WO2017165855A2 - Mutant proteins enabling agrochemical control of plant gene expression - Google Patents

Mutant proteins enabling agrochemical control of plant gene expression Download PDF

Info

Publication number
WO2017165855A2
WO2017165855A2 PCT/US2017/024153 US2017024153W WO2017165855A2 WO 2017165855 A2 WO2017165855 A2 WO 2017165855A2 US 2017024153 W US2017024153 W US 2017024153W WO 2017165855 A2 WO2017165855 A2 WO 2017165855A2
Authority
WO
WIPO (PCT)
Prior art keywords
mutated
pyr
pp2c
plant
pyl receptor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/024153
Other languages
French (fr)
Other versions
WO2017165855A3 (en
Inventor
Sean R. CUTLER
Sang-Youl Park
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of California Berkeley
University of California San Diego UCSD
Original Assignee
University of California Berkeley
University of California San Diego UCSD
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of California Berkeley, University of California San Diego UCSD filed Critical University of California Berkeley
Priority to US16/087,024 priority Critical patent/US10919943B2/en
Publication of WO2017165855A2 publication Critical patent/WO2017165855A2/en
Publication of WO2017165855A3 publication Critical patent/WO2017165855A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/415Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/82Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
    • C12N15/8216Methods for controlling, regulating or enhancing expression of transgenes in plant cells
    • C12N15/8237Externally regulated expression systems
    • C12N15/8238Externally regulated expression systems chemically inducible, e.g. tetracycline

Definitions

  • the first chemically induced heterodimerization system harnessed immunosuppressant regulated protein-protein interactions to build rapamycin-controlled three-hybrid systems (Belshaw, Ho, Crabtree, & Schreiber, 1996: Bier, Thiel, Briels, & Ottmann, 2 15; Licitra & Liu, 1996), in which transcription of a target gene is controlled by a CID module that controls the physical association of a transcriptional activation (AD) and DNA binding domain (DBD).
  • AD transcriptional activation
  • DBD DNA binding domain
  • rapamycin or related rapalogs
  • FKBP prolyl-isomerase FKBP
  • FRB the FKBP-rapamycin binding domain of mammalian Target of Rapamycin Complex 1
  • CID can be used to regulate the enzymatic activity of enzymes split into two non-functional halves, as recently Illustrated with CAS9 (Zetsche, Volz, & Zhang, 2015). It can also be used to regulate the activity of proteins that function in specific subcellular locations.
  • the "anchor away" method uses a FRB domain fused to cytoplasmic anchors (such as abundant nbosomai or plasma membrane proteins) to relocalize target-FKBP fusion proteins away from sites of action in response to rapamycin, enabling construction of inducible ioss-of-function phenotypes (Haruki, Nishikawa, & Laemmli, 2008).
  • Proteins can also be recruited to the proteasome or mitochondrial membrane using CID to create chemically inactivated protein functions (Janse, Crosas, Finley, & Church, 2004).
  • CID chemically inactivated protein functions
  • the converse creation of chemically activatable protein forms can be engineered using an unstable FKBP allele that is rapidly degraded under basal conditions, but stabilized upon rapamycin treatment by interaction FRB (Banaszynski, Chen, aynard-Smith, Ooi, & Wandless, 2006).
  • CID modules are powerful tools that can be leveraged to engineer many modes of chemically regulated activities, with many examples beyond those provided above.
  • ABA abscisic acid
  • CIP chemically induced proximity
  • the first polypeptide comprises the mutated PYR/PYL receptor polypeptide fused to a transcriptional activation domain and the second polypeptide comprises the mutated PP2C fused to a DNA binding domain.
  • the first polypeptide comprises the mutated PYR PYL receptor polypeptide fused to a DNA binding domain and the second polypeptide comprises the mutated PP2C fused to a transcriptional activation domain.
  • one or both of the polynucleotide that encodes the first polypeptide and the polynucleotide that encodes the second polypeptide is operably linked to a promoter that comprises a polynucleotide sequence that binds the DNA binding domain.
  • the one or more mutations in the PYRPYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an ammo acid corresponding to position F61, S85, T156, or T162 in PYR1.
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from F61K, S85P, T156P, and T162D.
  • the mutated PYR/PYL receptor polypeptide further comprises a mutation at one or more amino acids corresponding to positions Y58, K59, V81, A89, F108, S122, M158, F159, or A160 in PYR1 (SEQ ID NG:1), wherein the mutation is selected from Y58H, K59R, V81C, V81T, V81T, A89W, F108A, F108C, F108E, F108G, F108L F108L, F108N, F108Q, F108S, F108T, F108V, S122G, M158I, M158V, F159A, F159C, F159I, F159L, F159M, F159T, F159V, A160C, A160V, or combinations tliereof
  • the mutated PYR/PYL receptor comprises: mutations corresponding to Y58H, K59R, V81L F108A, S122G,
  • the mutated PYR/PYL receptor polypeptide as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs: 1-14, 19-21, or 41-115.
  • the mutated PYR/PYL receptor polypeptide as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs: 1-14, 19-21, or 41-115 and further comprises one or more mutations as described herein (e.g., a substitution at one or more amino acid residues corresponding to F61, 162, 63, 184, S85, G86, L87, P88, A89, HI 15, RI 16, LI 17, P148, GI50, N151, D155, T156, M158, F159, T162, or K170 in SEQ ID NO: l).
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E201, E203, H245, G246, G247, E323, K381, 1383, W385, R389, F391, G392, V393, or Y404 in HAB 1 (SEQ ID NO:22).
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E201H/K,
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E203, 1383, or V393 in HABI .
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E203D, E203T, E203W, 1383G, V393K, V393R, or V393Q.
  • the mutated PP2C further comprises one or more mutations that disrupts the catalytic acti v ity of the mutated PP2C.
  • the mutated PP2C comprises a mutation at one or more amino acids corresponding to positions R199, D204, S322, or R505 in HAB1 (SEQ ID NO: 22) wherein the mutation is selected from R199A, D204A, S322D, S322E, R505A, or combinations thereof.
  • the mutated PP2C comprises: mutations corresponding to D204A, V393R, and R505A in HAB 1 ; or mutations corresponding to R199A, D204A, S322D, V393R, and R505A in
  • the mutated PP2C as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs:22-31.
  • the mutated PYR PYL receptor polypeptide comprises a mutation corresponding to F61K in PYR1 and the mutated PP2C comprises a mutation corresponding to V393Q in HAB l;
  • the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYR1 and the mutated PP2C comprises a mutation corresponding to E203D in HAB 1:
  • the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYR1 and the mutated PP2C comprises a mutation corresponding to E203T in HABl:
  • the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYR1 and the mutated PP2C comprises a mutation corresponding to E203W m HABl;
  • the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to T156P in PYRl and the mutated PP2C comprises a mutation corresponding to 1383G in HAB 1 ;
  • the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to T162D in PYR l and the mutated PP2C comprises a mutation corresponding to V393R m HAB l .
  • the orthogonal ligand is an agrochemical. In some embodiments, the orthogonal ligand is mandipropamid.
  • a cell e.g., plant, animal, mammalian, bacterial, or fungal cell
  • the method comprises contacting a cell or plant as described herein with the orthogonal ligand, wherein the step of contacting the plant or cell with the orthogonal ligand activates an interaction between the mutated PYR/PYL and the mutated PP2C but does not significantly activate an endogenous abscisic acid (ABA) signaling pathway in the cell or plant.
  • ABA abscisic acid
  • contacting the plant or cell with the orthogonal ligand activates an interaction between the mutated PYR/PYL and the mutated PP2C, thereby associating die DNA binding domain and the transcriptional activation domain and activating expression of the gene, protein, or henotype.
  • expression cassettes comprising the expression cassette
  • a promoter operably linked to one or more polynucleotides encoding a mutated PYR/PYL receptor polypeptide and a mutated type 2C protein phosphatase (PP2C)
  • the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR ' PYL receptor polypeptide and wherein the mutated PYR/PYL receptor polypeptide comprises a mutation that disrupts binding to a wild-type PP2C, wherein the mutated PP2C comprises a mutation that disrupts binding to a wild-type PYR'PYL receptor polypeptide, and wherein the mutated PYR/PYL receptor polypeptide and the mutated PP2C interact with each other.
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61 , 162, K63, 184, S85, G86, L87, P88, A89, HI 15, Rl 16, LI 17, P148, G150, N 15 L D155, T156, M158, F159, T162, or K170 in PYR1 (SEQ ID NO: l).
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F6 I , S85, TI 56, or T162 in PYR1.
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from 1-6 s K . S85P, T156P, and T162D,
  • the mutated PYR/PYL receptor polypeptide further comprises a mutation at one or more amino acids corresponding to positions Y58, K59, V81, A89, F 108, S 122, M158, F159, or A 160 in PYRi (SEQ ID NO: l ), wherein the mutation is selected from Y58H, K59R, V81C, V81L V81T, A89W, F108A, F108C, F108E, F108G, F108I, F108L, F 1G8N, F 108Q, F 108S, F 108T, F 108V, S 122G, M158I, M158V, F159A, F159C, F159I, F 159L, F159M, F 159T, F 159V, A 160C, A160V, or combinations thereof.
  • the mutated PYR/PYL receptor comprises: mutations corresponding to Y58H, K59R, V
  • the mutated PYR/PYL receptor polypeptide as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs: 1 -14 or 19-21.
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E201 , E203, H245, G246, G247, E323, K381, 1383, W385, R389, F391 , G392, V393, or Y404 in HAB 1 (SEQ ID NO:22).
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E201H/K,
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E203, 1383, or V393 in HAB1.
  • the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E203D, E203T, E203W, I383G, V393K, V393R, or V393Q.
  • the mutated PP2C comprises: mutations corresponding to D204A, V393R, and R5G5A in HAB 1: or mutations corresponding to R199A, D204A, S322D, V393R, and R505A in HAB1.
  • the mutated PP2C as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs:22-31.
  • the present invention provides for isolated nucleic acids comprising a polynucleotide encoding a polypeptide comprising a mutated PYR/P YL receptor polypeptide as described herein fused to a transcriptional activation domain or a DNA binding domain, wherein the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal iigand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and wherein the mutated PYR/PYL receptor polypeptide comprises a mutation that disrupts binding to a wild-type PP2C.
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61, 162, K63, 184, S85, G86, 1.87. P88, A89, HI 15, Rl 16, LI 17, P148, G150, NISI, D155, T156, M158, F159, T162, or K170 in PYR1 (SEQ IDNO:l).
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from
  • the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61, S85, T156, or T162 in PYR1, In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from F61K, S85P, T156P, and T162D.
  • the mutated PYR/PYL receptor polypeptide further comprises a mutation at one or more amino acids corresponding to positions Y58, K59, V81, A89, F108, S122, M158, F159, or ⁇ 1 0 in PYR1 (SEQ ID NO:!), wherein the mutation is selected from Y58H, K59R, V81C, V81I, V81T, A89W, F108A, F108C, F108E, F108G, F108I, F108L, F108N, F108Q, F108S, F108T, F108V, S122G, M158I, M158V, F159A,
  • the mutated PYR/PYL receptor comprises: mutations corresponding to Y58H, K59R, V81I, F108A, S122G, Ml 581, F159V, A160V, and T162D in PYR!;
  • a wild-type PP2C refers to a naturally -occurring PP2C protein that negatively regulates ABA signaling.
  • a “mutated PP2C” or “modified PP2C” refers to a PP2C protein that is a variant from, a naturally-occurring (i.e., wild-type) PP2C.
  • a mutated or modified PP2C protein comprises one or more amino acid substitutions relative to a corresponding wild-type PP2C protein.
  • a "mutated" polypeptide or “modified” polypeptide can be generated by any method for generating non-wild type nucleotide sequences.
  • nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine
  • each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
  • the orthogonal ligands are agrichemicals, e.g., fungicides, herbicides, pesticides, nematicides, plant activators, synergists, herbicide safeners, plant growth regulators, insect repellants, and/or fertilizers.
  • the orthogonal ligand is mandipropamid .
  • plant includes whole plants, shoot vegetative organs and/or structures (e.g. , leaves, stems and tubers), roots, flowers and floral organs (e.g.
  • the class of plants that can be used in the method of the invention is generally as broad as the class of higher and lower plants amenable to transformation techniques, including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, and multicellular algae. It includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid, haploid, and hemizygous,
  • the mutated PYR/PYL receptor proteins and mutated PP2Cs described herein can be used to control gene expression in a plant through the use of an orthogonal ligand such as an agrochemical.
  • the mutated PYR PYL receptor proteins and mutated PP2Cs described herein can be used to control gene expression in a cell (e.g., a plant, animal, mammalian, or fungal cell) through the use of an orthogonal ligand such as an agrochemical.
  • more specific consensus sequences can be generated by aligning subsets of the 14 members of the Arabidopsis PYR/PYL proteins, as shown below.
  • the consensus sequences of SEQ ID NOs: 18, 116, and 1 17 were generated by aligning the Arabidopsis PYR/PYL receptor proteins PYR1, PYL1, PYL2, PYL3, PYL4, PYL5, and PYL6.
  • the consensus sequences of SEQ ID NOs: 118, 119, and 120 were generated by aligning the Arabidopsis PYR/PYL receptor proteins PYL7, PYL8, PYL9, and PYL10.
  • 1 he consensus sequences of SEQ ID NOs: 121 and 122 were generated by aligning the
  • VGRxVxVxSGLPAxxSxExLxxxDxxxxxxxxxFxxxGGxHRLxNYxSVT (SEQ ID NO: 1 16)
  • VxESYxVDxPxGNxxxxTxxFxDxxxxxNLQxL (SEQ ID NO : 117)
  • Mammalian or yeast two-hybrid approaches can be used to determine whether polypeptides interact or bind when expressed together in a cell.
  • both positive and negative selection schemes can be utilized in the two-hybrid assay. Binding can also be measured indirectly, such as by measuring inhibition of PP2C activity. Inhibition of PP2C activity can be measured in live cells using the yeast two hybrid or other cell-based methods.
  • residu es of the PP2C binding interface are also highly conserved among other PYR/PYL family members.
  • corresponding mutations can be made in the PP2C binding interface of other PYR PYL receptor proteins of interest by aligning the sequences of PYR1 (SEQ ID NO: 1) and the PYR/PYL protein of interest.
  • the mutated PYR/PYL receptor comprises a mutation at position S85 (e.g., a S85A/C/D/E/F/G H7I K/L M/N/P/Q/R/VAVA 7 substitution).
  • the mutated PYR/PYL receptor comprises a mutation at position G86 (e.g., a
  • the mutated PYR'PYL receptor comprises a mutation at position L87 (e.g., a
  • the mutated PYR/PYL receptor comprises a mutation at position P88 (e.g., a
  • the mutated PYR'PYL receptor comprises a mutation at position G 150 (e.g., a G ISQI/NAVW substitution).
  • the mutated PYR/PYL receptor comprises a mutation at position N151 (e.g., a N15 IGD/E/F/G/EJliKJlJM/P/Q/RN/WFY substitution).
  • the mutated PYR/PYL receptor comprises a mutation at position D 154.
  • the mutated PYR'PYL receptor comprises a mutation at position D155 (e.g., a D155C/F/G/1/K/L/M/P/R/VAWY substitution). In some embodiments, the mutated PYR PYL receptor comprises a mutation at position T156 (e.g., a
  • PYR/PYL receptor polypeptides that are agonized by orthogonal ligands are described, e.g., in LTS 201 1/0271408 and WO 2014/159394, incorporated by reference herein.
  • the orthogonal ligand is an agrochemical.
