVSFTCESHGFSPRDITLKWF), SEQ ID NO: 5 (ICEVAHVTLQG) a nd SEQ ID NO: 6 (YPQRLQLTWLE), a nd in particular collecting the resulting serum from sa id immunised non-huma n anima l to obtain antibodies directed aga inst said antigen.
- SEQ !D NO: 1 SEQ ID NO: 2 (G/ARELIYNQKEG H), SEQ ID
- the invention relates to a method of selecting an antibody of the invention, an antigen- binding fragment or mimetic of such an antibody, co mprising or consisting of at least one of the following steps:
- a. testing e.g. according to a method describing in the Examples 1, 2 a nd 3) the ability of an a ntibody, a n antigen-binding fragment or mimetic of such an a ntibody to bind to SI RPa, in particular to an antigen as defined above,
- testing e.g. according to a method describing in the Examples 4 and 5 the ability of an antibody, an antigen-binding fragment or mimetic of such an antibody to inhibit the binding of human CD47 to human SI RPa;
- testing e.g. according to a method describing in the Example 12
- testing e.g. according to a method describing in the Exa mple 13 the ability of an antibody, an antigen-binding fragment or mimetic of such an antibody to in hibit the T cells proliferation;
- a nd optionally comprising the following step: - selecting an antibody, an antigen-binding fragment or mimetic of such an antibody which specifically binds to SIRPa, in particular to an antigen as defined above, and which significantly inhibits the binding of CD47 to SIRPa, and which does not bind specifically to human SI Pg, and/or which does not bind specifically to human T-ce!ls, and/or which does not significantly inhibit the proliferation of human T-cells, and/or which does not significantly inhibit the binding of human CD47 to human SIRPg; more particularly which specifically binds to SIRPa, in particular to an antigen as defined above, and which significantly inhibits the binding of CD47 to SIRPa, and which does not bind specifically to human SIRPg, and which does not bind specifically to human T-cells, and which does not significantly inhibit the proliferation of human T-cells, and which does not significantly inhibit the binding of human CD47 to human SIRPg.
- Figure 1 Binding analyses of anti-SIRPa antibodies by ELiSA assay (human SIRPa-His coating and anti- human kappa detection).
- FIG. 1 Affinity analysis by Biacore of antr-SIRP antibodies on human SiRPa recombinant protein.
- SIRPa-His recombinant protein was immobilized onto a CMS chip at 5pg/ml (500RU) and the indicated antibodies were added at different concentration. Values were measured after an association period (ka) of 3min followed by a dissociation period of 10 min (kd) to determine affinity constant (KD).
- (E, F, G) SIRPa variants binding in the population by anti-h SIRPa antibodies The capacity of different anti-hSIRPa antibodies to bind SIRPa variants in the 32 volunteers was measured by FACS with a PE- anti mouse igG. All clones were tested at 10 pg/ml: mlSDS ( ⁇ ), 12D7 ( T ), 6G10 ( ⁇ ) and commercial antibodies SE5A5 ( ⁇ ), SE7C2 ( ⁇ ).
- Figure 6. Affinity analysis by Blitz of anti-SIRP antibody on human SiRPa recombinant protein pre- incubated or not with SP-D ligand.
- SIRPa-His recombinant protein was immobilized onto a NINTA biosensor at 10 g/m! and the SP-D !igand was added at 100 ug/rnl (saturating concentration).
- anti-SIRPa antibody was added at 20 ⁇ / ⁇ and affinity values were deduced after an association period (ka) of 120sec followed by a dissociation period of 120sec (kd) to determine affinity constant (KD).
- FIG. 7 Affinity analysis by Blitz of anti-SIRP antibodies on human SIRPb recombinant protein. SlRPb-His recombinant protein was immobilized onto a NINTA biosensor and the indicated antibodies were added at 20pg/ml. Values were deduced after an association period (ka) of 120sec followed by a dissociation period of 120sec (kd) to determine affinity constant (KD).
- B Binding analysis of anti- SIRP antibodies (human SlRPb-His coating and anti-human kappa detection).
- FIG. 8 Affinity analysis by Blitz of anti-SIRP antibodies on human SIRPg recombinant protein. SIRPg-His recombinant protein was immobilized onto a N!NTA biosensor and the indicated antibodies were added at 10 pg/ml. Values were deduced after an association period (ka) of 120sec followed by a dissociation period of 120sec (kd) to determine affinity constant (KD).
- B Binding analysis by ELISA assay of anti-SIRP antibodies on SIRPg (human SIRPg-His coating and anti-human kappa detection).
- Figure 9 Affinity analysis by Blitz of CD47 on human SIRPg recombinant protein pre-incubated with anti-SIRP antibodies.
- SIRPg-His recombinant protein was immobilized onto a NINTA biosensor at 10 ⁇ g/ml and the indicated antibodies were added at 20pg/ml (saturating concentration).
- CD47Fc was added at 100 ng/m ⁇ and affinity values were deduced after an association period (ka) of 120sec followed by a dissociation period of 120sec (kd) to determine affinity constant (KD).
- FIG. 10 Geometric mean fluorescence intensity measured by flow cytometry on (A) peripheral human CD3+ T cells, (B) red blood cells or (C) platelets after staining with different monoclonal antibodies and revealing with secondary anti-lgG fluorescent antibody.
- Figure 11. Percentage of positive peripheral human CD3+ T cells after staining with different monoclonal antibodies. The table indicates the value of % of positive cells in duplicate experiments, Figure 12.
- Human T cells isolated from peripheral blood mononuclear cells from healthy volunteers were stimulated with (A ⁇ (C) anti-CD3+ anti-CD28 beads at a 1:1 ratio for 3 days or (B) (D) with allogeneic dendritic cells (DC) at a 5 T cell : 1 DC ratio for 5 days or (E) with different concentrations of tuberculin unpurified protein derivative (PPD) for 5 days.
- Antibodies were added at day 0 of the culture. Proliferation was measured by incorporation of H 3 -thymidine during the last 12h of culture.
- FIG. 13 Mouse CD8+ T cells were isolated from splenocytes of naive mice. CDS T cells were stimulated with anti-CD3+ anti-CD28 beads at a 1:1 ratio for 3 days. Antibodies were added at day 0 of the culture. Proliferation was measured by incorporation of H 3 -thymidine during the last 12h of culture.
- FIG. 14 Human T cells isolated from peripheral blood mononuclear cells from healthy volunteers were stimulated with allogeneic dendritic cells (DC) at a 5 T cell : 1 DC ratio for 5 days. Antibodies were added at day 0 of the culture. Proliferation was measured by incorporation of H 3 -thymidine during the last 12h of culture.
- DC dendritic cells
- FIG. 15 Anti-tumor effect of anti-SIRPa (P84 clone) i.p. administration three times a week for 4 weeks (300pg/injection) in combination or not with two injection (day 4 & 8) of anti-4-l-BB mAb (3H3 clone, 100 g/i jection ⁇ or with injections (twice a week) of anti-PDL-l (10F.9G2 clone, 200 pg/injection, treatment during 4 weeks) in an orthotropic model of murine hepatoma (2.5.10 ⁇ 6 of Hepa 1.6 cells injected through the portal vein on day 0). Mice were considered cured when they survived three times longer than the time necessary to all control mice died.
- mice previously cured in the hepatoma model by anti-SIRPa + anti-4-lBB were rechallenged by Hepa 1.6 cells injection in the spleen (2.5.10 ⁇ 6 ceils/mouse) and their spleen was harvested 30 days after rechalienge.
- Splenocytes and T-cell splenocytes were isolated. Naive mice were injected intravenously with vehicle, whole splenocytes (10.10 A 6/mouse) or T-cell purified from splenocytes (2.5.10 A 6/mouse) and ail received Hepal.6 ceil injection in the spleen (2.5.10 ⁇ 6 cells/mouse).
- mice were then left untreated and considered cured when they survived three times longer than the time necessary to ail control mice died.
- Figure 16 Mice previously cured in the hepatoma model by anti-SIRPa + anti-PDLl injection were rechailenged by Hepa 1.6 ce!ls injection in the spleen (2.5.10 ⁇ 6 cells/mouse). Naive mice were injected in parallel in the same route in order to compare tumor development with rechal!enged mice. Mice were then left untreated.
- Figure 17 Ants-tumor effect of anti-SIRPa (P84 clone) i.p.
- FIG. 1 Immune cells phenotype analysis in spleen, tumor and lymph nodes of mice treated with anti-SIRPa (P84 clone) or ctrl mAb i.p. three times a week for two weeks (200ug/injection) in an orthotropic mode! of murine mammary carcinoma (0.25.10 ⁇ 6 of 4T1 cells injected in the mammary gland). Immune cell analysis were performed two weeks after tumor inoculation.