  • Agrochemicals are often prepared and applied to plants as esters or salts, which may improve uptake and efficacy.
  • the action of ubiquitous cellular esterases can convert esters (or homologous compounds such as the S- methyl derivatives of acibenzolar) into free acids or alcohols, which are the bioactive forms.
  • the agrochemical comprises a fungicide, an herbicide, a pesticide, a nematicide, a plant activator, a synergist, an herbicide safener, a plant growth regulator, an insect repeilant, or a fertilizer.
  • the agrochemical is mandipropamid, bromoxynil, chloroxynil, loxynil, fludioxonil, coumatetralyl, dichiobenil, fenhexamid, benoxacor, ⁇ (acibenzolar-s-methyl), or benzothiadiazoie.
  • an orthogonal ligand e.g., mandipropamid
  • agonizes a mutated PYR/PYL receptor polypeptide but does not significantly agonize a wild-type PYR PYL receptor polypeptide, when the orthogonal ligand is contacted to the PYR/PYL receptor polypeptide.
  • a agent "agonizes" a PYR PYL receptor protein if the presence of the agent results in activation or up-regulation of activity of the receptor, e.g., to increase downstream signaling from the PYR/PYL receptor.
  • an agent agonizes a PYR/PYL receptor if, when the agent is present at a concentration no greater than 200 ⁇ , contacting the agent to the PYR PYL receptor results in activation or up- regulation of the activity of the P YR/PY L receptor. If an agent does not induce activation or up-regulation of a PYR/PYL receptor protein's activity when the agent is present at a concentration no greater than 200 ⁇ , then the agent does not significantly agonize the PYR PYL receptor.
  • activation requires a minimum threshold of activity to be induced by the agent.
  • Determining whether this minimum threshold of activity has been met can be accomplished, e.g., by using an enzymatic phosphatase assay that sets a minimum value for the level of enzymatic activity that must be induced (e.g., enzymatic activity of a wild-type PP2C), or by using an enzymatic phosphatase assay in the presence of a colorimetric detection reagent (e.g., para-nitrophenylphosphate) wherein the minimum threshold of activity has been met if a color change is observed.
  • a colorimetric detection reagent e.g., para-nitrophenylphosphate
  • the mutated PYR/PYL receptor comprises a substitution at a residue corresponding to amino acid position 59 in PYR1 (SEQ ID NO: 1).
  • a K59 mutation is not only sufficient to abolish ABA sensitivity in a modified PYR/PYL receptor protein, it is also sufficient to confer sensitivity to an orthogonal ligand (i.e., a molecule other than ABA) on a modified PYR/PYL receptor protein.
  • the K59 mutation that results in receptor activation by an orthogonal ligand is a substitution of an alanine residue for the wild-type residue, a substitution of a cysteine residue for the wild-type residue, a substitution of an aspartic acid residue for the wild-type residue, a substitution of a glutamic acid residue for the wild-type residue, a substitution of a phenylalanine residue for the wild-type residue, a substitution of a glycine residue for the wild-type residue, a substitution of a histidine residue for the wild-type residue, a substitution of a leucine residue for the wild-type residue, a substitution of a methionine residue for the wild-type residue, a substitution of an asparagine residue for the wild-type residue, a substitution of a glutamme residue for the wild-type residue, a substitution of an arginine residue for the wild-type residue, a substitution of a serine residue for the wild-type residue, a substitution of a
  • the modified PYR PYL receptor protein comprises one or more substitutions selected from Y58H, V81C, YK ! i . V81T, V83L, L87A, A89W, F108A, F108C, F108E, F108G, F108I, F108L, F108N, F1Q8Q, F108S, F 108T, F108V, S122G, M158I, M158V, F159A, F159C, F159I, F159L, F159M, F159T, F159V, A160V, V164I, or combinations thereof.
  • the mutated PYR PYL receptor protein comprises a mutation at one or more amino acids corresponding to positions Y58, 59, V81, A89, Fl 08, S 122,
  • the mutated PYR/PYL receptor comprises one or more substitutions selected from Y58H, V81C, V81I, V81T, F108A, F108C, F108E, F108G, F108I, F108L, F108N, F108Q, F108S, F108T, F108V, SI22G, M158I, M158V, F159A, F159C, F159I, F159L, F159M, F159T, F159V, A 160V, T162D, T162E, T162F, T162P, and combinations thereof.
  • the mutated PYR PYL receptor polypeptide is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) SEQ ID NO:20.
  • the mutated PYR PYL receptor polypeptide comprises the sequence of SEQ ID NO: 20.
  • the mutated PYR/PYL receptor polypeptide is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) SEQ ID NO:21.
  • the mutated PYR/PYL receptor polypeptide comprises the sequence of SEQ ID NO:21.
  • mutated PP2Cs that (I) comprise one or more mutations that disrupts binding to a wild-type PYR/PYL receptor polypeptide and that (2) optionally comprise one or more mutations that disrupts the catalytic activity of the PP2C are provided.
  • polynucleotides encoding polypeptides comprising the mutated PP2Cs expression cassettes and expression vectors comprising said polynucleotides; cells (e.g., plant, animal, mammalian, bacterial, or fungal cells), plants, and plant parts comprising the mutated PP2Cs; methods of making cells or plants comprising the mutated PP2Cs;
  • methods of making the mutated PP2Cs methods of making the mutated PP2Cs; methods of activating an orthogonal PYR PYL-PP2C interaction in cells or plants comprising the mutated PP2Cs and mutated PYR/PYL receptor polypeptides as described above; and methods of controlling gene expression in ceils or plants comprising the mutated PP2Cs and mutated PYR/PYL receptor polypeptides as described herein.
  • PP2Cs such as the PP2Cs within the "Clade A" cladogram, are key negative regulators of ABA signaling.
  • HAB1, ABI1, ABI2, and PP2CA have been shown to affect both seed and vegetative responses to ABA. See, e.g., Rubio et al., Plant Physiology, 2009, 150: 1345-1355, incorporated by reference herein.
  • ABA signaling via PP2Cs is modulated by PYR/PYL receptor polypeptides.
  • PYR/PYL proteins are not bound to PP2Cs, and therefore, PP2C activity is high, which prevents phosphorylation and activation of snRK2s (subfamily 2 SNF1 -related kinases) and downstream factors.
  • snRK2s subfamily 2 SNF1 -related kinases
  • PYR/PYL proteins bind and inhibit PP2Cs, which allows accumulation of phosphoiylated downstream factors and ABA transcriptional responses. See, e.g., Park et al., Science, 2009, 324: 1068-1071, incorporated by reference herein.
  • PP2Cs are found in Arabidopsis and other species of plants as well as across kingdoms, and are characterized in part by the presence of a serine/threonine phosphatase catalytic site.
  • a wild-type PP2C protein comprises a Clade A PP2C protein.
  • a wild-type PP2C protein comprises any of SEQ ID NOs:22, 23, 24, 25, 26, 27, 28, or 29.
  • a wild-type PP2C protein is substantially identical to (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, or 99% identical to) any of SEQ ID NOs:22, 23, 24, 25, 26, 27, 28, or 29.
  • a mutated PP2C protein is substantially identical to a SEQ ID listed herein and further comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) mutation at an amino acid position.
  • a mutated PP2C is substantially identical to any of SEQ ID NOs:22-29 and further comprises at least one mutation at any amino acid position.
  • a mutated PP2C protein comprises one or more mutations that disrupts binding to a wild-type PYR/PYL receptor protein (e.g., wild-type PYR1).
  • a mutated PP2C exhibits "disrupted" binding to a wild-type PYR/PYL receptor protein if the level of binding between the mutated PP2C protein (e.g., a mutated HAB1 protein) and the wild-type PYR/PYL receptor protein is decreased by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more in the presence of ABA as compared to the le v el of binding between the corresponding wild-type PP2C protein (e.g., wild-type HAB1) and the wild-type PYR/PYL receptor protein in the presence of ABA,
  • a mutated PP2C protein comprises one or more mutations that
  • a mutated PP2C that comprises one or more mutations that disrupts binding to a wild-type PYR/PY L receptor protein comprises a mutation at one or more residues of the PYR PYL binding interface.
  • the PYR/PYL binding interface of a PP2C protein comprises amino acid residues that are in close proximity (e.g., within about 5 A) to die PYR/PYL receptor when PP2C, the PYR PYL receptor, and ABA are all bound together in a ternary complex.
  • the PYR/PYL binding interface is determined with reference to the PYR/PYL protein PYR1.
  • the PYR/PYL binding interface in HAB i is made up of the following 20 amino acid residues: R199, S200, E20I , E203, H245, G246, G247, S322, E323, T324, K381 , 1383, Q384, W385, Q386, R389, F391, G392, V393, and Y404.
  • the residues of the PYR PYL binding interface are conserved among other PP2C family members.
  • corresponding mutations can be made in the PYR/PYL binding interface of other PP2C proteins of interest by aligning tlie sequences of HAB 1 (SEQ ID N():22) and the PP2C protein of interest.
  • a mutated PP2C comprises one, two, three, four, five, six, seven, eight, nine, or more ammo acid substitutions in the PYR PYL binding interface relative to wild-type PP2C.
  • a muated PP2C comprises 1 -10 mutations, 5-10 mutations, 1 -7 mutations, 1-5 mutations, 1 -3 mutations, 1-2 mutations, 2-7 mutations, or 2-5 mutations in the PYR/PYL binding interface relative to wild-type PP2C.
  • a mutated PP2C comprises a substitution at one or more of residues selected from E201, E203, H245, G246, G247, E323, K381 , 1383, W385, R389, F391 , G392, V393, and Y404 in HAB I .
  • a mutated PP2C comprises one or more substitutions selected from E201H/K, E203A/CfD/F/GMfU ⁇ JUMm/P/R/Sn:fV/W/Y, m45A/C/D/E F/G/I K L/ /N/P/Q R/S rA ⁇ /WA r ,
  • the mutated PP2C comprises a mutation at position R199. In some embodiments, die mutated PP2C comprises a mutation at position S200. In some embodiments, the mutated PP2C comprises a mutation at position E201 (e.g., a E201H/K substitution). In some embodiments, the mutated PP2C comprises a mutation at position E203 (e.g., a E203A/C/D/F/G/H/I /IJM N/P R/S TA r AV ' Y substitution). In some embodiments, die mutated PP2C comprises a mutation at position H245 (e.g., a
  • the mutated PP2C comprises a mutation at position G246 (e.g., a G246A/C/D E/F/H I/K/UM/N/P/Q/R S/T/V W/Y substitution).
  • the mutated PP2C comprises a mutation at position G247 (e.g., a
  • the mutated PP2C comprises a mutation at position S322. In some embodiments, the mutated PP2C comprises a mutation at position E323 (e.g., a E323L substitution). In some embodiments, the mutated PP2C comprises a mutation at position T324. In some embodiments, the mutated PP2C comprises a mutation at position K381 (e.g., a K381W substitution). In some embodiments, die mutated PP2C comprises a mutation at position 1383 (e.g., a
  • the mutated PP2C comprises a mutation at position Q384. In some embodiments, the mutated PP2C comprises a mutation at position W385 (e.g., a W385A/( ⁇ /E F/G/H/I K/IJM/N P/Q/R/S/TA ⁇ Y substitution). In some embodiments, the mutated PP2C comprises a mutation at position Q386.
  • the mutated PP2C comprises a mutation at position R389 (e.g., a, R3%9A/C/D/EiF/G/H/l/KAJM/P/QriN/W/Y substitution) .
  • the mutated PP2C comprises a mutation at position F391 (e.g., a F391D/E/P substitution).
  • the mutated PP2C comprises a mutation at position G392 (e.g., a substitution).
  • the mutated PP2C comprises a mutation at position V393 (e.g., a V393D E/G/K/N/P/Q R/S substitution).
  • the mutated PP2C comprises a mutation at position Y404 (e .g . , a Y404D/E/G/K/N/P/Q/R/S/T substitution) .
  • the mutated PP2C protein comprises one or more mutations at amino acids corresponding to position E203, 1383, or V393 in HAB 1.
  • the mutated PP2C protein comprises one or more substitutions selected from E2Q3A/Cfo/F/G/H/I/K/UMn /P/R/S/T/V/W/Y, I383D E/G H/K/N P/Q/R/S TAV/Y, V393D E/G /N/P/Q R/S, and combinations thereof.
  • the mutated PP2C protein comprises one or more substitutions selected from E203D, E203T, E203W, I383G, V393K, V393R, V393Q, and combinations thereof.
  • the mutated PP2C further comprises one or more mutations that disrupts the catalytic activity of the mutated PP2C.
  • the mutated PP2C exhibits "disrupted" catalytic activity if the level of phosphatase activity of the mutated PP2C (e.g., a mutated HAB i) is decreased by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%> or more relative to a corresponding wild-type PP2C (e.g., wild-type HAB I).
  • the mutated PP2C does not have a detectable level of phosphatase activity.
  • phosphatase activity is measured in a phosphatase assay, e.g., as described herein in the Examples section.
  • the catalytic activity of the mutated PP2C is measured by measuring the activity of a downstream signaling pathway component (e.g., measuring the activity of a downstream snRK2 kinase).
  • the mutated PP2C comprises a mutation at a residue within die PP2C catalytic active site. In some embodiments, the mutated PP2C comprises a mutation at one or more amino acid residues corresponding to the positions D204 or R505 in HAB 1 (SEQ ID NO:22). In some embodiments, the mutated PP2C comprises one or more substitutions selected from R505A and D204A.
  • the mutated PP2C further comprises one or more substitutions that stabilizes or strengthens interactions with a mutated PYR/PYL protein (e.g., at a site within the PYR/PYL interface).
  • the mutated PP2C further comprises a mutation at one or more amino acid residues corresponding to the positions R199 and S322 in HAB1.
  • the mutated PP2C further comprises one or more substitutions selected from R199A, S322D, and S322E.
  • the mutated PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) any of SEQ ID NO:22 ⁇ 29 and comprises mutations corresponding to D204A, V393R, and R505A in HAB 1 .
  • the mutated PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%>, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%>, at least 98%, or at least 99% identical to) any of SEQ ID NQ:22 ⁇ 29 and comprises mutations corresponding to R199A, D204A, S322D, V393R, and R505A in HAB1.
  • Embodiments of the present invention provide for use of the above proteins and/or nucleic acid sequences, encoding such polypeptides, in the methods and compositions (e.g., expression cassettes, plants, cells, etc.) of the present invention.
  • the isolation of a polynuc eotide sequence encoding a plant wild-type PYR/PYL receptor and/or PP2C may be accomplished by a number of techniques. For instance, oligonucleotide probes based on the PYR/PYL coding sequences disclosed herein (e.g.
  • oligonucleotide probes based on the PP2C coding sequences disclosed herein can be used to identify the desired wild-type PP2C gene in a cDNA or genomic DNA library.
  • genomic libraries large segments of genomic DNA are generated by random fragmentation, e.g., using restriction endonucleases, and are ligated with vector DNA to form concatemers that can be packaged into the appropriate vector.
  • mRNA To prepare a cDNA library, mRNA.
  • a cDNA library containing the gene transcript of interest is prepared from the mRNA.
  • cDNA may be prepared from mRNA extracted from other tissues in which the PYR/PYL gene and/or PP2C gene is expressed.
  • the cDNA or genomic library can then be screened using a probe based upon the sequence of a PYR/PYL gene and/or PP2C gene disclosed here. Probes may be used to hybridize with genomic DN A or cDNA sequences to isolate homologous genes in the same or different plant species. Alternatively, antibodies raised against a polypeptide can be used to screen an mRNA expression library.
  • the nucleic acids encoding a PYR/PYL or a PP2C can be amplified from nucleic acid samples using amplification techniques. For instance, polymerase chain reaction (PCR) technology can be used to amplify the coding sequences of a PYR PYL and/or a P.P2C directly from, genomic DNA, from cDNA, from genomic libraries or cDNA libraries.
  • PCR polymerase chain reaction
  • PCR and other in vitro amplification methods may also be useful, for example, to clone polynucleotide sequences encoding the PYR/PYL and/or PP2C to be expressed, to make nucleic acids to use as probes for detecting the presence of the desired mRNA in samples, for nucleic acid sequencing, or for other purposes.
  • PCR Protocols A Guide to Methods and Applications . (Innis, M., Gelfand, D., Smnsky, J. and White, T., eds.), Academic Press, San Diego (1990).
  • Appropriate primers and probes for identifying sequences from plant tissues are generated from comparisons of the sequences provided here with other related genes.
  • the partial or entire genome of a number of plants has been sequenced and open reading frames identified.
  • a BLAST search one can identify the coding sequence for a wild-type PYR/PYL or wild-type PP2C in various plants.
  • mutagenesis may be accomplished by means of error-prone PCR amplification (ePCR), which modifies PCR reaction conditions (e.g., using error-prone polymerases, varying magnesium or manganese concentration, or providing unbalanced dNTP ratios) in order to promote increased rates of error in DNA replication.
  • Kits for ePCR mutagenesis are commercially available, such as the GeneMorph® PCR Mutagenesis kit (Stratagene) and Diversify® PCR Random Mutagenesis Kit (Clontech). Briefly, DNA polymerase (e.g., Taq polymerase), salt (e.g..
  • binding assays can be used for determining whether the mutated PYR/PYL receptor protein and the PP2C protein interact with each other. Binding assays can involve contacting the mutated PYR PYL receptor polypeptide with the mutated PP2C and allowing sufficient time for the proteins to form a binding complex. Any binding complexes formed can be detected using any of a number of established analytical techniques. Protein binding assays include, but are not limited to, methods that measure co-precipitation or co- migration on non -denaturing SDS-polyacrylamide gels, and co-migration on Western blots (see, e.g., Bennet, J.P. and Yamamura, H.I.
  • one or more expression cassettes comprising the fusion proteins is expressed in a plant or plant cell.
  • one expression cassette comprises both a mutated PYR/PYL receptor protein fused to a transcriptional activation domain and a mutated PP2C protein fused to a DNA binding domain, or comprises both a mutated PP2C protein fused to a transcriptional activation domain and a mutated PYR/PYL receptor protein fused to a DNA binding domain, under the control of a heterologous promoter.
  • a first expression cassette comprises a first heterologous promoter for expressing a mutated PYR/PYL receptor protein fused to one of a
  • a second expression cassette comprises a second heterologous promoter for expressing a mutated PP2C protein fused to the other of a transcriptional activation domain or a DNA binding domain.
  • the first promoter and the second promoter are the same promoter.
  • the first promoter and the second promoter are different promoters.
  • the promoter comprises a sequence that is bound by the DNA binding domain.
  • one or both of the mutated PYR/PYL receptor protein (or mutant PYR/PYL fusion protein) and mutated PP2C protein (or mutant PP2C fusion protein) further comprises a sequence for localizing the expression of the mutated PYR/PYL protein or mutated PP2C protein, e.g., in the nucleus, in the cytoplasm of a cell, or in an organelle
  • PYR/PYL-PP2C interaction module e.g., mitochondria or chioropiast.
  • Localization of the PYR/PYL-PP2C interaction module to the nucleus of the cell can be advantageous, e.g., for regulating transcription factors or other nuclear proteins that require access to their DNA targets in order to control phenotypic outputs.
  • one or both of the mutated PYR/PYL receptor protein (or mutant PYR/PYL fusion protein) and mutated PP2C protein (or mutant PP2C fusion protein) is localized to the nucleus.
  • the mutated PYR/PYL receptor protein or fusion protein, or the mutated PP2C protein or fusion protein further comprises a nuclear localization sequence.
  • the nuclear localization sequence is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) the nuclear localization sequence having the amino acid sequence of SEQ ID NO: 37.
  • the nuclear localization sequence comprises the sequence of SEQ ID NO: 37.
  • one or both of the mutated PYR/PYL receptor protein (or mutant PYR/PYL fusion protein) and mutated PP2C protein (or mutant PP2C fusion protein) is localized to the cytoplasm.
  • the mutated PYR/PYL receptor protein or fusion protein, or the mutated PP2C protein or fusion protein further comprises a nuclear export sequence.
  • the nuclear export sequence is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) the nuclear export sequence having the amino acid sequence of SEQ ID NO: 38 or 39.
  • the nuclear export sequence comprises the sequence of SEQ ID NO:38 or 39.
  • polynucleotide sequence encoding a polypeptide comprising a mutated PYR/PYL receptor polypeptide and a polynucleotide sequence encoding a polypeptide comprising a mutated PP2C protein are obtained, the polynucleotide sequences can be used to prepare an expression cassette for expressing the mutated PYR/PYL receptor polypeptide and mutated PP2C in a cell (e.g., a plant, animal, mammalian, bacterial, or fungal cell) or in a transgenic plant, directed by a heterologous promoter.
  • a cell e.g., a plant, animal, mammalian, bacterial, or fungal cell
  • a transgenic plant directed by a heterologous promoter.
  • polynucleotide sequence encoding the polypeptide comprising the mutated PYR/PYL receptor polypeptide and the polynucleotide sequence encoding the polypeptide comprising the mutated PP2C protein are expressed in a single expression cassette (e.g., under the control of a single heterologous promoter or each polynucleotide under the control of its own promoter).
  • a first expression cassette is generated comprising the polynucleotide sequence encoding the polypeptide comprising the mutated PYR/PYL receptor polypeptide under the control of a first promoter
  • a second expression cassette is generated comprising the polynucleotide sequence encoding the polypeptide comprising the mutated PP2C protein under the control of a second promoter.
  • the first promoter and the second promoter are identical to each other. In some embodiments, the first promoter and the second promoter are not identical to each other.
  • a polynucleotide sequence for a mutated PYR PYL receptor polypeptide or a mutated PP2C protein in the above techniques, recombinant DNA vectors suitable for transformation of cells or plants are prepared. Techniques for transforming a wide variety of cells and higher plant species are well known and described in the technical and scientific literature. See, e.g., Weising et al. Ann. Rev. Genet. 22:421-477 (1988).
  • a DNA sequence coding for the mutated PYR/PYL receptor polypeptide preferably will be combined with transcriptional and translational initiation regulatory sequences which will direct the transcription of the sequence from the gene in the intended tissues of the transformed plant.
  • a promoter fragment may be employed to direct expression of the mutated PYR/PYL polynucleotide or mutated PP2C polynucleotide in all tissues of a regenerated plant.
  • Such promoters are referred to herein as "constitutive" promoters and are active under most environmental conditions and states of development or cell differentiation.
  • constitutive promoters include the cauliflower mosaic vims (CaMV) 35S transcription initiation region, the ⁇ - or 2'- promoter derived from T-DNA of Agrohacterium tumafaciens, and other transcription initiation regions from various plant genes known to those of skill.
  • the promoter may direct expression of the mutated PYR/PYL receptor protein or mutated PP2C in a specific tissue (tissue-specific promoters) or may be otherwise under more precise environmental control (inducible promoters).
  • tissue-specific promoters under developmental control include promoters that initiate transcription only in certain tissues, such as leaves, vegetative tissue, or guard cells (including but not limited to those described in WO/2005/085449; U.S. Patent No. 6,653,535; Li et al. , Sci China C Life Sci. 2005 Apr;48(2): 181-6; Husebye, et al, Plant Physiol, April 2002, Vol. 128, pp.
  • the promoter comprises a sequence that is bound by a DNA binding domain (e.g., by a PYR/PYL- BD or PP2C-BD fusion protein as described herein).
  • an upstream activating sequence can also be included for enhancing gene expression.
  • a promoter fragment can be employed to direct expression of a mutated PYR/PYL nucleic acid and/or mutated PP2C nucleic acid in all transformed cells or tissues, e.g., as those of a regenerated plant.
  • the term "constitutive regulatory element” means a regulator ⁇ ' element that confers a level of expression upon an operatively linked nucleic molecule that is relati v ely independent of the ceil or tissue type in which the constituti ve regulatory element is expressed.
  • a constitutive regulator] that is expressed in a plant generally is widely expressed in a large number of cell and tissue types. Promoters that drive expression continuously under physiological conditions are referred to as “constitutive" promoters and are active under most environmental conditions and states of development or cell differentiation.
  • CaMV 35S cauliflower mosaic virus 35S
  • the CaMV 35S promoter can be particularly useful due to its activity in numerous diverse plant species (Benfey and Chua, Science 250:959-966 (1990); Futterer et al, Physiol. Plant 79: 154 (1990); Odell et al., supra, 1985).
  • a tandem 35S promoter in which the intrinsic promoter element has been duplicated, confers higher expression levels in comparison to the unmodified 35S promoter (Kay et al., Science 236: 1299 (1987)).
  • Other useful constitutive regulatory elements include, for example, the cauliflower mosaic virus 19S promoter; the ubiquitin promoter; the Figwort mosaic vims promoter; and the nopaline synthase (nos) gene promoter (Singer et ai . Plant Mol. Biol. 14:433 (1990); An, Plant Physiol. 81 :86 (1986)).
  • Additional constitutive regulatory elements including those for efficient expression in monocots also are known in the art, for example, the pEmu promoter and promoters based on the rice Actin-1 5' region (Last et al. , Theor. Appl. Genet. 81 :581 (1991); Mcelroy et al., Mol. Gen. Genet. 231 : 150 (1991); Mcelroy et al. , Plant Cell 2: 163 (1990)).
  • Chimeric regulatory elements which combine elements from different genes, also can be useful for ectopically expressing a nucleic acid molecule encoding a mutated PYR/PYL receptor protein and/or mutated PP2C protein (Comai et al.. Plant Mol. Biol. 15:373 (1990)).
  • Plant Mol. Biol. 33 125-139 (1996)
  • Cat 3 from Arabidopsis (GenBank No . U43147, Zhong et al. , Mol. Gen. Genet. 251 : 196-203 ( 1996)), the gene encoding stearoyl-acyl carrier protein desaturase from Brassica napiis (Genbank No.
  • a promoter may direct expression of the mutated PYR/PYL polynucleotide and/or mutated PP2C polynucleotide under the influence of changing environmental conditions or developmental conditions.
  • environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, elevated temperature, drought, or the presence of light.
  • inducible promoters are referred to herein as "inducible" promoters.
  • the invention can incorporate a drought-specific promoter such as a drought-inducible promoter of maize (e.g., the maize rab!7 drought- inducible promoter (Vilardell et al . (1991) Plant Mol. Biol.
  • promoters which are inducible upon exposure to plant hormones can be used to express the mutated PYR/PYL polynucleotide and/or mutated PP2C polynucleotide.
  • the invention can use the auxin-response elements El promoter fragment (AuxREs) in the soybean (Glycine max L.) (Liu (1997) Plant Physiol. 1 15:397-407); the auxin-responsive Arabidopsis GST6 promoter (also responsive to salicylic acid and hydrogen peroxide) (Chen (1996) Plant J.
  • Plant promoters inducible upon exposure to chemicals reagents that may be applied to the plant, such as herbicides or antibiotics, are also useful for expressing the mutated PYR/PYL polynucleotide.
  • benzenesulfonamide herbicide safeners can be used (De Veylder (1997) Plant Cell Physiol. 38:568-577); application of different herbicide safeners induces distinct gene expression patterns, including expression in the root, hydathodes, and the shoot apical meristem.
  • a PYR/PYL and/or PP2C coding sequence can also be under the control of, e.g. , a
  • tetracycline-inducible promoter e.g., as described with transgenic tobacco plants containing the Avena sativa L. (oat) arginine decarboxylase gene (Masgrau (1997) Plant J. 11 :465-473); or, a salicylic acid-responsive element (Stange (1997) Plant J. 11 : 1315-1324; Uknes et al., Plant Cell 5: 159-169 (1993); Bi et a ⁇ ., Plant J. 8:235-245 (1995)).
  • Examples of useful inducible regulatory elements include copper-inducible regulatory elements (Mett et al., Proc. Natl. Acad. Sci. USA 90:4567-4571 (1993); Furst et al , Cell 55:705-717 (1988)); tetracycline and chlor-tetracycline-inducible regulatory elements (Gatz et al. , Plant J. 2:397-404 (1992); Roder et al., Mol. Gen. Genet. 243:32-38 (1994); Gatz, Meth. Cell Biol. 50:411-424 (1995)); ecdysone inducible regulatory elements (Chnstopherson et al., Proc. Natl. Acad.
  • An inducible regulatory element useful in the transgenic plants of the invention also can be, for example, a nitrate-inducible promoter derived from the spinach nitrite reductase gene (Back et al, Plant Mol. Biol. 17:9 (1991)) or a light-inducible promoter, such as that associated with tlie small subunit of RuBP carboxylase or the LHCP gene families (Feinbaum et al., Mol. Gen. Genet. 226:449 (1991 ); Larn and Chua, Science 248:471 ( 1990)).
  • Tissue-specific promoters derived from the spinach nitrite reductase gene (Back et al, Plant Mol. Biol. 17:9 (1991)
  • a light-inducible promoter such as that associated with tlie small subunit of RuBP carboxylase or the LHCP gene families
  • the promoter may direct expression of the mutated PYK/PYL polynucleotide and/or mutated PP2C polynucleotide in a specific tissue (tissue-specific promoters).
  • tissue specific promoters are transcriptional control elements that are only active in particular cells or tissues at specific times during plant development, such as in vegetative tissues or reproductive tissues.
  • tissue-specific promoters under developmental control include promoters that initiate transcription only (or primarily only) in certain tissues, such as vegetative tissues, e.g. , roots or leaves, or reproductive tissues, such as fruit, ovules, seeds, pollen, pistols, flowers, or any embryonic tissue, or epidermis or mesophyll.
  • Reproductive tissue-specific promoters may be, e.g. , ovule-specific, embryo-specific, endosperm-specific, integument-specific, seed and seed coat-specific, pollen-specific, petal-specific, sepal- specific, or some combination thereof.
  • the promoter is cell -type specific, e.g., guard cell-specific.
  • tissue-specific promoters include seed promoters. Suitable seed-specific promoters are derived from the following genes: MAC I from maize (Sheridan (1996)
  • a variety of promoters specifically active in vegetative tissues can also be used.
  • promoters controlling patatin the major storage protein of the potato tuber
  • the ORF13 promoter from Agrobactenum rhizogenes that exhibits high activity in roots can also be used (Hansen (1 97) ⁇ /, Gen. Genet. 254:337-343.
  • vegetative tissue-specific promoters include: the tarin promoter of the gene encoding a globulin from a major taro (Colocasia esculenta L. Schott) corm protein family, tarin (Bezerra (1995) Plant Mol. Biol. 28: 137-144): the curculin promoter active during taro conn development (de Castro (1992) Plant Cell 4: 1549-1559) and the promoter for the tobacco root-specific gene TobRB7, whose expression is localized to root meristem and immature central cylinder regions (Yamamoto (1991) Plant Cell
  • Another leaf-specific promoter is the light harvesting chlorophyll a/b binding protein gene promoter, see, e.g. , Shiina (1997) Plant Physiol. 115:477-483: Casal (1998) Plant Physiol. 116: 1533-1538.
  • the AtmybS promoter is expressed in developing leaf trichomes, stipules, and epidermal cells on the margins of young rosette and cauline leaves, and in immature seeds.