- anti-SIRPa P84 clone
- ctrl mAb i.p. three times a week for two weeks (200ug/injection) in an orthotropic mode! of murine mammary carcinoma (0.25.10 ⁇ 6 of 4T1 cells injected in the mammary gland).
- Anti-SIRPa P84 clone
- anti-CD47 M1AP410 clone
- irrelevant isotype control were administered intraperitoneally at day 0 and day 2 at 12mg/kg in C57BI/6 mice.
- Blood samples were collected at day 0 and day 3 in EDTA containing tubes and blood count was performed with a XS-800! hematology analyzer (Sysmex).
- the level of hemoglobin (left) and the percentage of hematocrit (right) were evaluated at day 3.
- the dotted-lines represent norma! range values in the C57BI/6 mice for each parameter.
- FIG 20 (Up) Flow cytometry analysis of anti-SIRPa (HEFLB, grey) and anti-CD47 (B6H12, black) mAb as compared to a control mAb (dotted line) on human platelets freshly isolated from the blood of healthy donors. (Bottom) Human platelet aggregation measurement using optical aggregometer in the presence of a 50 ⁇ g/m! of control mAb, anti-SIRPa (HEFLB), anti-CD47 (B6H12) or anti-integrin allb as positive control of inhibitor of aggregation. Antibodies were evaluated on non-activated and ADP-activated platelets. Figure 21.
- Allogeneic CD4+ T ceils were cultured in a 1:1 ratio with CD14+ myeloid ceils extracted from (A) fresh or (B) frozen ovarian cancer ascites with 10 ng/ml of control antibody (white), anti- SiRPa HEFLB (black) or anti-CD47 mAb (grey). Proliferation was measured at day 5 by 3 H-thymidine incorporation.
- C Alternatively, allogeneic T cells were cultured in a 5:1 ratio with al!ogeneic dendritic ce!ls and different ratio of CD14+ myeloid celis extracted from ovarian cancer ascites in the presence of lOjjg/ml of antibody as in (A).
- the antibody “18D5" corresponds to the mouse antibody 18D5
- the "chimeric” antibody corresponds to the chimeric mouse/human 18D5 antibody
- the antibodies "HALA, HALB, HBLA, HBLB, HCLA, HCLB, HELA, HELB, HFLA, HFLB, HEFLA and HEFLB” correspond to specific humanized 18D5 variants.
- the antibodies 6G10 and 12D7 belong to the Applicant; these antibodies have been obtained by the same method than ml8D5 and are used as control. These control antibodies are lgG2a mouse monoclonal anti-human SIRPa antibodies.
- the first one is an anti-S!RPa antibody, named SE7C2 (Santa Cruz sc-23863); the second antibody is an antibody able to recognize both SIRP ⁇ / ⁇ and is named SE5A5 (BioLegend BLE323802); and the third one is an anti-human SIRPa antibody named Kwar23 (Creative Biolabs).
- An anti-human SIRPa antibody named SIRP29 from University of Toronto described in the PCT application WO2013056352 was also used for comparison.
- Example 1 Binding analyses of the anti-SIRPa antibodies on SIRPa by ELISA
- the binding activity of the anti-SIRPa antibodies was assessed by ELISA.
- the humanized antibodies, SIRP29 and Kwar23, a recombinant hSIRPa (Sino Biologicais, Beijing, China; reference 11612-H08H) was immobilized on plastic at 0.5 ⁇ ⁇ in carbonate buffer (pH9.2) and the purified antibody was added to measure binding.
- peroxidase-labeled donkey anti-human IgG Jackson Immunoresearch; USA; reference 709-035-149) was added and revealed by conventional methods.
- the binding activity of the different anti-SIRPa antibodies on SIRPa as measured by ELISA showed effective concentrations (EC50) of 2.9 ng/ml for the chimeric antibody, 3.9 ng/ml for HALA, 5.1 ng/ml for HFLA, 4.0 ng/ml for HFLB, 7.1 ng/ml for HEFLA, 4.4 ng/ml HEFLB in a first experiment, 4.06 ng/mi for the chimeric antibody, 5.60 ng/ml for HCLA, 5.59 ng/ml for HCLB, 4.61 ng/ml for HELA, 4.13 ng/ml for HELB in a second experiment, and 2.74 ng/ml for the chimeric antibody, 2.53 ng/ml for HALB, 2.68 ng/ml for HBLA, 2.95 ng/ml for HBLB in a third experiment.
- EC50 effective concentrations
- the binding activity of different anti-SIRPa antibodies on SIRPa as measured by ELISA showed an effective dose (ED50) of 0.16nM (24ng/ml) for SE5A5 and 0.06n (9ng/mi) for the clone ml8D5.
- the clones 6G10 and 12D7 did not seem to bind SIRPa by ELISA assay.
- Those results indicate that the clone ml8D5 is a good SIRPa binder by ELISA compared to a commercial antibody and indicate that the epitope recognized by this clone is accessible when SIRPa is coated on a plastic well compared to clones 6G10 and 12D7.
- hSIRPa Recombinant hSIRPa (Sino Biologicals, Beijing, China; reference 11612-H08H) was immobilized into a C 5 sensor chip (GeHealthcare; France) at 5 ⁇ g/m ⁇ (500RU) and antibodies were applied at different concentrations with a flow rate of 40 ⁇ / ⁇ . Analysis was performed with a BiAcore 3000 (Biacore, GeHealthcare). Values were measured after an association period (ka) of 3min followed by a dissociation period of 10 min (kd) to determine affinity constant (KD).
- the antibodies of the invention have a strong affinity (KD) for SIRPa (from 1.93e-10 M to 3.67e-10 M), which is equivalent to the affinity of the known anti-SIRPa antibodies SIRP29 and Kwar23 and better than the affinity of the commercial anti-SIRPa antibodies SE7C2 and SE5A5.
- KD strong affinity
- results indicate a strong binding of the anti-SIRPa antibodies of the invention on human monocytes and a binder binding (as measured with the MFI (Median Fluorescent Intensity)) that the known anti-SIRPa antibodies Kwar23, SE7C2 and SE5A5.
- MFI Median Fluorescent Intensity
- Example 4 Competitive analysis between CD47 and the ant!-SIRPa antibodies by antagonist ELISA assay Method: For competitive ELISA assay, recombinant hSIRPa (Sino Biologicals, Beijing, China; reference 11612-H08H) was immobilized on plastic at in carbonate buffer (pH9.2). For the chimeric antibody, the humanized antibodies, SIRP29 and Kwar23, a purified antibody (at different concentrations) was mixed with 6 ⁇ g/ml final (fix concentration) of biotinylated Human CD47Fc (AcroBiosystems interchim; France; reference: #CD7-H82F6) to measure competitive binding for 2h at 37°C. After incubation and washing, peroxidase-labeled streptavidin (Vector laboratoring; USA; reference SA-5004) was added to detect Biotin-CD47Fc binding and revealed by conventional methods.
- peroxidase-labeled streptavidin Vector laboratoring; USA; reference SA-
- a purified antibody (at different concentrations) was mixed with 0.04 ⁇ / ⁇ of CD47Fc (Sino Biologicals, Beijing, China; reference 12283-H02H) to measure competitive binding for 2h at 37"C. After incubation and washing, peroxidase-labeled donkey anti- human Fc chain (Jackson Immunoresearch; reference 709-035-149) was added to detect CD47Fc binding and revealed by conventional methods.
- the antibodies of the invention have an antagonist activity on the SlRPa ⁇ CD47 interaction.
- the chimeric antibody, HFLA, HFLB, HEFLA and HEFLB have a better antagonist activity as compared to the antagonist activity of SIRP29 and the commercial anti-SIRPa antibody SE5A5.
- the antibodies of the invention have an antagonist activity on SIRPa- CD47 interaction on human monocytes.
- Example 6 Blitz method competition with SP-D
- SIRPa + Anti-SIRPa antibody + Surfactant Protein D SP-D
- SIRPa His
- SIRPa recombinant protein Sino Biologicals, Beijing, China; reference 11612-H08H
- Ni-NTA biosensor Ni-NTA biosensor
- anti-SIRPa antibodies were added at 20 / ⁇ -. (saturating concentration) for 120 seconds.
- SIRPa + Surfactant Protein D (SP-D) + Anti-SIRPa antibody SIRPa + Surfactant Protein D (SP-D) + Anti-SIRPa antibody.
- Sirp-a His
- Sirp-a recombinant protein Sino Biologicals, Beijing, China; reference 11612-H08H
- Ni-NTA biosensor Ni-NTA biosensor
- human SP-D R et D Systems; USA; reference 1920-SP-050
- anti-SIRPa antibodies were associated at 20 ⁇ /mL (saturating concentration) for 120 seconds.
- the antibodies of the invention have a lower affinity for SIRPb as compared to SIRPa.