  • the expression cassettes of the invention can also be used over a broad range of plants, including species from the genera Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Cucumis, Cucurhita, Daucus, Fragaria, Glycine, Gossypium,
  • the plant is selected from the group consisting of rice, maize, wheat, soybeans, cotton, canola, turfgrass, and alfalfa.
  • the plant is an ornamental plant.
  • the plant is a vegetable- or fruit-producing plant.
  • the plant is Arabidopsis.
  • expression of a desired gene, protein, or phenotype can be regulated by contacting the plant or cell with an orthogonal ligand (e.g., an agrochemical such as mandipropamid).
  • an orthogonal ligand e.g., an agrochemical such as mandipropamid
  • the transgenic plant or cell comprises a first polynucleotide encoding a first polypeptide comprising a mutated PYR/PYL receptor polypeptide fused to one of a transcriptional activation domain or a DNA binding domain, and a second polynucleotide encoding a second polypeptide comprising a mutated PP2C fused to the other of a transcriptional acti vation domain or a DNA binding domain, under the control of a promoter that comprises a polynucleotide sequence that binds the DN A binding domain.
  • contacting the plant or cell with the orthogonal gand activates an interaction between the mutated PYR/PYL and the mutated PP2C, thereby associating the DN A binding domain and the transcriptional activation domain and activating transcription of a target gene.
  • the orthogonal gand e.g., mandipropamid
  • methods of controlling gene, protein, or phenotype expression in a transgenic cell or plant as described herein comprise: contacting the transgenic cell or plant with an orthogonal ligand, wherein the step of contacting the cell or plant with the orthogonal ligand activates an interaction between tlie mutated PYR/PYL and the mutated PP2C, thereby associating the DNA binding domain and the transcriptional activation domain and activating transcription of a target gene.
  • orthogonal ligand activates an interaction between tlie mutated PYR/PYL and the mutated PP2C, thereby associating the DNA binding domain and the transcriptional activation domain and activating transcription of a target gene.
  • the mutated PYR/PYL proteins, mutated PP2C proteins, PYR/PYL-PP2C interaction modules, expression cassettes, and/or expression vectors described herein can be used for regulating the expression of a gene, protein, or phenotype relating to cell growth, development, metabolism, cell structure or architecture, stress response, or cell signaling.
  • the mutated PYR/PYL proteins, mutated PP2C proteins, PYR/PYL-PP2C interaction modules, expression cassettes, and/or expression vectors described herein can be used for regulating a phenotype relating to plant growth (e.g., growth rate or size), yield (e.g., biomass yield or seed yield), plant development (e.g., shoot development, root development, vegetative development, reproductive development, stem elongation, flowering, pattern formation, differentiation, senescence, or time of flowering), plant architecture (e.g., shape, size, color, texture, or patterning), stress tolerance (e.g., environmental stress such as salinity, drought, heat, chilling, freezing, dehydration, flooding, anaerobic stress, aerobic stress, osmotic stress, temperature stress, pollutant, or pathogen-induced stress), or metabolism.
  • the mutated relating to plant growth e.g., growth rate or size
  • yield e.g., biomass yield or
  • PYR/PYL proteins, mutated PP2C proteins, PYR/PYL-PP2C interaction modules, expression cassettes, and/or expression vectors described herein can be used for regulating the expression of a particular gene or protein of interest.
  • ABA abscisic acid
  • PYRl/HABl interaction enables ABA-regulated CIP, but is not appropriate for use in plants.
  • PYRl ' / HAB an orthogonal response module, denoted PYRl ' / HAB : , that is insulated from the endogenous ABA signaling pathway.
  • PYRl ' / HAB orthogonal response module
  • the best mutant pair identified introduces an acid/base residue pair in close proximity that likely form a salt bridge that stabilizes the mutant PYR1 ! /HAB1 ! interaction but destabilizes both PYRl vHABl and PYR1/HAB1 1 interactions.
  • mutagenic ⁇ " site directed mutagenesis primers were synthesized for each of the 20 positions and the primers used in QuickChange site-directed mutagenesis reactions using a previously described pACT-HABl template (Park et al., 2009).
  • this clone uses a HAB1 cDNA lacking its three N-terminal amino acids.
  • the reaction products were digested with Dpnl, and transformed into competent Escherichia colt DH5cx cells and plasrnid DNA for 96 colonies per site was isolated using Bioneer AccuPrep® Plasmid Mini Extraction Kit (Alameda, CA) and sequenced to identify mutants.
  • the pooled cells were plated onto SD(-Leu,-Trp,-His, + 10 mM 3-ammotriazole, + 10 ⁇ ABA) and positive, best-growing clones isolated and spotted onto both SD(-Leu,-Trp, -His) and SD( ⁇ Leu, ⁇ Trp, -His, +10 ⁇ ABA) plates, grown for 2 days growth at 30°C, and stained for ⁇ -galactosidase activity after chloroform lysis.
  • wild type PYR1 In the presence of ABA, wild type PYR1 binds to HAB1 and docks into its active site, which inhibits its enzymatic activity by blocking access of substrates.
  • PP2C assays were conducted in 96-weii polystyrene flat- bottom microtitre plates (Greiner). Assays were conducted using the following assay conditions: 100 nM 6x-His-PYRl or 6x-His-PYRl ! , 50 nM GST-HAB l or 50 nM GST- HABl/, 100 mM I ris ! K i (pH 7.9), 100 mM NaCl, 1 mM nCl 2 , 1% ⁇ -mercaptoethanol ( ⁇ - me) and 0.3% bovine serum albumin (BSA). Reactions were mixed with ABA,
  • HABl / SnRK2.6 interaction is stabilized by two modular interactions, one between HABl 's C-terminal basic domain and an SnRK2 "ABA-box" motif, and a second between HABl's active site and the SnRK2 kinase- domain (Soon et al., 2012).
  • the formation of a stable HABl/SnRK2 complex in vitro can be abolished by the double mutant HABI VJ9JR/R5(bA , which disrupts both HABl/ABA-box and HABl/kinase-domain interactions (Soon et al., 2012).
  • V393R mutation is fortuitously present in HABI ', so we introduced R505A to pACT- ⁇ using QuickChange mutagenesis, to create pACT-HABl 1'2 .
  • This mutant protein should, in principle, affect ABA responses less than ⁇ or HABI would irrplanta.
  • Plasmid DNA for the librar' was prepared from pooled E. coli transformants, and subsequently transformed into S. cerevisiae strain MAV99 harboring pACT-HABl 1"2 .
  • -20,000 yeast transformants were generated, pooled, and plated onto SD(- Leu,-Trp) agar media supplemented with 0.1% fluorotic acid (to select against mutants that interact in a ligand-independent fashion).
  • the surviving cells were collected and plated onto SD(Leu,-Trp,-Ura) plates supplemented with 50 nM mandipropamid.
  • the colonies displaying the best uracil-independent growth were isolated and retested on different mandipropam id concentrations and then stained in ⁇ -galactosidase assays to rank their relative strength.
  • the most sensitive mutant obtained contained the following 9 mutations:
  • HABl HABl 's catalytic activity by introducing a mutation in a conserved metal-ion binding residue (D204), which is homologous to D131 A mutation in ABI1 , previously shown to eliminate phosphatase activity without disrupting wild type receptor- AB11 interactions (Liang et al., 2011).
  • D204 conserved metal-ion binding residue
  • ⁇ ⁇ ' 3 is ⁇ 10-fold less sensitive to mandipropamid relative to ⁇ ' ⁇ ( Figure 5).
  • D204 is located within HAB 1 's catalytic active site and binds to one of 3 catalytic Mg "1" ions that participate in catalysis. Although D204 does not make direct contacts with PYL receptors, the receptors dock into the active site. It is likely that disruptions to active site structure introduced by D204A destabilize the PYRl * _ ANDl / ⁇ ' 3 interaction relative to HAB 1 ! ⁇ 2 .
  • GST-HAB1 assays were conducted using the following assay conditions: 100 nM 6x-His-PYRl or 6x-His- 5 5 50 nM GST-HAB1, 100 mM Tris-HCl (pH 7.9), 100 mM NaCl, 1 mM MnCl 2 , 1% ⁇ -me and 0.3% BSA.
  • Vsiii l plants isolated were grown for ⁇ 5 weeks and then treated with mandipropamid, using comparisons to wild type Columbia plants and a previously constructed 35S::PYR1 MAND1 transgenic strain as controls.
  • the treated plants were thermographed 24 hours after chemical applications to examine leaf temperature, which increases after ABA responses are activated, due to reduced transpiration.
  • the plants were first treated with 1 ⁇ mandipropamid and then 3 days later were treated again with 10 ⁇ mandipropamid.
  • the HAB 1* Tj were propagated and 4 homozygous single insertion transgenic lines identified by glufosinate segregation patterns in the T3 seedlings.
  • GFP-HAB1* protein levels were established by western blotting using an anti-GFP antibody, as described above and two lines with high protein expression le vels were selected for further experimentation.
  • Example 6 Agrochemical control of protein localization using the PY 1* " 4ND1 /HAB1 * interaction module
  • NHRs nuclear hormone receptors
  • HSPs cytoplasmic heat shock proteins
  • Inducible transcription factors can be engineered by fusing to nuclear hormone receptors, which has been used to create numerous chemically inducible plant transcription factors, for example inducible flowering time using GR fusions to the transcriptional regulator Cons tans (Corbesier et ai., 2007) .
  • Our CIP module can, in principle, be used to engineer similar types of regulation that are under control of an agrochemical and therefore suited for use in agricultural contexts.
  • HAB ! * was amplified from pACT-HAB 1 * by PGR using and cloned into pBD downstream of the GAL4 DBD.
  • a Bsal site was introduced by site directed mutagenesis between BD and HAB1, at the same time an internal Bsal site was removed.
  • An 14 amino acid long Gly-Ser rich linker flanked by Bsal sites was synthesized and cloned in between pBD and HAB 1* using GoldenGate assembly (Engler, Kandzia, & Mariiionnet, 2008).
  • the synthetic fusion was then amplified from the resultant plasmid by PCR, using primers that appended 2 nuclear export sequences onto the C-terminus of HAB1.
  • the PCR fragment obtained was cloned into pEGAD in-frame with and downstream of GFP, creating 35 S : :GFP-cyt-HAB 1 * .
  • the leaf tissue was scanned manually by epi -fluorescence to identify patches of GFP " cells and then observed by spinning disk confocal microscopy, collecting -10 micron deep sections that spanned the entire epidermal cell layer.
  • the Z-series stacks were reconstructed by brightest-point projections in image J. Eight to ten GFP + regions were imaged in this manner. Fluorescence imaging was done using a custom built spinning disk system (Solaxnere Technology, Inc) with a Yokagawa Wl spinning disk (Yokagawa), EM-CCD camera (Hamamatsu 9100c) and a Nikon Eclipse TE (Nikon) inverted stand.
  • a 40X water immersion lens (1.15 N A) was used with perfiuorcarbon immersion liquid (RIAAA-678, Cargille).
  • the microscope's stage is fully motorized and controlled by Micromanager software (www.micromanager.org) with ASI Peizo (300 mm range) and 3 axis DC servo motor controller.
  • GFP was excited with a 445 nm light a solid- state laser (Obis from 40-100 mW) and a 480/40 emission filter (Chroma). All lasers are) and emission filters are from Chroma Technology.
  • Example 7 Agrochemical control of transcription using the PYR1 * ' ⁇ 1 / ' HAB1 * interaction module
  • HAB 1 * was amplified from, p ACT-HAB 1 * by PGR and cloned into pBD downstream of the GAL4 DBD.
  • a Bsal site was introduced by site directed mutagenesis between the BD and HAB1*, at the same time an internal Bsal site in the vector backbone was removed.
  • a 14 amino acid long Gly-Ser rich linker flanked by Bsal sites was synthesized and cloned in between pBD and HAB ! * using GoldenGate assembly (Engler et aL 2008). The resultant plasmid was used as template to introduce Nes.
  • BD-Nes-linker-H*-Nes imker-H* was amplified by PGR using primers in which Nes sequence were added in both primers and per product was re-cloned to pBD in downstream of BD.
  • BD-Nes-linker-H*-Nes was amplified by PGR and introduced to pEGAD by replacing GFP.
  • the cassette was amplified and introduced pCB308K-AD to make pCB308K-AD_BD.
  • a UAS-35S minimal promoter was prepared by primer extension using synthetic oligonucleotides and cloned into pEGAD, replacing its 35S promoter so that GFP expression is controlled by the UAS.
  • the cassette created was amplified from the resultant plasmid by PGR and cloned to pCB301K-AD BD between the activation domain and binding domain modules, yielding a final construct named pUAS GFP mandi.
  • the BD-PYR1 * -MANDI fragment was create£ j as follows.
  • PYRl * "MAND! coding sequence was PCR amplified from plasmid DNA using primers that append Mfel sites and the PCR fragment digested and cloned into pBD-Ga34 (Clontech, USA) at its EcoRl site.
  • the resultant BD-PYR1* "1 ! fusion protein was amplified using PCR primers that appended an XmaJ site on 5 '-end and a Bglll site on 3 '-end; the resultant fragment was cloned into pEGAD at its Age!
  • the resultant VP64-HAB 1 * fragment was cloned to pAD-Gal4 (Clontech), adding an SV40 nuclear localization signal (NLS) to yield an NLS- VP64-HAB1* fragment with Xmal dXhoI sites on its 5'- and 3 '-ends respectively; this fragment was then cloned into pEGAD at its Agel and Xhol sites, which eliminated pEGAD's 35S-GFP unit; the resultant intermediary vector is called pVP64-HAB 1 * .
  • NLS nuclear localization signal
  • the GAL4 UAS component needed to dri ve expression of target genes was constructed as follows: a UAS-35S minimal promoter cassette was created by primer extension using synthetic oligonucleotides harboring multimerized GAL4 binding sequences and and a minimal 35S promoter (-46 from stast site) was cloned into pEGAD at its Sad and Agel sites, replacing pEGAD's 35S promoter; this resulted in an intermediary vectors called pUAS.
  • a 35S: :NLS-VP64-HAB l*-N7-Nos- terminator cassette was PGR amplified from pVP64-HABl *-N7 and cloned pBD-PYRl *-2 into its Sad site, upstream of the PEX4::BD-PYR1* cassette, yielding pAD-PEX4-BD.
  • the UAS: ::GFP-MCS-terminator cassette was amplified with primers that introduce Mfel sites on both ends, digested, and then cloned into pAD-PEX4 ⁇ BD between the 35S:NLS-VP64- H*-N7-terminator and PEX4: :BD-PYRl*-terminator components at an EcoRI site, yielding pPEX4-MANDl-GFP.
  • MAPKKK 18 (Atl G05100), a gene that is highly mduced by ABA, but otherwise has very low basal induction levels (Okamoto et al., 2013).
  • MAPKKK 18 (69 bp) and ⁇ 71 (71 bp) 5 '-UTRs were prepared by primer extension using synthetic oligonucleotides that appended Xmal and Agel sites at the ends; the resultant fragments were cloned into the Agel site of pEGAD-UAS; the two resultant UAS: :UTR-GFP cassettes were cloned into both pAD-BD and pAD-PEX4-BD to generate pMANDI-GFP and pPEX4-MANDI-GFP deri vatives with either the MAPKKK18 or ⁇ 71 5'-UTRs preceding GFP, To investigate the effects of these alterations, the parent and resultant constructs were transformed into
  • Floral dip a simplified method for Agrobacterium- mediated transformation of Arabidopsis thaiiana. Plant J. 16, 735-743. Corbesier, L., ei al. (2007). FT protein movement contributes to long-distance signaling in floral induction of Arabidopsis. Science, 3 (5827), 1030-1033.
  • AtXPOl is the export receptor for ieucine-rich nuclear export signals in Arabidopsis thaliana. The Plant Journal: For Cell and Molecular Biology, 20(6), 695-705.
  • SEQ ID NO: 16 (consensus sequence)
  • DPNALFSGGG ISFLAGVRTV KFSYGYSSLK GKRATMEDYF ETRISDVNGQ MVAFFGVFDG HGGARTAEYL KNNLFKNL V S HDDFISDTKK AIVEVFKQTD EEYLIEEAGQ PKNAGSTAAT AFLIGDKLIV ANVGDSRVVA SRNGSAVPLS DDHKPDRSDE RQRIEDAGGF IIWAGTWRVG GILAVSRAFG DKQLKPYVIA EPETQEEDIS TLEFIVVASD GLWNVLSNKD AVAIVRDISD AETAARKLVQ EGYARGSCDN ITCIWRFEV S
  • mpcipasspgipliqhqhqhhralagvg maygcaaeaayaaagvagtrcgalidgevpmevarhhehaepgsgrccsa ⁇ vqh vaapaaavwswrrfdqpqaykrfvrscall ⁇

Landscapes

  • Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Engineering & Computer Science (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Plant Pathology (AREA)
  • Cell Biology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Botany (AREA)
  • Medicinal Chemistry (AREA)
  • General Chemical & Material Sciences (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)

Abstract

Mutated PYR/PYL receptor polypeptides and mutated type 2C protein phosphatases (PP2Cs) are provided. In some embodiments, the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and comprises one or more mutations that disrupts binding to a wild-type PP2C, and the mutated PP2C comprises one or more mutations that disrupts binding to a wild-type PYR/PYL receptor polypeptide, wherein the mutated PYR/PYL receptor polypeptide and the mutated PP2C interact with each other.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional Patent Application No.
62/313,290, filed March 25, 2016, the entire content of which is incorporated by reference herein.
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH AND DEVELOPMENT
[0002] This invention was made with Government support under Grant No. 1258175, awarded by the National Science Foundation. The Government has certain rights in this invention.
BACKGROUND OF THE INVENTION
[0003] Systems for regulating biological responses with small molecules have broad biotechnologicai utility and are generally built by modifying natural regulator}' circuits, as first exemplified by engineering the Lac operon from E. co!i for inducible production of recombinant proteins in the 1970s. Numerous regulatory mechanisms can be coopted for creating inducible inducible regulator}' circuits, including allostery, subcellular localization, and chemically induced dimerization (CID). The first chemically induced heterodimerization system harnessed immunosuppressant regulated protein-protein interactions to build rapamycin-controlled three-hybrid systems (Belshaw, Ho, Crabtree, & Schreiber, 1996: Bier, Thiel, Briels, & Ottmann, 2 15; Licitra & Liu, 1996), in which transcription of a target gene is controlled by a CID module that controls the physical association of a transcriptional activation (AD) and DNA binding domain (DBD). The most common three-hybrid systems use rapamycin, or related rapalogs, to direct the formation of a complex between and the prolyl-isomerase FKBP (FK506 binding protein 12) and FRB (the FKBP-rapamycin binding domain of mammalian Target of Rapamycin Complex 1) (Rutkowska & Schuitz, 2012). Several CID systems based on different protein-protein interaction modules have been developed (Bier et al., 2015), and CID is a general process that can be exploited for man - synthetic biological processes. For example, CID can be used to regulate the enzymatic activity of enzymes split into two non-functional halves, as recently Illustrated with CAS9 (Zetsche, Volz, & Zhang, 2015). It can also be used to regulate the activity of proteins that function in specific subcellular locations. For example, the "anchor away" method uses a FRB domain fused to cytoplasmic anchors (such as abundant nbosomai or plasma membrane proteins) to relocalize target-FKBP fusion proteins away from sites of action in response to rapamycin, enabling construction of inducible ioss-of-function phenotypes (Haruki, Nishikawa, & Laemmli, 2008). Proteins can also be recruited to the proteasome or mitochondrial membrane using CID to create chemically inactivated protein functions (Janse, Crosas, Finley, & Church, 2004). The converse creation of chemically activatable protein forms can be engineered using an unstable FKBP allele that is rapidly degraded under basal conditions, but stabilized upon rapamycin treatment by interaction FRB (Banaszynski, Chen, aynard-Smith, Ooi, & Wandless, 2006). Thus, CID modules are powerful tools that can be leveraged to engineer many modes of chemically regulated activities, with many examples beyond those provided above.
[0004] The plant abscisic acid (ABA) response module has been coopted to build a chemically induced proximity (CIP) system controlled by ABA, which is a non-toxic dietary metabolite (Liang, Ho, & Crabtree, 2011 ). ABA is perceived by the soluble receptor PYR1 (Pyrabactin Resistance 1), and related PYRl-like (PYL) ABA receptors (Cutler, Rodriguez, Finkelstein, & Abrams, 2010). These proteins indirectly control the activity of a subfamily of three Sucrose non-fermenting 1 -related (SnR 2) protein kinases in response to drought and other environmental stresses. The SnRK2s autoactivate by cis- and trans-autophosphorylation on their activation loops, but are continuously inactivated by clade A type 2C protein phosphatases (PP2Cs), which results in low basal kinase activity( g et al., 2011; Soon et al., 2012). When ABA rises during stress it binds to PYR1 and PYRl-like (PYL) receptors and stabilizes their activated conformations, enabling them to bind to and inhibit the PP2Cs (Ma et al., 2009; Melcher et al., 2009: Miyazono et al., 2009: S.-Y. Park et al., 2009; Yin et al., 2009). This in turn allows accumulation of activated SnRK2 kinases, which triggers downstream signaling events. ABA's ability to stabilize a complex between ABA receptors and PP2Cs has been exploited to create a new CID module regulated by ABA, as have other plant hormones and their perception systems. However, plant hormones are not well-suited for use in plants as ligands for C1D.
BRIEF SUMMARY OF THE INVENTION [0005] The present invention provides for cells (e.g., plant, animal, mammalian, bacterial, or fungal cells) or plants (or a plant cell, seed, flower, leaf, fruit, or other plant part from such plants or processed food or food ingredient from such plants) compri sing a heterologous expression cassette, the expression cassette comprising a promoter operably linked to one or more polynucleotides encoding a first polypeptide comprising a mutated PYR/PYL receptor polypeptide and a second polypeptide comprising a mutated type 2C protein phosphatase (PP2C), wherein the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and wherein the mutated PYR PYL receptor polypeptide comprises one or more mutations that disrupts binding to a wild-type PP2C, wherein the mutated PP2C comprises one or more mutations that disrupts binding to a wild-type PYR/PYL receptor polypeptide, and wherein the mutated PYR/PYL receptor polypeptide and the mutated PP2C interact with each other.
[0006] In some embodiments, the cell or plant comprises a first heterologous expression cassette and a second heterologous expression cassette, wherein the first expression cassette comprises a first promoter operably linked to a polynucleotide encoding the first polypeptide comprising the mutated PYR/PYL receptor polypeptide, and wherein the second expression cassette comprises a second promoter operably linked to a polynucleotide encoding the second polypeptide comprising the mutated PP2C. In some embodiments, the first promoter and the second promoter are the same promoter. In some embodiments, the first promoter and the second promoter are different promoters. [0007] In some embodiments, the first polypeptide comprises the mutated PYR/PYL receptor polypeptide fused to a transcriptional activation domain and the second polypeptide comprises the mutated PP2C fused to a DNA binding domain. In some embodiments, the first polypeptide comprises the mutated PYR PYL receptor polypeptide fused to a DNA binding domain and the second polypeptide comprises the mutated PP2C fused to a transcriptional activation domain. In some embodiments, one or both of the polynucleotide that encodes the first polypeptide and the polynucleotide that encodes the second polypeptide is operably linked to a promoter that comprises a polynucleotide sequence that binds the DNA binding domain.
[0008] In some embodiments, the one or more mutations in the PYRPYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an ammo acid corresponding to position F61, 162, K63, 184, S85, G86, L87, P88, A89, HI 15, Rl 16, LI 17, P148, G150, N151, D155, T156, M158, F159, T162, or K170 in PYR1 (SEQ IDNO:l). In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from
F61D/E/Geyi/K/N/P/Q/R/S, 162D./E/G/K/R/W./Y, K63P, I84L,
S85A/C/TJ/E/F/G/H/I/K/L/M/T .P/Q/¾AW/Y,
G86ACD/E/F/fM/K/L/M^
P88C/D/F/F/G/H/
H 115 A/C/D/ vT/G,I/TK/L/M/P/Q/U''Sr/ 7AV/YT, R 116A/C D/E/F/G/H/I/P/S/T/V/W/Y,
LinA/D/E/G/H/K/N/P/Q/RSTA/'^/Y, PMSC/DE/F/G/H/L'K/L/M /Q/R/S/TA^/W/Y, G150I/NV/W, N151CD/E/F/G/HI/K7UM/P/Q/RVWY,
D 155 C/F/G,i/K/L/]Vl/P/RA';/W/Y, T 156EiF/GiR/l/K/LiMm/¥/Q/R/W/Y, M 158P,
F159DE/GH7K P/QRSAVY, T162D/E/F/P, or K170P. in some embodiments, the one or more mutations in the PYRPYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an ammo acid corresponding to position F61, S85, T156, or T162 in PYR1. in some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from F61K, S85P, T156P, and T162D.
[0009] In some embodiments, the mutated PYR/PYL receptor polypeptide further comprises a mutation at one or more amino acids corresponding to positions Y58, K59, V81, A89, F108, S122, M158, F159, or A160 in PYR1 (SEQ ID NG:1), wherein the mutation is selected from Y58H, K59R, V81C, V81T, V81T, A89W, F108A, F108C, F108E, F108G, F108L F108L, F108N, F108Q, F108S, F108T, F108V, S122G, M158I, M158V, F159A, F159C, F159I, F159L, F159M, F159T, F159V, A160C, A160V, or combinations tliereof In some embodiments, the mutated PYR/PYL receptor comprises: mutations corresponding to Y58H, K59R, V81L F108A, S122G, M158I,
F159V, A 160V, and T162D in PYR1; mutations corresponding to Y58H, K59R, V81I, F1 Q8A, S 122G, M158V, F159V, A160V, and T162D in PYR1; or
mutations corresponding to Y58H, K59R, V81L F108A, S 122G, M158I, F159V, A160C, and T162D in PYR1 , [0010] In some embodiments, the mutated PYR/PYL receptor polypeptide as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs: 1-14, 19-21, or 41-115. In some embodiments, the mutated PYR/PYL receptor polypeptide as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs: 1-14, 19-21, or 41-115 and further comprises one or more mutations as described herein (e.g., a substitution at one or more amino acid residues corresponding to F61, 162, 63, 184, S85, G86, L87, P88, A89, HI 15, RI 16, LI 17, P148, GI50, N151, D155, T156, M158, F159, T162, or K170 in SEQ ID NO: l).
[0011] In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E201, E203, H245, G246, G247, E323, K381, 1383, W385, R389, F391, G392, V393, or Y404 in HAB 1 (SEQ ID NO:22). In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E201H/K,
E203A/OD/F/G/H/I/K/L M/N/P R S/TA^ W Y,
m45A/C/D/E F/G/I K L/ /N/P/Q R/S rA^/WAr,
G246A/C/D/E/F/m/K^^
E323L, K381W, I383D/i G/H/K/N/P/Q R/S/TAV/Y5
W385A/C/D/E/F/G/H/L'K/L/M WP/Q/R/S/T/VA^
R389A/C/D/E/F/G/Hyi/K/L/M/P/Q/T/VAVAr, F391 D/E/P,
G3 A/D/i7L/:-/i j/!/ ! ./M/\ P/Q R/TA7WA-. \' 3D/i:/(j/K/N/p/Q/K/S. or
Y404D/E/G K/N P/Q R/S/T. In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E203, 1383, or V393 in HABI . In some
embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E203D, E203T, E203W, 1383G, V393K, V393R, or V393Q.
[0012] In some embodiments, the mutated PP2C further comprises one or more mutations that disrupts the catalytic acti v ity of the mutated PP2C. In some embodiments, the mutated PP2C comprises a mutation at one or more amino acids corresponding to positions R199, D204, S322, or R505 in HAB1 (SEQ ID NO: 22) wherein the mutation is selected from R199A, D204A, S322D, S322E, R505A, or combinations thereof. In some embodiments, the mutated PP2C comprises: mutations corresponding to D204A, V393R, and R505A in HAB 1 ; or mutations corresponding to R199A, D204A, S322D, V393R, and R505A in
HAB1.
[0013] In some embodiments, the mutated PP2C as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs:22-31. In some embodiments, and comprises one or more mutations as described herein (e.g., a substitution at one or more amino acid residues corresponding to E201 , E203, H2 5, G246, G247, E323, K381, 1383, W385, R389, F391, G392, V393, or Y404 in SEQ ID NO:22).
[0014] In some embodiments, (a) the mutated PYR PYL receptor polypeptide comprises a mutation corresponding to F61K in PYR1 and the mutated PP2C comprises a mutation corresponding to V393Q in HAB l;
(b) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYR1 and the mutated PP2C comprises a mutation corresponding to E203D in HAB 1:
(c) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYR1 and the mutated PP2C comprises a mutation corresponding to E203T in HABl:
(d) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYR1 and the mutated PP2C comprises a mutation corresponding to E203W m HABl; (e) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to T156P in PYRl and the mutated PP2C comprises a mutation corresponding to 1383G in HAB 1 ;
(f) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to T162D in PYRl and the mutated PP2C comprises a mutation corresponding to V393K m HAB l; or
(g) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to T162D in PYR l and the mutated PP2C comprises a mutation corresponding to V393R m HAB l .
[0015] In some embodiments, the orthogonal ligand is an agrochemical. In some embodiments, the orthogonal ligand is mandipropamid.
[0016] In another aspect, methods of activating an orthogonal PYR/PYL-PP2C interaction in a cell (e.g., plant, animal, mammalian, bacterial, or fungal cell) or plant are provided. In some embodiments, the method comprises contacting a cell or plant as described herein with the orthogonal ligand, wherein the step of contacting the plant or cell with the orthogonal ligand activates an interaction between the mutated PYR/PYL and the mutated PP2C but does not significantly activate an endogenous abscisic acid (ABA) signaling pathway in the cell or plant.
[0017] In another aspect, methods of controlling expression of a gene, protein, or phenotype in a cell (e.g., plant, animal, mammalian, bacterial, or fungal cell) or plant are provided. In some embodiments, the method comprises: expressing in a plant or a cell an expression cassette comprising a promoter operably linked to one or more polynucleotides encoding a first polypeptide comprising a mutated PY R/PYL receptor polypeptide as described herein fused to one of a transcriptional activation domain or a DNA binding domain, and a second polypeptide comprising a mutated PP2C as described herein fused to the other of a transcriptional activation domain or a DNA binding domain, wherein the promoter comprises a polynucleotide sequence that binds the DNA binding domain: and
contacting the plant or cell with the orthogonal ligand activates an interaction between the mutated PYR/PYL and the mutated PP2C, thereby associating die DNA binding domain and the transcriptional activation domain and activating expression of the gene, protein, or henotype.