- the chimeric antibody, HFLA, HFLB, HE FLA, HEFLB have a reduced affinity for SIRPb as compared to SIRP29 and Kwar23.
- Example 8 ELISA binding of anti-SS P antibodies on SIRPb
- the anti-SIRPa antibodies have a low affinity for SIRPb. It must be indicated that the revelation was performed with a donkey anti-human antibody for all antibodies except for B4B6 (revealed with a mouse antibody), which may explain that the signal obtained for the 10 anti-SIRPb antibody B4B6 is lower than the signal obtained for the anti-SIRPa antibodies.
- Ni-NTA biosensor Form Bio; USA; reference 18-0029
- an anti-SIRPa antibody was associated at 20 ⁇ /mL for 120 seconds.
- the dissociation of anti- SIRPa antibody was made in kinetics buffer for 120 seconds.
- Analysis of data was made with the Blitz pro 1.2 software, which calculated association constant (ka) and dissociation constant (kd) and determined the affinity constant KD (ka/kd).
- the anti-SIRPa antibodies of the invention have a low affinity for SIRPg. This affinity is slightly weaker than the affinity of the known anti-SIRPa antibodies SIRP29 and Kwar23.
- the kinetics properties differ between anti-SIRPa antibodies, SIRP29 and Kwar23, with a high dissociation rate constant (Kd) for anti-SIRPa antibodies as compared to SIRP29 and Kwar23.
- Kd dissociation rate constant
- HFLB has the lowest affinity for SIRPg with a KD value of 1.036e-7 M that 5 equals to a 2-log difference as compared to the KD values of SIRP29 and Kwar23.
- hSIRPg-His (Sino Biologicals, Beijing, China; reference 11828-H08H) was immobilized on plastic at ⁇ g/ml in carbonate buffer (pH9.2) and purified antibody were added0 to measure binding. After incubation and washing, peroxidase-iabeied donkey anti-human IgG (Jackson Immunoresearch; USA; reference 709-035-149) was added and revealed by conventional methods.
- CD47Fc (Sino Bioiogicais, Beijing, China; reference 12283-H02H) was associated at 100 g/mL, in competition with anti-SIRPa antibodies, for 120 seconds.
- the dissociation of CD47Fc was made in kinetics buffer for 120 seconds.
- Analysis data was made with the Blitz pro 1.2 software, which calculated association constant (ka) and dissociation constant (kd) and determined the affinity constant KD (ka/kd).
- the anti-S!RPa HEFLB of the invention does not compete with the binding of CD47 to SIRPg.
- the other known antibodies SIRP29 and, in particular, kwar23 compete with the binding of CD47 to SIRPg.
- Example 12 Binding to blood cells by flow cytometry
- the experiment was realized to analyze the binding of the anti-SIRPa antibodies on human blood cells.
- CD3-positive T lymphocytes, red blood cells and platelets were extracted from purified blood from healthy volunteers. Cells were then stained for 30min at 4°C with 10 micrograms/ml of each tested antibody, washed and then stained with a secondary fluorescent anti-lgG antibody for another 30min at 4°C. After washes, cells were analyzed on a CANTO II (BD Bioscience) flow cytometer.
- the T cells, the red blood cells and the platelets are positive for CD47, which is expressed ubiquitously, and they were stained with the B6H12 antibody.
- the SIRP29 and the Kwar23 antibodies like LSB2.20 (specific anti-SIRPy antibody), bind to T cells that are known to express SIRPy.
- the anti-SIRPa humanized 18D5 antibody does not bind to the T cells (same results obtained with four different 18D5 humanized variants tested). Red blood ceils and platelets do not express SIRPa and, thus, they were not revealed with the humanized 18D5 antibody and the other anti-S!RPa antibodies. This result shows the specificity of the humanized 18D5 antibody for SIRPa on live cells as compared to the known anti-SIRPa antibodies.
- the T-celis are not stained by the humanized 18D5 antibody (same results obtained with five different 18D5 humanized variants tested) and with the chimeric 18D5 (data not shown) whereas more than 70% of T cells are stained by SIRP29 and Kwar23.
- Example 13 Human CD3+ T cell proliferation Method: hPBMC were isolated from buffy coat of healthy volunteers. CD4 or CD8 T cells were selected by positive selection using an AutoMACS ( iltenyi) and plated in 96 ⁇ round well plate (50 000 cells/well). The proliferative signals were provided by either anti ⁇ CD3/anti-CD28 coated microbeads (UfeTechno!ogies) at a 1 bead for 1 T cell ratio during three days, or allogeneic mature dendritic cells generated in vitro at a 5 T cell for 1 mDC during 5 days or with different concentrations of tuberculin unpurified protein derivative (PPD) for 5 days.
- PPD tuberculin unpurified protein derivative
- Antibodies targeting the SIRPa/CD47 pathway were added from the beginning of the proliferation test at a saturating concentration ⁇ 10 ug/mL). Proliferation was measured by incorporation of H 3 -thymidine during the last 12h of culture. Results: As shown in Figure 12, the anti-SIRPa antibody HALA and HEFLB variants do not inhibit the T cell proliferation when T cells are stimuiated with anti-CD3+ anti-CD2S beads (A) (C) or with allogenic dendritic cells (B) (D) or with PPD (E), whereas the anti-SIRPa Kwar23 inhibits T cell proliferation when T ceils are stimulated with allogenic dendritic cells. As expected, the anti-CD47 antibodies and the anti-SIRPg antibody are inhibitors of the T cell proliferation. Example 14. Mouse CD8+ T cell proliferation
- Splenocytes were isolated from naive mice.
- CDS T cells were selected by positive selection using an AutoMACS (Miltenyi) and plated in 96-round well plate (50 000 cells/well).
- the proliferative signals were provided by anti-CD3/anti-CD28 coated microbeads (Life Technologies) at a 1 bead for 1 T cell ratio during three days.
- a mouse anti-SIRPa antibody (P84) and an anti-CD47 antibody (MIAP310) targeting the SIRPa/CD47 pathway were added from the beginning of the proliferation test at a saturating concentration (10 ⁇ g/mL). Proliferation was measured by incorporation of H 3 - thymidine during the last 12h of culture.
- mice As shown in Figure 13, there is no inhibition of the anti-SIRPa or anti-CD47 antibody on the proliferation of mouse T cells. This result is explained by the fact that mice does not express the SIRPg gene. Thus, mice can be used as a model to predict the in vivo effects of a specific anti-SIRPa antibody that does not bind SIRPg. In contrast, anti-CD47 or non-selective anti-SIRPa antibodies in vivo preclinical efficacy, in particular on adaptive immunity and generation of memory T lymphocytes, is not predictive of human situation.
- Example 15 Human T cell proliferation
- hPBMC were isolated from buffy coat of healthy volunteers.
- CD4 or CD8 T cells were selected by positive selection using an AutoMACS (Miltenyi) and plated in 96-round well plate (50 000 cells/well).
- the proliferative signals were provided by either anti-CD3/anti-CD28 coated microbeads (LifeTechnologies) at a 1 bead for 1 T cell ratio during three days, or allogeneic mature dendritic cells generated in vitro at a 5 T cell for 1 mDC during 5 days.
- Antibodies were added from the beginning of the proliferation test at a saturating concentration (5pg/mL for anti-CD47 and anti- SIRPa antibodies and 2,5pg/mL for the anti-PD-l/PD-Ll antibodies and the recombinant 4-1BBL). Proliferation was measured by incorporation of H 3 -thymidine during the fast 12h of culture.
- the anti-PD-l/PD-Ll antibodies and the recombinant 4-1BBL have a boost effect on the proliferation of human T cells
- white anti-CD47 has a negative effect on the proliferation of human T cells.
- the ants-CD47 antibody prevents the human T-ceil immunostimulatory efficacy of anti-PD-l/PD-Ll or 4-1BB agonist agents.
- the anti-SIRPa HEFLB has no significant effect on the proiiferation of T cells.
- mice were anesthetized with a cocktail of xylazine/ketamine. After a laparotomy, tumoral Hepa 1.6 ce!ls were injected through the portal vein (2,5.10 6 ceils/100 ⁇ ) in PBS. The treatment was started 4 days after tumor injection.
- the agonistic anti-4-lBB monoclonal antibody (3H3) was injected two times at d4 and dS after Hepa 1.6 cells (Hepatocarninoma cells, HCC) injection intraperitonealiy in PBS (100 pg/injection).
- the anti-PDLl monoclonal antibody was injected twice a week during 4 weeks intraperitonealiy in PBS (20Qpg/injection).
- the antagonistic anti-SIRPa antibody (P84) was injected three time a week during four weeks intraperitonealiy in PBS (300pg/injection).
- the anti-tumor response was evaluated in the orthotopic model of HCC thirteen days after the tumor inoculation. At this time, the tumor and the spleen were collected in order to phenotype the immune cells that infiltrated the tumor or in the systemic way.