[0018] In another aspect, expression cassettes (and expression vectors comprising the expression cassette) comprising a promoter operably linked to one or more polynucleotides encoding a mutated PYR/PYL receptor polypeptide and a mutated type 2C protein phosphatase (PP2C) are provided, wherein the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR'PYL receptor polypeptide and wherein the mutated PYR/PYL receptor polypeptide comprises a mutation that disrupts binding to a wild-type PP2C, wherein the mutated PP2C comprises a mutation that disrupts binding to a wild-type PYR'PYL receptor polypeptide, and wherein the mutated PYR/PYL receptor polypeptide and the mutated PP2C interact with each other.
[0019] In some embodiments, a first expression cassette and a second expression cassette are provided, wherein the first expression cassette comprises a first promoter operably linked to a polynucleotide encoding the first polypeptide comprising the mutated PYR/PYL receptor polypeptide, and wherein the second expression cassette comprises a second promoter operably linked to a polynucleotide encoding the second polypeptide comprising the mutated PP2C. In some embodiments, the first promoter and the second promoter are the same promoter, in some embodiments, the first promoter and the second promoter are different promoters. [0020] In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61 , 162, K63, 184, S85, G86, L87, P88, A89, HI 15, Rl 16, LI 17, P148, G150, N 15 L D155, T156, M158, F159, T162, or K170 in PYR1 (SEQ ID NO: l). In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from
F61D/E/G/H/I/K N/P/Q/R/S, I62D/E/G/K/R/W/Y, K63P, I84L,
S85A/ D E F/G/Ii I/K/UM/N/P/Q/R/VAV/Y5
G86A/C/D E/F/H/I/ /L M N/P/Q R/S/T/V/W/Y, L87A/C/D/E/G I1/K/ /Q/R/S/T/W/Y,
Figure imgf000009_0001
H115A/C/D/E/F/G/I/K L/^
L i i 7A ;|.)/ :VG.;I l/ ;\/P;Q/K/S/'i'/\7\\'A'. I 8(7i) K/F/(i l l/!/ l . \l/N/Q/R S/ i7\'A\'/V. G150I/N/V/W, N151C/D/E/F/^^ D 155 C/F/G/I/K/L/M/P/R/V/W/Y, T 156E F/G/H/I/K/L/M/N/P/Q/R/W/Y, M 158P,
F159D E/G/H K/N/P/Q/R/SAV/Y, T162D E/F/P, or K170P. In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F6 I , S85, TI 56, or T162 in PYR1. In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from 1-6 s K . S85P, T156P, and T162D,
[0021] In some embodiments, the mutated PYR/PYL receptor polypeptide further comprises a mutation at one or more amino acids corresponding to positions Y58, K59, V81, A89, F 108, S 122, M158, F159, or A 160 in PYRi (SEQ ID NO: l ), wherein the mutation is selected from Y58H, K59R, V81C, V81L V81T, A89W, F108A, F108C, F108E, F108G, F108I, F108L, F 1G8N, F 108Q, F 108S, F 108T, F 108V, S 122G, M158I, M158V, F159A, F159C, F159I, F 159L, F159M, F 159T, F 159V, A 160C, A160V, or combinations thereof. In some embodiments, the mutated PYR/PYL receptor comprises: mutations corresponding to Y58H, K59R, V81L F 108A, S 122G, M158I,
F159V, A 160V, and T162D in PYRI ;
mutations corresponding to Y58H, K59R, V81I, F 108A, S 122G, M158V, F159V, A 160V, and T162D in PYRI; or
mutations corresponding to Y58H, K59R, V81I, F 108A, S 122G, M158I, F 159V, A 160C, and T 162D in PYR 1 .
[0022] In some embodiments, the mutated PYR/PYL receptor polypeptide as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs: 1 -14 or 19-21. [0023] In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E201 , E203, H245, G246, G247, E323, K381, 1383, W385, R389, F391 , G392, V393, or Y404 in HAB 1 (SEQ ID NO:22). In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E201H/K,
E203A/ D F/G Ii/I/K/UM N/P R/S/TA^ W Y,
H245A/C/D/E/F/G/1/K/L/MWP/Q/R/S/T/VAV/Y, G246A/C D E/F/H I/K/U]V^
E323L, K381W, I383D/E/G/H K/N P/Q/R/S TAV/Y,
W385 A/CfD/E/F/G/EJliKJlJM/N/V/Q/R/SrY/Y/Y,
R389Α/€0/Ε/Ρ/Ό/ί /Κ.1./Μ Ρ/ρ/Τ/ ΑνΑ , F391 D/E/P,
G392A/D/C/E/F/¾/I/I yL/M/N/P/Q/R/T/V W
Y404D/E/G/K/N/P/Q/R/S/T. In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E203, 1383, or V393 in HAB1. In some
embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E203D, E203T, E203W, I383G, V393K, V393R, or V393Q.
[0024] In some embodiments, the mutated PP2C further comprises one or more mutations that disrupts the catalytic activity of the mutated PP2C, In some embodiments, the mutated PP2C comprises a mutation at one or more amino acids corresponding to positions R199, D204, S322, or R505 in HAB 1 (SEQ ID NO: 22) wherein the mutation is selected from
R199A, D204A, S322D, S322E, R505A, or combinations thereof. In some embodiments, the mutated PP2C comprises: mutations corresponding to D204A, V393R, and R5G5A in HAB 1: or mutations corresponding to R199A, D204A, S322D, V393R, and R505A in HAB1.
[0025] In some embodiments, the mutated PP2C as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs:22-31. [0026] In yet another aspect, the present invention provides for isolated nucleic acids comprising a polynucleotide encoding a polypeptide comprising a mutated PYR/P YL receptor polypeptide as described herein fused to a transcriptional activation domain or a DNA binding domain, wherein the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal iigand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and wherein the mutated PYR/PYL receptor polypeptide comprises a mutation that disrupts binding to a wild-type PP2C. [0027] In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61, 162, K63, 184, S85, G86, 1.87. P88, A89, HI 15, Rl 16, LI 17, P148, G150, NISI, D155, T156, M158, F159, T162, or K170 in PYR1 (SEQ IDNO:l). In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from
F61D/E/G/H7i/K/N,P/Q/R/S, I62D/E/G/K/R/W/Y, K63P, I84L,
S85A/C/D/E/F/G/I /K/L/MN/P/Q/R/VAVA;",
G86A/C/D/E/F/H/I/ /L/M/N/IVQ/R'¾/T/V/W/Y,L8
Figure imgf000012_0001
HI 1 SA/OO /F/G/l/K/LM/P/Qm/SfT/V/Wri, Rl 16A/CD/EF/GH/IP/STA^AV/Y, L117A/D/E/GH/K/ P/QRSTA/W/Y, P148C/D/E/F/GH/I/I^/M/N/QR/S/T/VA\ Y, G150I/N/V/W,N151C/D/E/F/G/H/I /IJ ^
D 155 C,F/G/I, /L/M/IYR/VAVA'" T 156E/F/G /17K/L /N/P/Q/RAVA:' , M158P,
F 159DE/GHK /P/QR/SWY, Tl 62D/E/F/P, or K170P, In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61, S85, T156, or T162 in PYR1, In some embodiments, the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from F61K, S85P, T156P, and T162D.
[0028] In some embodiments, the mutated PYR/PYL receptor polypeptide further comprises a mutation at one or more amino acids corresponding to positions Y58, K59, V81, A89, F108, S122, M158, F159, or Λ 1 0 in PYR1 (SEQ ID NO:!), wherein the mutation is selected from Y58H, K59R, V81C, V81I, V81T, A89W, F108A, F108C, F108E, F108G, F108I, F108L, F108N, F108Q, F108S, F108T, F108V, S122G, M158I, M158V, F159A,
F159C, F159I, F159L, F159M, F159T, F159V, A160C, A160V, or combinations thereof In some embodiments, the mutated PYR/PYL receptor comprises: mutations corresponding to Y58H, K59R, V81I, F108A, S122G, Ml 581, F159V, A160V, and T162D in PYR!;
mutations corresponding to Y58H, K59R, V81I, F108A, S122G, M158V,
F159V, A160V, and T162D in PYR1; or
mutations corresponding to Y58H, K59R, V81I, F108A, S122G, M1581, F159V, A160C, and T162D in PYR1. [0029] In some embodiments, the mutated PYR/PYL receptor polypeptide as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs: 1 - 14, 19-21 , or 41 - 1 i 5. [0030] In some embodiments, the polypeptide comprises a mutated PYR/PYL receptor polypeptide as described herein fused to a transcriptional activation domain . In some embodiments, the polypeptide is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%>, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 32, [0031] In still another aspect, the present invention provides for isolated nucleic acids comprising a polynucleotide encoding a polypeptide comprising a mutated PP2C as described herein fused to a transcriptional activation domain (e.g., SEQ ID NO: 35) or a DNA binding domain (e.g., SEQ ID NO:36), wherein the mutated PP2C comprises a mutation that disrupts binding to a wild-type PYR/PYL receptor polypeptide. [0032] In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E201, E203, H245, G246, G247, E323, K381, 1383, W385, R389, F391, G392, V393, or Y404 in HAB1 (SEQ ID NO:22). In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide compri ses a mutation selected from E201H/K,
E203A/C D/F/G/H/I/ /L M/N/P
H245A/C/D E7F/G I/K/L M/N/P/Q/R/S T VAV Y,
G246A/C/D/E/F/H/I/K/L/^
E323L, K381W, L 83D/E/G H, /N/P/Q/R/S rAV.Y,
W385A/ , D/E/F/O I/l /IVM/N/P/Q/R/S/T/'VA ,
R389A/C/D/E/F/G/Iia K/L/M P/Q/T VAV Y, F391D/E/P,
G392A/D/C/E/F./H/LK/L/MWP/Q/R/TA7W/Y, V393D/E/G/ /N/P/Q/R/S, or
Y404D E/G/K/ P/Q/R/S/T. In some embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E203, 1383, or V393 in HABI . In some
embodiments, the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E203D, E2Q3T, E203W, 1383G, V393K, V393R, or V393Q.
[0033] In some embodiments, the mutated PP2C further comprises one or more mutations that disrupts the catalytic acti v ity of the mutated PP2C. In some embodiments, the mutated PP2C comprises a mutation at one or more amino acids corresponding to positions R199, D204, S322, or R505 in HAB1 (SEQ ID NO: 22) wherein the mutation is selected from R199A, D204A, S322D, S322E, R505A, or combinations thereof. In some embodiments, the mutated PP2C comprises: mutations corresponding to D204A, V393R, and R505A in HAB 1 ; or mutations corresponding to R199A, D204A, S322D, V393R, and R505A in
HAB1.
[0034] In some embodiments, the mutated PP2C as described herein is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to any of SEQ ID NOs:22-31.
[0035] In some embodiments, the polypeptide comprises a mutated PP2C as described herein fused to a DNA binding domain. In some embodiments, the polypeptide is substantially identical (at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO:33 or 34,
BRIEF DI .SC Ri P nON OF TOE DRAWINGS
[0036] FIG. 1. PYR1T!62D and HAB1V 93R enable an orthogonal ABA response module. The experiment examines the ABA-promoted interaction of wild type and mutant proteins as measured using a yeast two hybrid assay in which the PYR1 component is expressed as a fusion protein to the GAL4 DNA binding domain and HAB1 component is fused to the GAL4 activation domain, as described in Example 1. PYRE D '! and HAB l " " ' (renamed PYRF / HAB1 !) selectively interact with one another, but not wild type counterparts,
[0037] FIG. 2. PYR11 does not inhibit HABl1 enzymatic activity. The experiment examines the ABA-promoted inhibition of wild type and mutant HABl proteins by either wild type or mutant PYRl, as measured using in vitro PP2C assays, as described in Example 1. The data show that PYRl : is unable to inhibit the activity of either HAB 1 or HAB 1 : .
[0038] FIG. 3. PYRl kMAND1 selectively interacts with or HAB 1 ' and HAB 1 w. Trie experiment examines the mandipropamid-promoted interaction of PYRl'"MANDI with HAB1, HAB 1 ! and HAB 1 '"2, as measured using a yeast two hybrid assay in which the PYRl component is expressed as a fusion protein to the GAL4 DNA binding domain and HABl component is fused to the GAL4 activation domain, as described in Example 2. The data show that PYRl !_MANDI interacts selectively with or HAB 1 ' and HAB 1 !"2 in response to mandipropamid .
[0039] FIG. 4. PYRl *"MANDI selectively interacts with HAB 1 '"2. The experiment examines the mandipropamid-promoted interaction of either PYR1MAND! or PYRI *-mandi with HABl or HAB 1 '" , as measured using yeast two hybrid assays in which the PYRl component is expressed as a fusion protein to the GAL4 DNA binding domain and the HAB 1 component is fused to the GAL4 activation domain, as described in Example 2. The data sho that PYRl " MANO' interacts selectively with HABl'"2 in response to nM levels of mandipropamid.
[0040] FIG. 5. The catalyticaliy inactive mutant HAB1'"J shows reduced sensitivity in its interaction with P YRl "l relative to 1 1ΛΒ I The experiment examines the
mandipropamid-promoted interaction of PYR 1 ' _1VlANDl with either HAB 1 !"2 or a catalyticaliy inactive mutant HAB1W, as measured using yeast two hybrid assays in which the PYRl component is expressed as a fusion protein to the GAL4 DNA binding domain and the HAB 1 component is fused to the GAL4 activation domain, as described in Example 3. The data show that pYRi' _! lAi Dl interacts selectively with HABl'"i in response to nM levels of mandipropamid.
[0041] FIG. 6. The catalyticaliy inactive mutant HABl* shows a high sensitivity interaction with PYR1*" 'AND\ The experiment examines the mandipropamid-promoted interaction of PYR J "MA Di with either HABl'"2 or a catalyticaliy inactive mutant HABl '"3, as measured using yeast two hybrid assays in which the PYRl component is expressed as a fusion protein to the GAL4 DNA binding domain and the HAB 1 component is fused to the GAL4 activation domain, as described in Example 3. The data show that PYRl "ΜλΝΙ)! interacts selectively with HAB 1 '"2 in response to nM levels of mandipropamid. [0042] FIG. 7. HAB 1 * is catalyticaily inactive. The experiment examines the phosphatase activity of wild type and mutant HAB 1 proteins, as measured using in vitro PP2C assays, as described in Example 3. The data confirm that HAB 1* is catalytically inactive.
[0043] FIG. 8. HAB 1 * does not bind to wild type PYR1 in the presence of ABA or rnandipropamid. The experiment examines the physical interactions of mutant and wild type protein in response to either 10 μΜ rnandipropamid or 10 μΜ ABA using pull down assays, as described in Example 4. The data indicate that HAB 1* does not bind to wild type PYR1 in response to either iigand, however pYRi*"MA Di is aDie to bind to wild type HAB l in response to rnandipropamid.
[0044] FIG. 9. PYRJ*-mandi does not inhibit HABl enzymatic activity in response to either ABA or rnandipropamid. The experiment examines the rnandipropamid- or ABA- promoted inhibition of HAB l , as measured using in vitro PP2C assays, as described in the Example 4. The data show that PYR1 ""i Ii ND! is unable to inhibit the activity of either HAB l, in spite of its ability to physically interact with HAB 1. The control data shown for PYRi inhibition of HAB l is the same as shown in Figure 2, as the experiments were conducted at the same time.
[0045] FIG. 10. Activation of PY i""^1""0' in planta does not elicit an ABA response. The experiment examines the thermal response on 35S: :GFP-PYR 1 ' " iANDl Ti transgenic plants to 1 or 10 μΜ rnandipropamid treatment, as described in Example 5. Wild type Columbia and 35S: :PYR1MANDI are included as negative and positive controls respectively. The data show that expression of PYRI ' _1VlANDl jn planta is not associated with altered ABA responses.