- Spienocytes and non-parenchymal cells (NPC) of the liver which are the infiltrating immune ceils were stained with four different mixes for flow cytometry acquisition.
- the combination of anti-SIRPa with a co-stimulatory agent e.g. anti-4-lBB
- T-cell checkpoint inhibitor e.g. anti-PDLl
- the Mo-MDSC are characterized by a high expression of Ly6C and no Ly6G among the CDllb positive- and MHC class II negative-population.
- the combination of anti-SIRPa with a co-stimulatory agent e.g. anti-4 ⁇ lBB
- T-cell checkpoint inhibitor e.g. anti-PDLl
- accumulation of cytolytic (CD27-negative) NK ceils is induced the tumor and periphery by the anti-SI Pa combination with anti-41BB or anti-PDLl.
- anti-SIRPa modifies the tumor and peripheral immunity in particular adaptive (T-cell, Tregs, B-cells) and innate ⁇ MDSC, Macrophages, NK cells) immune cells contributing to tumor elimination and long-term protection.
- mice previously cured in the hepatoma model by anti-SIRPa + anti-4-lBB injection or SIRPa mutant mice treated with anti-4-lBB were rechallenged by Hepa 1.6 cells injection in the spleen (2.5,10 ⁇ 6 cells/mouse). Mice were anesthetized with 3% of isoflurane in the air. After incision on the flank of the mice and isolation of the spleen, tumoral Hepa 1.6 cells were injected into the spleen (2,5,10 6 ceils/50pL) in PBS. Naive mice were injected in parallel in the same route in order to compare tumor development with rechallenged mice.
- Example 18 Anti-tumor effects of T-celi splenocvtes or whole splenocvtes collected from mice previously cured
- mice Cured anti-SIRPa + anti-4-lBB rechallenged mice were euthanized and the spleen was collected. After red blood cell lysis, splenocytes were extracted and CD3 positive T cells were isolated from a part of splenocytes with an AutoMACS. After anesthesia, mice were injected with either T-cell splenocytes (2,5.10 6 ceils/100 ⁇ ) or whole splenocytes ⁇ 10.10 6 cells/100 pL) or excipient alone (PBS) intravenously. All mice received Hepa 1.6 cells through the portal vein as described previously (2,5.10 6 cells/100 pL).
- mice previously cured in the hepatoma model by anti-SIRPa + anti-PDL-1 injection were rechallenged by Hepa 1.6 cells injection in the spleen (2.5.10 ⁇ 6 cells/mouse). Mice were anesthetized with 3% of isoflurane in the air. After incision on the flank of the mice and isolation of the spleen, tumoral Hepa 1.6 cells were injected into the spleen (2,5.10 6 celis/5C ⁇ L) in PBS. Naive mice were injected in parallel in the same route in order to compare tumor development with rechallenged mice.
- Example 20 Effects of the growth of a tumor in a m , a , mma3 ⁇ 4rardnom model
- mice were anesthetized with 3% of isoflurane in the air. Mice were shaved on the abdomen and 4T1 cel!s were injected in the mammary gland with an insulinic syringe (30 Gauges) in 50 ⁇ of PBS.
- the antagonistic anti-SIRPa antibody (P84) or a control antibody was injected three time a week during four weeks intraperitoneally in PBS (20C ⁇ g/injection).
- the anti-SIRPa antibody significantly (p ⁇ 0.01) reduces the growth of the tumor in the mammary carcinoma model as compared to a control antibody.
- Figure 18 shows the immune cell analysis two weeks after inoculation.
- Anti-SIRPa has a positive effect on myeloid and non-myelold ceils (T and NK ceils) both in tumor and in periphery (spleen) with a dramatic decrease of Tregs and accumulation of memory T cells.
- Example 21 Effects of SiRPa antibodies on the concentration of hemoglobin and on the hematocrit Method: Anti-SIRPa (P84 clone), anti-CD47 (MIAP410 clone) and irrelevant isotype control were administered intraperitoneally at day 0 and day 2 at 12mg/kg in C57BI/6 mice.
- Blood samples were collected at day 0 and day 3 in EDTA containing tubes and blood count was performed with a ⁇ 5-800 ⁇ haematology analyzer (Sysmex). The ievel of hemoglobin (left) and the percentage of hematocrit (right) were evaluated at day 3.
- the anti-SIRPa antibody has no toxic effect on the concentration of hemoglobin and on the hematocrit.
- the anti-CD47 antibody induces a decrease of the concentration of hemoglobin and of the hematocrit in accordance with anemia observed during phase 1 in man.
- Example 22 Platelet aggregation
- Aggregation was determined by measuring the transmission of light through the sample at 37"C with continuous stirring using a standard optical aggregometer (TA-8V Thrombo-Aggregometer, SD Innovation SAS, Frouard, France). The transmission of PPP was set as 100%. Aggregation was recorded under stirring for a total of 5 minutes. Induction Assays: Platelet aggregation was directly initiated by mAb addition ⁇ 50 g.m 1 ). Aggregation was recorded under stirring for a total of max. 10 minutes.
- anti-SIRPa antibodies does not bind to human red blood cells or platelets. Consequently, anti-CD47 induces in vitro human platelets aggregation while anti-SIRPa antibodies does not. Similarly, anti-SIRPa antibodies does not disturb reversible ADP-induced human platelets aggregation while anti-integrin alpha 2b completely abrogates it.
- Example 23 Proliferation of allogeneic T ceils by SIRFa-blocking CD14+ cells from a cancer ovarian ascitis
- Allogeneic CD4 T cells were isolated by positive selection using an AutoMACS (Miltenyi) from hPBMC of a buffy coat of a healthy volunteer. CD4 were plated in 96-round well plate (50 000 cells/well). CD14+ cells were isolated by the same method from the ascitis of a cancer ovarian patient. The CD14+ cells were plated with the allogeneic CD4 T cells at a 1:1 ratio for 5 days. In some conditions, human LPS-matured allogeneic monocyte-derived dendritic ceils (moDC) were added at a 1:5 ratio to stimulate T cells and analyzed the immunosuppressive action of different ratio of CD14+ MDSC purified from the ascite. Antibodies targeting the SIRPa/CD47 pathway were added from the beginning of the proliferation test at a saturating concentration Proliferation was measured by incorporation of H 3 -thymidine during the last 12h of culture.
- AutoMACS Miltenyi
- CD14+ cells were isolated by the
- human myeloid cells purified from ovarian cancer ascites can suppress human T-cell proliferation induced by allogeneic moDC at 1:1 and 2:1 myeloid to T-ce!l ratio.
- anti-CD47 antibodies anti-SIRPa antibodies does not potentiates the immunosuppression induced by human MDSC.
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Hospice & Palliative Care (AREA)
- Food Science & Technology (AREA)
- Oncology (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
Description
Claims
Priority Applications (20)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2018550322A JP7491666B2 (en) | 2016-04-14 | 2017-04-14 | Novel anti-SIRPa antibodies and their therapeutic applications |
MYPI2018703774A MY195448A (en) | 2016-04-14 | 2017-04-14 | New Anti-Sirpa Antibodies and Their Therapeutic Applications |
UAA201809487A UA126658C2 (en) | 2016-04-14 | 2017-04-14 | NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS |
CN202310060526.8A CN115785272A (en) | 2016-04-14 | 2017-04-14 | Novel anti-SIRPa antibodies and therapeutic uses thereof |
IL262251A IL262251B2 (en) | 2016-04-14 | 2017-04-14 | New anti-sirpa antibodies and their therapeutic applications |
EA201891882A EA201891882A1 (en) | 2017-02-17 | 2017-04-14 | NEW ANTIBODIES TO SIRPa AND OPTIONS OF THEIR THERAPEUTIC APPLICATION |
CN201780023581.2A CN109071664B (en) | 2016-04-14 | 2017-04-14 | Novel anti-SIRPa antibodies and therapeutic uses thereof |
EP17718881.0A EP3443010B1 (en) | 2016-04-14 | 2017-04-14 | New anti-sirpa antibodies and their therapeutic applications |
US16/093,062 US11279766B2 (en) | 2016-04-14 | 2017-04-14 | Anti-SIRPa antibodies and their therapeutic applications |
AU2017248626A AU2017248626B2 (en) | 2016-04-14 | 2017-04-14 | New anti-SIRPa antibodies and their therapeutic applications |
CA3020373A CA3020373A1 (en) | 2016-04-14 | 2017-04-14 | New anti-sirpa antibodies and their therapeutic applications |
BR112018070823A BR112018070823A2 (en) | 2016-04-14 | 2017-04-14 | anti-human sirpa antibody or antigen-binding fragment thereof or antigen-binding antibody mimetic, pharmaceutical composition, combination product, isolated nucleic acid molecule, vector, isolated host cell, polypeptide, methods for making an antibody, in in vitro or ex vivo to determine sirp positive, diagnostic and predictive response cells of a subject, and use of an anti-sirp antibody or antigen-binding fragment thereof or an antibody-binding mimetic in vitro or ex vivo of at least one anti-human sirpa antibody or antigen binding fragment thereof or antigen binding antibody mimetic. |
SG11201808465UA SG11201808465UA (en) | 2016-04-14 | 2017-04-14 | NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS |
KR1020187032968A KR102355240B1 (en) | 2016-04-14 | 2017-04-14 | Novel anti-SIRPa antibodies and methods of their therapeutic application |
MX2018012434A MX2018012434A (en) | 2016-04-14 | 2017-04-14 | NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS. |
ZA2018/06293A ZA201806293B (en) | 2016-04-14 | 2018-09-19 | New anti¿sirpa antibodies and their therapeutic applications |
PH12018550160A PH12018550160A1 (en) | 2016-04-14 | 2018-09-25 | NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS |
CONC2018/0010855A CO2018010855A2 (en) | 2016-04-14 | 2018-10-10 | New anti-sirpa antibodies and their therapeutic applications |
US17/681,219 US20220281991A1 (en) | 2016-04-14 | 2022-02-25 | ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS |
JP2022112873A JP7549626B2 (en) | 2016-04-14 | 2022-07-14 | Novel anti-SIRPa antibodies and their therapeutic applications |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662322707P | 2016-04-14 | 2016-04-14 | |
US62/322,707 | 2016-04-14 | ||
EP17305182.2 | 2017-02-17 | ||
EP17305182 | 2017-02-17 |
Related Child Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/093,062 A-371-Of-International US11279766B2 (en) | 2016-04-14 | 2017-04-14 | Anti-SIRPa antibodies and their therapeutic applications |
US17/681,219 Division US20220281991A1 (en) | 2016-04-14 | 2022-02-25 | ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2017178653A2 true WO2017178653A2 (en) | 2017-10-19 |
WO2017178653A3 WO2017178653A3 (en) | 2018-07-05 |
Family
ID=58185461
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2017/059071 WO2017178653A2 (en) | 2016-04-14 | 2017-04-14 | NEW ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS |
Country Status (10)
Country | Link |
---|---|
EP (1) | EP3443010B1 (en) |
CN (1) | CN109071664B (en) |
AU (1) | AU2017248626B2 (en) |
BR (1) | BR112018070823A2 (en) |
CA (1) | CA3020373A1 (en) |
CO (1) | CO2018010855A2 (en) |
EA (1) | EA201891882A1 (en) |
PE (1) | PE20181921A1 (en) |
SG (1) | SG11201808465UA (en) |
WO (1) | WO2017178653A2 (en) |
Cited By (68)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2018149938A1 (en) * | 2017-02-17 | 2018-08-23 | Ose Immunotherapeutics | New uses of anti-sirpg antibodies |
WO2018190719A2 (en) | 2017-04-13 | 2018-10-18 | Aduro Biotech Holdings, Europe B.V. | Anti-sirp alpha antibodies |
WO2018210795A1 (en) * | 2017-05-16 | 2018-11-22 | Synthon Biopharmaceuticals B.V. | ANTI-SIRPα ANTIBODIES |
WO2019073080A1 (en) * | 2017-10-13 | 2019-04-18 | Ose Immunotherapeutics | Modified anti-sirpa antibodies and uses thereof |
WO2019080883A1 (en) * | 2017-10-26 | 2019-05-02 | Immuneonco Biopharmaceuticals (Shanghai) Co., Ltd. | Novel recombinant fusion proteins, preparation and use thereof |
WO2019178218A1 (en) * | 2018-03-14 | 2019-09-19 | Memorial Sloan Kettering Cancer Center | Anti-polysialic acid antibodies and uses thereof |
WO2019175218A1 (en) | 2018-03-13 | 2019-09-19 | Ose Immunotherapeutics | Use of anti-human sirpa v1 antibodies and method for producing anti-sirpa v1 antibodies |
WO2019183266A1 (en) * | 2018-03-21 | 2019-09-26 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
WO2019226973A1 (en) | 2018-05-25 | 2019-11-28 | Alector Llc | Anti-sirpa antibodies and methods of use thereof |
WO2020013170A1 (en) | 2018-07-10 | 2020-01-16 | 国立大学法人神戸大学 | ANTI-SIRPα ANTIBODY |
WO2020039049A1 (en) * | 2018-08-22 | 2020-02-27 | Ose Immunotherapeutics | Anti-sirpg compounds |
WO2020091596A1 (en) | 2018-10-29 | 2020-05-07 | Umc Utrecht Holding B.V. | Iga mediated killing of aberrant cells by cd47- sirpalpha checkpoint inhibition of neutrophils |
WO2020099653A1 (en) | 2018-11-15 | 2020-05-22 | Byondis B.V. | HUMANIZED ANTI-SIRPα ANTIBODIES |
WO2020176790A1 (en) * | 2019-02-27 | 2020-09-03 | Fred Hutchinson Cancer Research Center | Hydrogel compositions and methods for treatment of malignancies |
WO2020180811A1 (en) * | 2019-03-04 | 2020-09-10 | Qilu Puget Sound Biotherapeutics Corporation | Anti-sirp-alpha antibodies |
WO2020247820A1 (en) | 2019-06-07 | 2020-12-10 | ALX Oncology Inc. | Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays |
WO2020260281A1 (en) | 2019-06-25 | 2020-12-30 | Université de Nantes | Inhibitor of surface protein (sp-d) / sirpa / shp2 pathway for use in the prevention and/or treatment of secondary infection |
WO2020263830A1 (en) | 2019-06-25 | 2020-12-30 | Gilead Sciences, Inc. | Flt3l-fc fusion proteins and methods of use |
WO2021032078A1 (en) * | 2019-08-20 | 2021-02-25 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel anti-sirpa antibodies |
WO2021076908A1 (en) | 2019-10-18 | 2021-04-22 | Forty Seven, Inc. | Combination therapies for treating myelodysplastic syndromes and acute myeloid leukemia |
WO2021087064A1 (en) | 2019-10-31 | 2021-05-06 | Forty Seven, Inc. | Anti-cd47 and anti-cd20 based treatment of blood cancer |
WO2021108693A1 (en) | 2019-11-27 | 2021-06-03 | ALX Oncology Inc. | Combination therapies for treating cancer |
WO2021130638A1 (en) | 2019-12-24 | 2021-07-01 | Carna Biosciences, Inc. | Diacylglycerol kinase modulating compounds |
WO2021163064A2 (en) | 2020-02-14 | 2021-08-19 | Jounce Therapeutics, Inc. | Antibodies and fusion proteins that bind to ccr8 and uses thereof |