[0046] FIG. 11. Activation of PYR _MAj Dl in planta does not elicit an ABA response or inhibit ABA-induced leaf temperature increase. (Upper panel) The experiment examines the thermal response of two independent homozygous 35S: :GFP-PYRl*"lVlANDl transgenic strains #2 and #3 to eitlier 5 μΜ rnandipropamid or 25 μΜ ABA treatment, as described in Example 5. Wild type Columbia is included as a control. The data, show that expression of PYRI " MANDi jn pjanta js not associated with altered ABA responses. (Lower panel) The data show western analyses of protein levels in three transgenic lines, lines #2 and #3 were selected for experimentation . [0047] FIG. 12. Expression of HABl * in planta does not inhibit ABA responses. (Upper panel) The experiment examines the leaf temperature of two independent homozy gous 35S::GFP-HAB l' transgenic strains #2 and #3 in comparison to either wild type Columbia of die ABA insensitive mutant abil-1, as described in Example 5. The data show that expression HAB1* in planta does not strongly interfere with endogenous ABA responses. (Lower panel) The data show Western analyses of fusion protein levels in 4 transgenic lines, lines #2 and #3 were selected for experimentation. [0048] FIG. 13. Mandipropamid-mediated control of protein nuclear localization using the PYR1 *"^ND1 / HAB1 * interaction module. 35S: :GFP-cyt-HAB l* and 35S::nuc-PYRl *" MA Di were transiently co-expressed in N. benthamiana and plants treated with a mock solution or 50 μΜ mandipropamid. 35S: :GFP-cyt-HABl* displays the expected cytoplasmic localization in the absence of mandipropamid treatment, however it shows a predominantly nuclear localization pattern after exposure to mandipropamid. Thus, the HAB 1* /' PYR1 *" MAND! module can be used to chemically regulate protein localization.
[0049] FIG. 14. Mandipropamid-mediated control of transcription using the pYR i* 'MA iD! / HAB1* interaction module. pUAS GFP mandi was transiently expressed in N benthamiana and plants treated with a mock solution or 50 μΜ mandipropamid and proteins detected by Western blot analyses using an anti-GFP antibody, as described in Example 6. Thus, the FIAB1* / PYR1*_MANDI module can be used to chemically regulate transcription in planta. The leftmost lane is a control non-infiltrated leaf sample.
FIG. 15. (A) T-DNA region (-8.5 kb) of pMANDI-GFP vector that was used to construct a UAS: : GFP -LEAFY that is mandipropamid inducible. (B) Tl Arabidopsis leaf tissue of the same transgenic plant treated with either control or 10 μΜ mandipropamid for 24 hours and subsequently imaged by fluorescence microscopy. (C) The pMANDI-GFP base vector was modified by altering expression of its BD-PYR1*_MA DI component with the PEX4 promoter (pPEX4-MAND!-GFP) with or without added MAPKKK18 (M3K) or ΊΌ71 UTRs appended to GFP. These constructs were transiently expressed in N benthamiana and their responses to mandipropamid profiled 24 hours after application of 50 μΜ
manidpropamid or control solution, as measured using western blotting with an anti-GFP antibody. Lanes marked are controls that contain protein samples from infiltrated leaf samples. Thus, the HAB1 * / PYR1 *"MAilD1 module can be used to chemically regulate transcription in planta. DEFINITIONS
[0051] The term "PYR/PYL receptor polypeptide" refers to a protein characterized in part by the presence of one or more or all of a polyketide cyclase domain 2 (PF 10604), a polyketide cyclase domain 1 (PF03364), and a Bet V I domain (PF03364), which in wild-type form, mediates abscisic acid (ABA) and ABA analog signaling, A wide variety of PYR/PYL receptor polypeptide sequences are known in the art, PYR/PYL receptor proteins, their structural elements, and their mechanism of activity are described, for example, in Klinger et al., 2010, Journal of Experimental Botany, 61 :3199-3210, and in Santiago et al., 2012, Plant Sci, 182:3-1 1, incorporated by reference herein. In some embodiments, a PYR/PYL receptor polypeptide comprises a polypeptide sequence that is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) PYR1 (SEQ ID NO: 1), PYL1 (SEQ ID NO:2), PYL2 (SEQ ID NO:3), PYL3 (SEQ ID NO:4), PYL4 (SEQ ID NO: ). PYL5 (SEQ ID NO:6), PYL6 (SEQ ID NO:7), PYL7 (SEQ ID NO: 8). PYL8 (SEQ ID NO:9), PYL9 (SEQ ID NO: 10), PYL10 (SEQ ID NO: 1 1), PYL1 1 (SEQ ID NO: 12), PYL12 (SEQ ID NO: 13), or PYL13 (SEQ ID NO: 14), or to any of SEQ ID NOs : 41 - 115.
[0052] A "wild-type PYR/PYL receptor polypeptide" refers to a naturally occurring PYR/PYL receptor polypeptide that binds to ABA and mediates ABA signaling via interactions with a PP2C.
[0053] A "mutated PYR PYL receptor polypeptide " or "modi fied PYR PYL receptor polypeptide" refers to a PYR/PYL receptor polypeptide that is a variant from a naturally- occurring (i.e., wild-type) PYR/PYL receptor polypeptide. As used herein, a mutated or modified PYR/PYL receptor polypeptide comprises one or more amino acid substitutions relative to a corresponding wild-type PYR/PYL receptor polypeptide. In this context, a "mutated" polypeptide or "modified" polypeptide can be generated by any method for generating non-wild type nucleotide sequences,
[0054] The term "type 2C protein phosphatase" or "PP2C" refers to a protein characterized in part by the presence of a serine/threonine phosphatase catalytic site and one or more metal binding sites for binding magnesium or manganese ions, A wide variety of PP2C protein sequences are known in the art. PP2C proteins and their structure and function are described, for example, in Singh et al., 2015, Critical Reviews in Biotechnology, DOI: 10.3109/07388551.2015.1083941, incorporated by reference herein. In some embodiments, a PP2C is a Clade A PP2C. In some embodiments, a PP2C protein comprises a sequence that is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) HAB 1 (SEQ ID NC):22), ABI1 (SEQ ID NO:23), ABI2 (SEQ ID NO:24), HAB2 (SEQ ID SO: 25 ). HAI 1 (SEQ ID NO:26), HAI2 (SEQ ID NO:27), HAI3 (SEQ ID NO:28), or Atlg43900 (SEQ ID NO: 2 )
[0055] A "wild-type PP2C" refers to a naturally -occurring PP2C protein that negatively regulates ABA signaling. [0056] A "mutated PP2C" or "modified PP2C" refers to a PP2C protein that is a variant from, a naturally-occurring (i.e., wild-type) PP2C. As used herein, a mutated or modified PP2C protein comprises one or more amino acid substitutions relative to a corresponding wild-type PP2C protein. In this context, a "mutated" polypeptide or "modified" polypeptide can be generated by any method for generating non-wild type nucleotide sequences. [0057] An amino acid "corresponding to position [X] of [specific sequence]" refers to an amino acid in a polypeptide of interest that aligns with the equivalent amino acid of a specified sequence. Generally, as described herein, the amino acid corresponding to a position of a PYR/PYL receptor polypeptide or PP2C can be determined using an alignment algorithm such as BLAST. With respect to PYR/PYL receptor polypeptide sequences, in typical embodiments of the present invention, "correspondence" of amino acid positions is determined by aligning to a region of the PYR/PYL receptor polypeptide comprising SEQ ID NO: 1 (PYRl), as discussed further herein. When a PYR/PYL receptor polypeptide sequence differs from SEQ ID NO: 1 (e.g. , by changes in amino acids or addition or deletion of ammo acids), it may be that a particular mutation (e.g., a mutation that disrupts binding to a wild- type PP2C) will not be in the same position number as it is in SEQ ID NO: 1. For example, amino acid position T192 of PYL1 (SEQ ID NO:2) aligns with amino acid position T162 in SEQ ID NO: 1, as can be readily illustrated in an alignment of the two sequences. In this example, a mutation at amino acid position 192 in SEQ ID NO:2 corresponds to position 162 in SEQ ID NO: l . [0058] Similarly, with respect to PP2C protein sequences, in typical embodiments of the present invention, "correspondence" of amino acid positions is determined by aligning to a region of the PP2C protein comprising SEQ ID NO:22 (HAB 1), as discussed further herein. When a PP2C protein differs from SEQ ID NO:22 (e.g., by changes in amino acids or addition or deletion of amino acids), it may be that a particular mutation (e.g., a mutation that disrupts binding to a wild-type PYR/PYL receptor protein) will not be in the same position number as it is in SEQ ID NO:22. For example, amino acid position V308 of ABI1 (SEQ ID NO:23) aligns with amino acid position V393 in SEQ ID NO: 22, as can be readily illustrated in an alignment of the two sequences. In this example, a mutation at amino acid position 308 in SEQ ID NO:23 corresponds to position 393 in SEQ ID NO:22.
[0059] Two nucleic acid sequences or polypeptides are said to be "identical" if the sequence of nucleotides or amino acid residues, respectively, in the two sequences is the same when aligned for maximum correspondence as described below. The terms "identical" or percent "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence over a comparison window, as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. When percentage of sequence identity is used in reference to proteins or peptides, it is recognized that residue positions that are not identical often differ by conservative amino acid substitutions, where amino acids residues are substituted for other amino acid residues with similar chemical properties (e.g. , charge or hydrophobicity) and therefore do not change the functional properties of the molecule. Where sequences differ in conservative substitutions, tlie percent sequence identity may be adjusted upwards to correct for the conservati e nature of the substitution. Means for making this adjustment are well known to those of skill in the art. Typically this involves scoring a conservative substitution as a partial rather than a full mismatch, thereby increasing the percentage sequence identity. Thus, for example, where an identical amino acid is given a score of 1 and a non-conservative substitution is given a score of zero, a conservative substitution is given a score between zero and 1. The scoring of conservative substitutions is calculated according to, e.g., the algorithm of Meyers & Miller, Computer Applic. Biol. Sci. 4: 11 -17 (1988) e.g. , as implemented in the program PC/GENE (Intelligenetics, Mountain View, California, USA). [0060] Tl e phrase "substantially identical," used in the context of two nucleic acids or polypeptides, refers to a sequence that has at least 60% sequence identity with a reference sequence. Alternatively, percent identity can be any integer from 60% to 100%. Some embodiments include at least: 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%, compared to a reference sequence using the programs described herein; preferably BLAST using standard parameters, as described below.
[0061] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters. [0062] A "comparison window," as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 ( 1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection.
[0063] Algorithms that are suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschui et al. (1990) J. Mol. Biol. 215 : 403-410 and Altschui et al. (1977) Nucleic Acids Res. 25: 3389- 3402, respectively. Software for performing BLAST analyses is publicly available through die National Center for Biotechnology Information (NCBI) web site.
[0064] "Conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at e ver - position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence. [0065] As to amino acid sequences, one of skill will recognize that individual substitutions, in a nucleic acid, peptide, polypeptide, or protein sequence which alters a single ammo acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an ammo acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art.
[0066] The following six groups each contain amino acids that are conservative substitutions for one another:
1) Alanine (A), Serine (S), Threonine (T);
2) Aspartic acid (D), Glutamic acid (E);
3} Asparagine (N), Glutamine (Q);
4} Arginine (R), Lysine (K):
5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V): and
6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
(see, e.g., Creighton, Proteins (1984)). [0067] It is contemplated that a substitution mutation in a mutated PYR/PYL receptor polypeptide and/or a mutated PP2C includes not only those specific ammo acid substitutions called out in the specification, e.g. in the Examples section or in any of the Figures or Tables of the specification, but also includes amino acids that are consen'atsve substitutions for those specific amino acids, so long as the conservatively- substituted amino acid is not the wild-type amino acid. As a non-limiting example, where a mutated PYR/PYL receptor polypeptide or PP2C comprises a serine-to-threonine substitution, it is contemplated that the mutated PYR/PYL receptor polypeptide or PP2C may alternatively comprise a serine-to-alanine substitution, as threonine and alanine are conservative substitutions for one another; but the mutated PYR PYL receptor polypeptide or PP2C would not comprise a serine-to-serine substitution, as serine is the amino acid that is present in the wild-type PYR PYL polypeptide or PP2C.
[0068] As used herein, the term "agonist" or "agonists" refers to a molecule identified using in vitro and in vivo assays for activity of a described target protein as described elsewhere herein. Agonists are agents that, e.g., induce or activate the expression of a described target protein or bind to, stimulate, increase, open, activate, facilitate, enhance activation, sensitize or up-regulate the activity of described target protein (or encoding polynucleotide). Agonists include naturally occurring and synthetic molecules. In some embodiments, the agonists are agrichemicals, e.g., fungicides, herbicides, pesticides, and/or fertilizers. Assays for determining whether an agonist "agonizes" or "does not agonize" a target protein include, e.g., contacting putative agonists to purified target protein(s) and then determining the functional effects on the described target protein activity, as described above, or contacting putative agonists to cells expressing the target protein(s) and then determining the functional effects on the described target protein activity, as described above. One of skill in the art will be able to determine whether an assay is suitable for determining whether an agonist agonizes or does not agonize a target protein. Samples or assays comprising described target protein that are treated with a putative agonist are compared to control samples without the agonist to examine the extent of effect. Control samples (untreated with agonists) are assigned a relative activity value of 100%. Agonism of the described target protein is achieved when the activity value relative to the control is 1 10%, optionally 150%, optionally 200%, 300%, 400%, 500%, or 1000-3000% or more higher.
[0069] As used herein, the term "orthogonal receptor" refers to a receptor that has been modified to selectively recognize new ligands ("orthogonal ligands"). As used herein, the term "orthogonal ligand" refers to an agent that agonizes a mutated or modified PYR/PYL receptor polypeptide but which does not agonize a wild-type PYR/PYL receptor polypeptide. In some embodiments, the orthogonal ligands are agrichemicals, e.g., fungicides, herbicides, pesticides, nematicides, plant activators, synergists, herbicide safeners, plant growth regulators, insect repellants, and/or fertilizers. In some embodiments, the orthogonal ligand is mandipropamid . [0070] The term "plant" includes whole plants, shoot vegetative organs and/or structures (e.g. , leaves, stems and tubers), roots, flowers and floral organs (e.g. , bracts, sepals, petals, stamens, carpels, anthers), ovules (including egg and central cells), seed (including zygote, embryo, endosperm, and seed coat), fruit (e.g. , the mature ovary), seedlings, plant tissue (e.g., vascular tissue, ground tissue, and the like), cells (e.g. , guard ceils, egg cells, trichomes and the like), and progeny of same. The class of plants that can be used in the method of the invention is generally as broad as the class of higher and lower plants amenable to transformation techniques, including angiosperms (monocotyledonous and dicotyledonous plants), gymnosperms, ferns, and multicellular algae. It includes plants of a variety of ploidy levels, including aneuploid, polyploid, diploid, haploid, and hemizygous,
[0071] The term "promoter," as used herein, refers to a polynucleotide sequence capable of driving transcription of a coding sequence in a cell. Thus, promoters used in the
polynucleotide constructs of the invention include cis-acting transcriptional control elements and regulatory sequences that are involved in regulating or modulating the timing and/or rate of transcription of a gene. For example, a promoter can be a cis-acting transcriptional control element including an enhancer, a promoter, a tra scription terminator, an origin of replication, a chromosomal integration sequence, 5' and 3' untranslated regions, or an intronic sequence, which are involved in transcriptional regulation. These cis-acting sequences typically interact with proteins or other biomolecules to carry out (turn on/off, regulate, modulate, etc.) gene transcription. A "plant promoter" is a promoter capable of initiating transcription in plant cells. A "constitutive promoter" is one that is capable of initiating transcription in nearly all tissue types, whereas a "tissue-specific promoter" initiates transcription only in one or a few particular tissue types.