CN113574067A (en) * | 2018-12-21 | 2021-10-29 | Ose免疫疗法公司 | Bifunctional anti-PD-1/SIRP alpha molecule |
WO2021236658A1 (en) | 2020-05-19 | 2021-11-25 | Boehringer Ingelheim International Gmbh | Binding molecules for the treatment of cancer |
WO2021247430A1 (en) | 2020-06-01 | 2021-12-09 | ALX Oncology Inc. | Combination therapies comprising a hypomethylation agent for treating cancer |
US11208459B2 (en) | 2015-08-07 | 2021-12-28 | ALX Oncology Inc. | Constructs having a SIRP-alpha domain or variant thereof |
JP2022507295A (en) * | 2018-11-14 | 2022-01-18 | アーチ オンコロジー,インコーポレイテッド | Therapeutic SIRPα antibody |
US11242404B2 (en) | 2016-09-21 | 2022-02-08 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
WO2022102634A1 (en) | 2020-11-11 | 2022-05-19 | 第一三共株式会社 | COMBINATION OF ANTIBODY-DRUG CONJUGATE WITH ANTI-SIRPα ANTIBODY |
WO2022110922A1 (en) | 2020-11-30 | 2022-06-02 | 启愈生物技术(上海)有限公司 | ANTI-SIRPα ANTIBODY OR ANTIGEN-BINDING FRAGMENT THEREOF, AND USE THEREOF |
WO2022120286A1 (en) | 2020-12-06 | 2022-06-09 | ALX Oncology Inc. | Multimers for reducing the interference of drugs that bind cd47 in serological assays |
EP3856787A4 (en) * | 2018-09-27 | 2022-06-29 | Celgene Corporation | SIRPalpha BINDING PROTEINS AND METHODS OF USE THEREOF |
US11401329B2 (en) | 2017-08-02 | 2022-08-02 | Phanes Therapeutics, Inc. | Anti-CD47 antibodies and uses thereof |
WO2022221304A1 (en) | 2021-04-14 | 2022-10-20 | Gilead Sciences, Inc. | CO-INHIBITION OF CD47/SIRPα BINDING AND NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT FOR THE TREATMENT OF CANCER |
WO2022241157A1 (en) | 2021-05-13 | 2022-11-17 | ALX Oncology Inc. | Combination therapies for treating cancer |
WO2022245671A1 (en) | 2021-05-18 | 2022-11-24 | Gilead Sciences, Inc. | Methods of using flt3l-fc fusion proteins |
WO2022247933A1 (en) * | 2021-05-28 | 2022-12-01 | 百奥泰生物制药股份有限公司 | ANTI-SIRPα ANTIBODY AND USE THEREOF |
WO2022271684A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2022271677A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2022271659A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2022271650A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2023278377A1 (en) | 2021-06-29 | 2023-01-05 | Seagen Inc. | Methods of treating cancer with a combination of a nonfucosylated anti-cd70 antibody and a cd47 antagonist |
US11572412B2 (en) | 2021-06-04 | 2023-02-07 | Boehringer Ingelheim International Gmbh | Anti-SIRP-alpha antibodies |
WO2023020459A1 (en) | 2021-08-17 | 2023-02-23 | 杭州九源基因工程有限公司 | MONOCLONAL ANTIBODY TARGETING SIRPα AND USE THEREOF |
US11591390B2 (en) | 2018-09-27 | 2023-02-28 | Celgene Corporation | SIRP-α binding proteins and methods of use thereof |
RU2791002C2 (en) * | 2018-07-10 | 2023-03-01 | Нэшнл Юниверсити Корпорейшн Кобе Юниверсити | ANTIBODY AGAINST SIRPα |
US11613564B2 (en) | 2019-05-31 | 2023-03-28 | ALX Oncology Inc. | Methods of treating cancer |
WO2023076983A1 (en) | 2021-10-28 | 2023-05-04 | Gilead Sciences, Inc. | Pyridizin-3(2h)-one derivatives |
WO2023077030A1 (en) | 2021-10-29 | 2023-05-04 | Gilead Sciences, Inc. | Cd73 compounds |
WO2023094698A1 (en) | 2021-11-29 | 2023-06-01 | Ose Immunotherapeutics | Specific antagonist anti-sirpg antibodies |
WO2023122581A2 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023122615A1 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023147418A1 (en) | 2022-01-28 | 2023-08-03 | Gilead Sciences, Inc. | Parp7 inhibitors |
WO2023154578A1 (en) | 2022-02-14 | 2023-08-17 | Sana Biotechnology, Inc. | Methods of treating patients exhibiting a prior failed therapy with hypoimmunogenic cells |
EP4245756A1 (en) | 2022-03-17 | 2023-09-20 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023183817A1 (en) | 2022-03-24 | 2023-09-28 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
WO2023183313A1 (en) | 2022-03-22 | 2023-09-28 | Sana Biotechnology, Inc. | Engineering cells with a transgene in b2m or ciita locus and associated compositions and methods |
US11779642B2 (en) | 2016-12-09 | 2023-10-10 | Alector Llc | Anti-SIRP-alpha antibodies and methods of use thereof |
WO2023196784A1 (en) | 2022-04-05 | 2023-10-12 | Gilead Sciences, Inc. | Combinations of antibody therapies for treating colorectal cancer |
US11795463B2 (en) | 2020-02-28 | 2023-10-24 | Tallac Therapeutics, Inc. | Transglutaminase-mediated conjugation |
WO2023205719A1 (en) | 2022-04-21 | 2023-10-26 | Gilead Sciences, Inc. | Kras g12d modulating compounds |
WO2023235754A1 (en) | 2022-06-01 | 2023-12-07 | ALX Oncology Inc. | Combination therapies for treating urothelial carcinoma |
WO2024006929A1 (en) | 2022-07-01 | 2024-01-04 | Gilead Sciences, Inc. | Cd73 compounds |
WO2024064668A1 (en) | 2022-09-21 | 2024-03-28 | Gilead Sciences, Inc. | FOCAL IONIZING RADIATION AND CD47/SIRPα DISRUPTION ANTICANCER COMBINATION THERAPY |
WO2024105180A1 (en) | 2022-11-16 | 2024-05-23 | Boehringer Ingelheim International Gmbh | Predictive efficacy biomarkers for anti-sirpa antibodies |
WO2024137852A1 (en) | 2022-12-22 | 2024-06-27 | Gilead Sciences, Inc. | Prmt5 inhibitors and uses thereof |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN111116713B (en) * | 2020-01-07 | 2023-06-23 | 郑州大学 | Sirpa protein affinity cyclic peptide and application thereof |
Family Cites Families (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100215640A1 (en) * | 2003-04-24 | 2010-08-26 | The University Of North Carolina At Chapel Hill | Method for inhibiting cellular activation by insulin-like growth factor-1 |
US8613922B2 (en) * | 2003-04-24 | 2013-12-24 | The University Of North Carolina At Chapel Hill | Methods for inhibiting diabetic retinopathy with an antibody against integrin associated protein (IAP) |
US20090191202A1 (en) * | 2005-09-29 | 2009-07-30 | Jamieson Catriona Helen M | Methods for manipulating phagocytosis mediated by CD47 |
WO2009046541A1 (en) * | 2007-10-11 | 2009-04-16 | University Health Network | MODULATION OF SIRPα - CD47 INTERACTION FOR INCREASING HUMAN HEMATOPOIETIC STEM CELL ENGRAFTMENT AND COMPOUNDS THEREFOR |
CN101780283A (en) * | 2010-03-16 | 2010-07-21 | 中国人民解放军第二军医大学 | Application of signal adjusting protein alpha in preparation of DC vaccine for preventing and treating tumors |
CN101880324B (en) * | 2010-05-25 | 2012-10-17 | 中国人民解放军第二军医大学 | Monoclonal antibody of anti-human SIRPalpha, cell strain, preparation method and application thereof |
EP3116544A4 (en) * | 2014-03-11 | 2017-08-23 | The Board of Trustees of the Leland Stanford Junior University | Anti sirp-alpha antibodies and bi-specific macrophage enhancing antibodies |
-
2017
- 2017-04-14 BR BR112018070823A patent/BR112018070823A2/en unknown
- 2017-04-14 AU AU2017248626A patent/AU2017248626B2/en active Active
- 2017-04-14 PE PE2018001974A patent/PE20181921A1/en unknown
- 2017-04-14 SG SG11201808465UA patent/SG11201808465UA/en unknown
- 2017-04-14 CA CA3020373A patent/CA3020373A1/en active Pending
- 2017-04-14 CN CN201780023581.2A patent/CN109071664B/en active Active
- 2017-04-14 WO PCT/EP2017/059071 patent/WO2017178653A2/en active Application Filing
- 2017-04-14 EA EA201891882A patent/EA201891882A1/en unknown
- 2017-04-14 EP EP17718881.0A patent/EP3443010B1/en active Active
-
2018
- 2018-10-10 CO CONC2018/0010855A patent/CO2018010855A2/en unknown
Cited By (108)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11208459B2 (en) | 2015-08-07 | 2021-12-28 | ALX Oncology Inc. | Constructs having a SIRP-alpha domain or variant thereof |
US11639376B2 (en) | 2015-08-07 | 2023-05-02 | ALX Oncology Inc. | Constructs having a SIRP-α domain or variant thereof |
US11242404B2 (en) | 2016-09-21 | 2022-02-08 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
US11401338B2 (en) | 2016-09-21 | 2022-08-02 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
US11779642B2 (en) | 2016-12-09 | 2023-10-10 | Alector Llc | Anti-SIRP-alpha antibodies and methods of use thereof |
JP7179743B2 (en) | 2017-02-17 | 2022-11-29 | オーエスイー・イミュノセラピューティクス | Novel use of anti-SIRPg antibody |
JP2020510643A (en) * | 2017-02-17 | 2020-04-09 | オーエスイー・イミュノセラピューティクス | Novel use of anti-SIRPg antibodies |
WO2018149938A1 (en) * | 2017-02-17 | 2018-08-23 | Ose Immunotherapeutics | New uses of anti-sirpg antibodies |
US10851164B2 (en) | 2017-04-13 | 2020-12-01 | Aduro Biotech Holdings, Europe B.V. | Anti-SIRPα antibodies |
WO2018190719A2 (en) | 2017-04-13 | 2018-10-18 | Aduro Biotech Holdings, Europe B.V. | Anti-sirp alpha antibodies |
WO2018190719A3 (en) * | 2017-04-13 | 2019-10-31 | Aduro Biotech Holdings, Europe B.V. | Anti-sirp alpha antibodies |
WO2018210795A1 (en) * | 2017-05-16 | 2018-11-22 | Synthon Biopharmaceuticals B.V. | ANTI-SIRPα ANTIBODIES |
US11274159B2 (en) | 2017-05-16 | 2022-03-15 | Byondis B.V. | Anti-SIRPα antibodies |
WO2018210793A3 (en) * | 2017-05-16 | 2018-12-20 | Synthon Biopharmaceuticals B.V. | ANTI-SIRPα ANTIBODIES |
US11718681B2 (en) | 2017-05-16 | 2023-08-08 | Byondis B.V. | Anti-SIRP α antibodies |
US11401329B2 (en) | 2017-08-02 | 2022-08-02 | Phanes Therapeutics, Inc. | Anti-CD47 antibodies and uses thereof |
WO2019073080A1 (en) * | 2017-10-13 | 2019-04-18 | Ose Immunotherapeutics | Modified anti-sirpa antibodies and uses thereof |
US11713356B2 (en) | 2017-10-13 | 2023-08-01 | Ose Immunotherapeutics | Modified bifunctional anti-human signal regulatory protein alpha (SIRPa) antibody and method of use thereof for treating cancer |
WO2019080883A1 (en) * | 2017-10-26 | 2019-05-02 | Immuneonco Biopharmaceuticals (Shanghai) Co., Ltd. | Novel recombinant fusion proteins, preparation and use thereof |
US11884723B2 (en) | 2018-03-13 | 2024-01-30 | Ose Immunotherapeutics | Use of anti-human SIRPa v1 antibodies and method for producing anti-SIRPa v1 antibodies |
CN112105646A (en) * | 2018-03-13 | 2020-12-18 | Ose免疫疗法 | Use of anti-human SIRPa v1 antibody and method for producing anti-SIRPa v1 antibody |
WO2019175218A1 (en) | 2018-03-13 | 2019-09-19 | Ose Immunotherapeutics | Use of anti-human sirpa v1 antibodies and method for producing anti-sirpa v1 antibodies |
JP2021517130A (en) * | 2018-03-13 | 2021-07-15 | オーセ イミュノセラピューティクスOse Immunotherapeutics | Use of anti-human SIRPav1 antibody and method for producing anti-v1 antibody |
WO2019178218A1 (en) * | 2018-03-14 | 2019-09-19 | Memorial Sloan Kettering Cancer Center | Anti-polysialic acid antibodies and uses thereof |
US11292850B2 (en) | 2018-03-21 | 2022-04-05 | ALX Oncology Inc. | Antibodies against signal-regulatory protein α and methods of use |
US11939393B2 (en) | 2018-03-21 | 2024-03-26 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
CN112040979A (en) * | 2018-03-21 | 2020-12-04 | Alx肿瘤生物技术公司 | Antibodies to signal-modulating protein alpha and methods of use |
EP4144372A3 (en) * | 2018-03-21 | 2023-06-14 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
US20220324996A1 (en) * | 2018-03-21 | 2022-10-13 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
WO2019183266A1 (en) * | 2018-03-21 | 2019-09-26 | ALX Oncology Inc. | Antibodies against signal-regulatory protein alpha and methods of use |
US11976119B2 (en) | 2018-05-25 | 2024-05-07 | Alector Llc | Anti-SIRPa antibodies and methods of use thereof |
WO2019226973A1 (en) | 2018-05-25 | 2019-11-28 | Alector Llc | Anti-sirpa antibodies and methods of use thereof |
US11319373B2 (en) | 2018-05-25 | 2022-05-03 | Alector Llc | Anti-SIRPA antibodies and methods of use thereof |
JP7337099B2 (en) | 2018-05-25 | 2023-09-01 | アレクトル エルエルシー | ANTI-SIRPA ANTIBODY AND USES THEREOF |
JP2021525082A (en) * | 2018-05-25 | 2021-09-24 | アレクトル エルエルシー | Anti-SIRPA antibody and its usage |
US12024566B2 (en) | 2018-07-10 | 2024-07-02 | National University Corporation Kobe University | Anti-SIRPalpha antibody |
WO2020013170A1 (en) | 2018-07-10 | 2020-01-16 | 国立大学法人神戸大学 | ANTI-SIRPα ANTIBODY |
JP7368809B2 (en) | 2018-07-10 | 2023-10-25 | 国立大学法人神戸大学 | Anti-SIRPα antibody |
RU2791002C2 (en) * | 2018-07-10 | 2023-03-01 | Нэшнл Юниверсити Корпорейшн Кобе Юниверсити | ANTIBODY AGAINST SIRPα |
JPWO2020013170A1 (en) * | 2018-07-10 | 2021-07-15 | 国立大学法人神戸大学 | Anti-SIRPα antibody |
KR20210030267A (en) | 2018-07-10 | 2021-03-17 | 고쿠리츠다이가쿠호진 고베다이가쿠 | Anti-SIRPα antibody |
CN112673023A (en) * | 2018-07-10 | 2021-04-16 | 国立大学法人神户大学 | anti-SIRP alpha antibodies |
CN112673023B (en) * | 2018-07-10 | 2023-09-12 | 国立大学法人神户大学 | anti-SIRP alpha antibodies |
WO2020039049A1 (en) * | 2018-08-22 | 2020-02-27 | Ose Immunotherapeutics | Anti-sirpg compounds |
EP3856787A4 (en) * | 2018-09-27 | 2022-06-29 | Celgene Corporation | SIRPalpha BINDING PROTEINS AND METHODS OF USE THEREOF |
AU2019349651B2 (en) * | 2018-09-27 | 2023-12-07 | Celgene Corporation | SIRP alpha binding proteins and methods of use thereof |
US12084499B2 (en) | 2018-09-27 | 2024-09-10 | Celgene Corporation | SIRP-α binding proteins and methods of use thereof |
US11591390B2 (en) | 2018-09-27 | 2023-02-28 | Celgene Corporation | SIRP-α binding proteins and methods of use thereof |
WO2020091596A1 (en) | 2018-10-29 | 2020-05-07 | Umc Utrecht Holding B.V. | Iga mediated killing of aberrant cells by cd47- sirpalpha checkpoint inhibition of neutrophils |
JP2022507295A (en) * | 2018-11-14 | 2022-01-18 | アーチ オンコロジー,インコーポレイテッド | Therapeutic SIRPα antibody |
EP3880239A4 (en) * | 2018-11-14 | 2022-11-23 | Arch Oncology, Inc. | THERAPEUTIC SIRPalpha ANTIBODIES |
CN113412279A (en) * | 2018-11-15 | 2021-09-17 | 拜奥迪斯私人有限公司 | Humanized anti-SIRP alpha antibodies |
WO2020099653A1 (en) | 2018-11-15 | 2020-05-22 | Byondis B.V. | HUMANIZED ANTI-SIRPα ANTIBODIES |
JP2022509065A (en) * | 2018-11-15 | 2022-01-20 | ビョンディス・ビー.ブイ. | Humanized anti-SIRPα antibody |
CN113574067A (en) * | 2018-12-21 | 2021-10-29 | Ose免疫疗法公司 | Bifunctional anti-PD-1/SIRP alpha molecule |
WO2020176790A1 (en) * | 2019-02-27 | 2020-09-03 | Fred Hutchinson Cancer Research Center | Hydrogel compositions and methods for treatment of malignancies |
CN113784984A (en) * | 2019-03-04 | 2021-12-10 | 齐鲁普吉湾生物治疗公司 | anti-SIRP alpha antibodies |
WO2020180811A1 (en) * | 2019-03-04 | 2020-09-10 | Qilu Puget Sound Biotherapeutics Corporation | Anti-sirp-alpha antibodies |
US11613564B2 (en) | 2019-05-31 | 2023-03-28 | ALX Oncology Inc. | Methods of treating cancer |
WO2020247820A1 (en) | 2019-06-07 | 2020-12-10 | ALX Oncology Inc. | Methods and reagents for reducing the interference of drugs that bind cd47 in serological assays |
WO2020263830A1 (en) | 2019-06-25 | 2020-12-30 | Gilead Sciences, Inc. | Flt3l-fc fusion proteins and methods of use |
WO2020260281A1 (en) | 2019-06-25 | 2020-12-30 | Université de Nantes | Inhibitor of surface protein (sp-d) / sirpa / shp2 pathway for use in the prevention and/or treatment of secondary infection |
WO2021032078A1 (en) * | 2019-08-20 | 2021-02-25 | Elpiscience (Suzhou) Biopharma, Ltd. | Novel anti-sirpa antibodies |
EP4349413A2 (en) | 2019-10-18 | 2024-04-10 | Forty Seven, Inc. | Combination therapies for treating myelodysplastic syndromes and acute myeloid leukemia |
WO2021076908A1 (en) | 2019-10-18 | 2021-04-22 | Forty Seven, Inc. | Combination therapies for treating myelodysplastic syndromes and acute myeloid leukemia |
WO2021087064A1 (en) | 2019-10-31 | 2021-05-06 | Forty Seven, Inc. | Anti-cd47 and anti-cd20 based treatment of blood cancer |
WO2021108693A1 (en) | 2019-11-27 | 2021-06-03 | ALX Oncology Inc. | Combination therapies for treating cancer |
WO2021130638A1 (en) | 2019-12-24 | 2021-07-01 | Carna Biosciences, Inc. | Diacylglycerol kinase modulating compounds |
WO2021163064A2 (en) | 2020-02-14 | 2021-08-19 | Jounce Therapeutics, Inc. | Antibodies and fusion proteins that bind to ccr8 and uses thereof |
US11692038B2 (en) | 2020-02-14 | 2023-07-04 | Gilead Sciences, Inc. | Antibodies that bind chemokine (C-C motif) receptor 8 (CCR8) |
US11795463B2 (en) | 2020-02-28 | 2023-10-24 | Tallac Therapeutics, Inc. | Transglutaminase-mediated conjugation |
US11920136B2 (en) | 2020-02-28 | 2024-03-05 | Tallac Therapeutics, Inc. | Transglutaminase-mediated conjugation |
WO2021236658A1 (en) | 2020-05-19 | 2021-11-25 | Boehringer Ingelheim International Gmbh | Binding molecules for the treatment of cancer |
WO2021247430A1 (en) | 2020-06-01 | 2021-12-09 | ALX Oncology Inc. | Combination therapies comprising a hypomethylation agent for treating cancer |
KR20230106645A (en) | 2020-11-11 | 2023-07-13 | 다이이찌 산쿄 가부시키가이샤 | Combination of antibody-drug conjugate with anti-SIRPα antibody |
WO2022102634A1 (en) | 2020-11-11 | 2022-05-19 | 第一三共株式会社 | COMBINATION OF ANTIBODY-DRUG CONJUGATE WITH ANTI-SIRPα ANTIBODY |
WO2022110922A1 (en) | 2020-11-30 | 2022-06-02 | 启愈生物技术(上海)有限公司 | ANTI-SIRPα ANTIBODY OR ANTIGEN-BINDING FRAGMENT THEREOF, AND USE THEREOF |
WO2022120286A1 (en) | 2020-12-06 | 2022-06-09 | ALX Oncology Inc. | Multimers for reducing the interference of drugs that bind cd47 in serological assays |
WO2022221304A1 (en) | 2021-04-14 | 2022-10-20 | Gilead Sciences, Inc. | CO-INHIBITION OF CD47/SIRPα BINDING AND NEDD8-ACTIVATING ENZYME E1 REGULATORY SUBUNIT FOR THE TREATMENT OF CANCER |
WO2022241157A1 (en) | 2021-05-13 | 2022-11-17 | ALX Oncology Inc. | Combination therapies for treating cancer |
WO2022245671A1 (en) | 2021-05-18 | 2022-11-24 | Gilead Sciences, Inc. | Methods of using flt3l-fc fusion proteins |
WO2022247933A1 (en) * | 2021-05-28 | 2022-12-01 | 百奥泰生物制药股份有限公司 | ANTI-SIRPα ANTIBODY AND USE THEREOF |
US11572412B2 (en) | 2021-06-04 | 2023-02-07 | Boehringer Ingelheim International Gmbh | Anti-SIRP-alpha antibodies |
WO2022271684A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2022271677A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2022271659A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2022271650A1 (en) | 2021-06-23 | 2022-12-29 | Gilead Sciences, Inc. | Diacylglyercol kinase modulating compounds |
WO2023278377A1 (en) | 2021-06-29 | 2023-01-05 | Seagen Inc. | Methods of treating cancer with a combination of a nonfucosylated anti-cd70 antibody and a cd47 antagonist |
WO2023020459A1 (en) | 2021-08-17 | 2023-02-23 | 杭州九源基因工程有限公司 | MONOCLONAL ANTIBODY TARGETING SIRPα AND USE THEREOF |
WO2023076983A1 (en) | 2021-10-28 | 2023-05-04 | Gilead Sciences, Inc. | Pyridizin-3(2h)-one derivatives |
WO2023077030A1 (en) | 2021-10-29 | 2023-05-04 | Gilead Sciences, Inc. | Cd73 compounds |
WO2023094698A1 (en) | 2021-11-29 | 2023-06-01 | Ose Immunotherapeutics | Specific antagonist anti-sirpg antibodies |
WO2023122615A1 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023122581A2 (en) | 2021-12-22 | 2023-06-29 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023147418A1 (en) | 2022-01-28 | 2023-08-03 | Gilead Sciences, Inc. | Parp7 inhibitors |
WO2023154578A1 (en) | 2022-02-14 | 2023-08-17 | Sana Biotechnology, Inc. | Methods of treating patients exhibiting a prior failed therapy with hypoimmunogenic cells |
WO2023178181A1 (en) | 2022-03-17 | 2023-09-21 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
EP4245756A1 (en) | 2022-03-17 | 2023-09-20 | Gilead Sciences, Inc. | Ikaros zinc finger family degraders and uses thereof |
WO2023183313A1 (en) | 2022-03-22 | 2023-09-28 | Sana Biotechnology, Inc. | Engineering cells with a transgene in b2m or ciita locus and associated compositions and methods |
WO2023183817A1 (en) | 2022-03-24 | 2023-09-28 | Gilead Sciences, Inc. | Combination therapy for treating trop-2 expressing cancers |
WO2023196784A1 (en) | 2022-04-05 | 2023-10-12 | Gilead Sciences, Inc. | Combinations of antibody therapies for treating colorectal cancer |
WO2023205719A1 (en) | 2022-04-21 | 2023-10-26 | Gilead Sciences, Inc. | Kras g12d modulating compounds |
US12098214B2 (en) | 2022-05-12 | 2024-09-24 | ALX Oncology Inc. | Combination therapies for treating cancer |
WO2023235754A1 (en) | 2022-06-01 | 2023-12-07 | ALX Oncology Inc. | Combination therapies for treating urothelial carcinoma |
WO2024006929A1 (en) | 2022-07-01 | 2024-01-04 | Gilead Sciences, Inc. | Cd73 compounds |
WO2024064668A1 (en) | 2022-09-21 | 2024-03-28 | Gilead Sciences, Inc. | FOCAL IONIZING RADIATION AND CD47/SIRPα DISRUPTION ANTICANCER COMBINATION THERAPY |
WO2024105180A1 (en) | 2022-11-16 | 2024-05-23 | Boehringer Ingelheim International Gmbh | Predictive efficacy biomarkers for anti-sirpa antibodies |
WO2024137852A1 (en) | 2022-12-22 | 2024-06-27 | Gilead Sciences, Inc. | Prmt5 inhibitors and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
PE20181921A1 (en) | 2018-12-11 |
EA201891882A1 (en) | 2019-07-31 |
CN109071664A (en) | 2018-12-21 |
AU2017248626B2 (en) | 2024-05-09 |
CN109071664B (en) | 2023-02-21 |
SG11201808465UA (en) | 2018-10-30 |
CA3020373A1 (en) | 2017-10-19 |
EP3443010B1 (en) | 2024-08-07 |
BR112018070823A2 (en) | 2019-02-05 |
EP3443010A2 (en) | 2019-02-20 |
WO2017178653A3 (en) | 2018-07-05 |
CO2018010855A2 (en) | 2018-11-13 |
AU2017248626A1 (en) | 2018-10-11 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2017248626B2 (en) | New anti-SIRPa antibodies and their therapeutic applications | |
US20220281991A1 (en) | ANTI-SIRPa ANTIBODIES AND THEIR THERAPEUTIC APPLICATIONS | |
US11713356B2 (en) | Modified bifunctional anti-human signal regulatory protein alpha (SIRPa) antibody and method of use thereof for treating cancer | |
US20230340133A1 (en) | Antibodies Directed Against CD127 | |
US20220242951A1 (en) | USES OF ANTI-SIRPg ANTIBODIES | |
WO2023052541A1 (en) | Combination of an anti-btn3a activating antibody and an il-2 agonist for use in therapy | |
EA044391B1 (en) | ANTIBODIES TO SIRPa AND OPTIONS FOR THEIR THERAPEUTIC USE |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 201891882 Country of ref document: EA |
|
ENP | Entry into the national phase |
Ref document number: 2018550322 Country of ref document: JP Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 11201808465U Country of ref document: SG |
|
ENP | Entry into the national phase |
Ref document number: 3020373 Country of ref document: CA |
|
ENP | Entry into the national phase |
Ref document number: 2017248626 Country of ref document: AU Date of ref document: 20170414 Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018070823 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 20187032968 Country of ref document: KR Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2017718881 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2017718881 Country of ref document: EP Effective date: 20181114 |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17718881 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 112018070823 Country of ref document: BR Kind code of ref document: A2 Effective date: 20181009 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 518400237 Country of ref document: SA |