[0072] A polynucleotide sequence is "heterologous" to an organism or a second polynucleotide sequence if it originates from a foreign species, or, if from the same species, is modified from its original form. For example, when a promoter is said to be operably linked to a heterologous coding sequence, it means that the coding sequence is derived from one species whereas the promoter sequence is derived another, different species; or, if both are derived from the same species, the coding sequence is not naturally associated with the promoter (e.g. , is a genetically engineered coding sequence, e.g., from a different gene in the same species, or an allele from a different ecotype or variety).
[0073] An "expression cassette" refers to a nucleic acid construct that, when introduced into a host cell, results in transcription and/or translation of an K A or polypeptide, respectively. Antisense or sense constructs that are not or cannot be translated are expressly included by this definition. In the case of both expression of transgenes and suppression of endogenous genes (e.g., by an ti sense, or sense suppression) one of skill will recognize that the inserted polynucleotide sequence need not be identical, but may be only substantially identical to a sequence of the gene from which it was derived. As explained herein, these substantially identical variants are specifically covered by reference to a specific nucleic add sequence.
DETAILED DESCRIPTION OF TOE INVENTION
I. Introduction
[0074] In the abscisic acid (ABA) signaling pathway, PYR/PYL polypeptides are receptors for ABA, while PP2Cs are negative regulators of ABA signaling. In the presence of ABA, the PYR/PYL receptor polypeptide forms a ternary complex with ABA and a PP2C, resulting in the inhibition of the PP2C. It has now been found that components of the ABA signaling pathway can be coopted to generate chemically induced interaction modules that can be expressed in vivo in plants for regulating the expression of a desired gene, protein, or phenotype. As described herein, PYR/PYL receptor polypeptides and PP2Cs can be mutated to disrupt their interactions with endogenous ABA signaling components and enable binding to an orthogonal ligand (such as an agrochemical) that does not activate the endogenous ABA signaling pathway. By linking the mutated PYR/PYL and PP2C proteins described herein to activation domains and DNA binding domains, transcription can be controlled by the presence or absence of the orthogonal ligand.
[0075] Thus, in one aspect, the mutated PYR/PYL receptor proteins and mutated PP2Cs described herein can be used to control gene expression in a plant through the use of an orthogonal ligand such as an agrochemical. In another aspect, the mutated PYR PYL receptor proteins and mutated PP2Cs described herein can be used to control gene expression in a cell (e.g., a plant, animal, mammalian, or fungal cell) through the use of an orthogonal ligand such as an agrochemical.
II. Mutated PYR/PYL Receptor Polypeptides
[0076] In one aspect, mutated PYR'PYL receptor polypeptides that (1) are agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and that (2) comprise one or more mutations that disrupts binding to a wild-type PP2C are provided. Also provided herein are polynucleotides encoding polypeptides comprising the mutated PYR/PYL receptor polypeptides; expression cassettes and expression vectors comprising said polynucleotides; cells (e.g., plant, animal, mammalian, or fungal cells), plants, and plant parts comprising the mutated PYR/PYL receptor polypeptides;
methods of making cells or plants comprising the mutated PYR/PYL receptor polypeptides; methods of making the mutated PYR/PYL receptor polypeptides; methods of activating an orthogonal PYR/PYL- PP2C interaction in cells or plants comprising the mutated PYR/PYL receptor polypeptides and mutated PP2Cs as described below; and methods of controlling gene expression in cells or plants comprising the mutated PYR/PY L receptor polypeptides and mutated PP2Cs as described herein.
[0077] A wide variety of wild-type (naturally occurring) PYR/PYL polypeptide sequences are known in the art. Although PYR1 was originally identified as an abscisic acid (ABA) receptor in Arabidopsis , in fact PYR1 is a member of a group of at least 14 proteins
(PYR/PYL proteins) in the same protein family in Arabidopsis that also mediate AB A signaling. This protein family is also present in other plants (see, e.g., US 2011/0271408) and is characterized in part by the presence of one or more or all of a poiyketide cyclase domain 2 (PF10604), a poiyketide cyclase domain 1 (PF03364), and a Bet V 1 domain (PF00407). START / Bet v 1 superfamily domains are described in, for example, Radauer, BMC Evol. Biol. 8:286 (2008). In some embodiments, a wild-type PYR/PYL receptor polypeptide comprises any of SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 41-115. In some embodiments, a wild-type PYR/PYL receptor polypeptide is substantially identical to (e.g., at least 70%, 75%, 80%, 85%, 90%, 91 %, 92%, 93%, 94% 95%, 96%, 97%, 98%, or 99% identical to) any of SEQ ID NOs: 1 -14 or 41 -1 15.
[0078] PYR/PYL receptor proteins can be described by reference to sequence alignments that identify conserved amino acid or motifs (i.e., where alteration in sequences may alter protein function) and regions where variation occurs in alignment of sequences (i.e. , where variation of sequence is not likely to significantly affect protein activity). SEQ ID NOs: ISIS and 116-122 provide consensus sequences useful for identifying wild-type PYR/PYL receptor polypeptides. The consensus sequences of SEQ ID NOs: 15-17 were generated by aligning all 14 members of the Arabidopsis PYR/PYL receptor protein family. In the consensus sequences of SEQ ID NOs: 15-17, the capitalized letter represents an amino acid residue that is absolutely conserved among all 14 members of the Arabidopsis PYR/PYL receptor protein family, while "x" represents an amino acid residue that is not absolutely conserved among ail 14 family members and which can be any amino acid. It will be appreciated that when selecting an ammo acid to insert at a position marked by an "x" that in some embodiments, the amino acid is selected from those amino acids found at the corresponding position in a wild-type or mutated PYR/PYL protein.
PYR1 to PYL13
CxSxxxxxxxAPxxxxWxxxxxFxxPxxxxxFxxxC (SEQ ID NO: 15)
GxxRxVxxxSxxPAxxSxExLxxxD (SEQ ID NO: 16) "
ESxxVDxPxGxxxxxTxxFxxxxxxxNLxxL (SEQ ID NO: 17)
[0079] Consensus sequence CxSxxxxxxxAPxxxxWxxxxxFxxPxxxxxFxxxC (SEQ ID NO: 15) comprises the region corresponding to amino acids 30 to 65 of PYR1 (SEQ ID NO: I). Consensus sequence GxxRxVxxxSxxPAxxSxExLxxxD (SEQ ID NO: 16) comprises tlie region corresponding to amino acids 76 to 100 of PYR1 (SEQ ID NO: l ).
ESxxVDxPxGxxxxxTxxFxxxxxxxNLxxL (SEQ ID NO: 17) comprises the region corresponding to amino acids 141 to 171 of PYR1 (SEQ ID NO: l).
[0080] In some embodiments, more specific consensus sequences can be generated by aligning subsets of the 14 members of the Arabidopsis PYR/PYL proteins, as shown below. The consensus sequences of SEQ ID NOs: 18, 116, and 1 17 were generated by aligning the Arabidopsis PYR/PYL receptor proteins PYR1, PYL1, PYL2, PYL3, PYL4, PYL5, and PYL6. The consensus sequences of SEQ ID NOs: 118, 119, and 120 were generated by aligning the Arabidopsis PYR/PYL receptor proteins PYL7, PYL8, PYL9, and PYL10. 1 he consensus sequences of SEQ ID NOs: 121 and 122 were generated by aligning the
Arabidopsis PYR/PYL receptor proteins PYL11, PYL12, and PYL13.
PYR1-PYL6
HxxxxxxxxCxSxxxxxxxAPxxxxWxxxxxFxxPxxYKxFxxxC (SEQ ID NO: 18)
VGRxVxVxSGLPAxxSxExLxxxDxxxxxxxFxxxGGxHRLxNYxSVT (SEQ ID NO: 1 16) VxESYxVDxPxGNxxxxTxxFxDxxxxxNLQxL (SEQ ID NO : 117)
PYL7-PYL10
iL HxxxxxQCxSxLV xIxAPxHx SxVRRFDxPQKYKPFxSRCxVxGx (SEQ ID
NO: 118)
ExGxxRF ' xx .SGLPATxSTExLExLDDxEHILxIxIxGGDFIRLKNVTSSxxxxHxExIxGxxGT x (SEQ ID NO: 119)
xxESFVVDVPxGNTKxxTCxFVExLlxCNLxSLAxxxERL (SEQ ID NO: 120)
PYL11-PYL13
CxSxxVxTIxAPLxLVWSILRxFDxPxxxxxFVKxCxxxSGxGG- (SEQ ID NO: 121)
GSVRxVTxVSxxPAxFSxERLxELDDESHVMxxSnGGxHRLV YxSKT (SEQ ID NO: 122) [0081] In some embodiments, the mutated PYR PYL receptor polypeptides of the present invention comprise one or more of the above-described consensus sequences (SEQ ID NOs: 15-18 and 116-122) or conservative variants thereof.
[0082] In some embodiments, a PYR/PYL mutation occurs at a residue within a consensus sequence of SEQ ID NOs: 15-18 or 1 16-122. In some cases, the mutation occurs at a residue that is absolutely conserved among all 14 members of the PYR PYL receptor protein family or that is absolutely conserved among all members of a PY R PYL receptor protein subset (e.g., the PYR1-PYL6 subset, the PYL7-PYL10 subset, or the PYL11-PYL13 subset). In some cases, the mutation occurs at a residue that is not absolutely conserved. Mutations that disrupt binding to a wild-type PP2C
[0083] In some embodiments, a mutated PYR/PYL receptor polypeptide is substantially identical to a SEQ ID listed herein and further comprises at least one (e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) mutation at an amino acid position. In some embodiments, a mutated
PYR/PYL receptor polypeptide is substantially identical to any of SEQ ID NOs: 1-14 or 41- 115 and further comprises at least one mutation at any amino acid position.
[0084] In some embodiments, a mutated PYR PYL receptor polypeptide comprises one or more mutations that disrupts binding to a wild-type PP2C (e.g., wild-type HAB1, ABI1 , or ABI2). In some embodiments, a mutated PYR/PYL receptor protein exhibits "disrupted" binding to a wild-type PP2C if the level of binding between the mutated PYR/PYL protein (e.g., a mutated PYR1 protein) and the wild-type PP2C is decreased by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more in the presence of ABA as compared to the level of binding between the corresponding wild-type PYR/PYL protein (e.g., wild-type PYR1) and the wild-type PP2C in the presence of ABA. In some embodiments, a mutated PYR/PYL receptor protein exhibits disrupted binding to a wild-type PP2C if no detectable binding occurs in the presence of ABA.
[0085] Mammalian or yeast two-hybrid approaches {see, e.g., Bartel, P.L. et. al. Methods Enzymol, 254:241 (1995)) can be used to determine whether polypeptides interact or bind when expressed together in a cell. Optionally, both positive and negative selection schemes can be utilized in the two-hybrid assay. Binding can also be measured indirectly, such as by measuring inhibition of PP2C activity. Inhibition of PP2C activity can be measured in live cells using the yeast two hybrid or other cell-based methods. It can also be measured in vitro using enzymatic phosphatase assays in the presence of a colorirnetric detection reagent (for example, para-nitrophenyiphosphate). See, e.g., Park et ai., Science, 2009, 324: 1068-1071, and the Examples section below; see also, US 2010/0216643, US 201 1/0271408, and US 2014/0259226, incorporated by reference herein, [0086] In some embodiments, a mutated PYR/PYL receptor that comprises one or more mutations that disrupts binding to a wild-type PP2C comprises a mutation at one or more residues of the PP2C binding interface. The PP2C binding interface of a PYR/PYL receptor polypeptide comprises amino acid residues that are in close proximity (e.g., within about 5 A) to PP2C when PP2C, the PYR/PYL receptor, and ABA are all bound together in a ternary complex. In total, there are 25 residues that make up the PP2C binding interface in PYR1 (SEQ ID NO: I): H60, F61, 162, K63, 184, S85, G86, L87, P88, A89, HI 15, Rl 16, LI 17, P148, G 150, \ 1 1 . D154, D155, T156, M158, F159, T162, V163, L166, and K170. The residu es of the PP2C binding interface are also highly conserved among other PYR/PYL family members. Thus, in some embodiments, corresponding mutations can be made in the PP2C binding interface of other PYR PYL receptor proteins of interest by aligning the sequences of PYR1 (SEQ ID NO: 1) and the PYR/PYL protein of interest.
[0087] In some embodiments, a mutated PYR PYL receptor comprises one, two, three, four, five, six, seven, eight, nine, or more amino acid substitutions in the PP2C binding interface relative to wild-type PYR/PYL, In some embodiments, a muated PYR/PYL receptor comprises 1-10 mutations, 5-10 mutations, 1-7 mutations, 1-5 mutations, 1-3 mutations, 1-2 mutations, 2-7 mutations, or 2-5 mutations in the PP2C binding interface relative to wild-type PYR/PYL. In some embodiments, a mutated PYR/PYL receptor comprises a substitution at one or more of residues selected from F61, 162, K63, 184, S85, G86, L87, P88, A89, HI 15, R116, LI 17, PI48, GI50, N151, D155, ΊΤ56, M158, F159, ΊΤ62, and K170 in PYR1. In some embodiments, a mutated PYR/PYL receptor comprises one or more substitutions selected from F61 D/E G/H/I/K/N/P/Q R/S, I62D/E/G/K/R/W/Y, K63P, I84L,
S85A/C/B/E/F/G/H/1/K/L/M/N/P/Q/R/VAVA;",
G86A/C D/E/F/H/I/KJ^
P88C D E/F/G/H I/K/L M/N/Q/R/S/ /VAVAr
HI 1 SA/OO/WF/G/l/K/LM/P/Qm/SfT/V/Wri, Rl 16A/C D/E F/G H/I P/S TA^AV/Y,
L117A/D E/G H/K/ P/Q/R S/TA /WA , P148C/D/E/F/G/H/I/I^/M/N/Q R/S/TA/A\ Y, G150I/R/VAV, N151C/D/E/F/G/m^^^ D 155 C/F/G I/K/L M/P/RA^ W Y, T 156E/T/G/IM/I L/M/N/P/Q/R WA'", M158P,
F159D E G/H K/N/P/Q/R/S/W/Y, T162D/E/F7P, K170P, and combinations thereof.
[0088] In some embodiments, the mutated PYR PYL receptor comprises a mutation at position H60. In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position F61 (e.g., a F61D E/G H/I K N P/Q R S substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position 162 (e.g., a I62D E/G/ /R/W7Y substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position K63 (e.g., a K63P substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position 184 (e.g., a I84L substitution). In some
embodiments, the mutated PYR/PYL receptor comprises a mutation at position S85 (e.g., a S85A/C/D/E/F/G H7I K/L M/N/P/Q/R/VAVA7 substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position G86 (e.g., a
G86A/C/D E/T/H/I K/L/M/ P/Q/R/S TA^AVAr substitution). In some embodiments, the mutated PYR'PYL receptor comprises a mutation at position L87 (e.g., a
L87A/C/D/E/G/W /N/Q/R/S/TA¾vY substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position P88 (e.g., a
P88C/D/TyT/G, fWK/i../M/N/Q/R'S/TA^, \V,A^ substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position A89 (e.g., a
A89C D/E/F/H/I/K/L/ I/ '/P/Q/R S T/VAr substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position HI 15 (e.g., a
Hl lSA/C/O/E/F/G/L'TK/L/M/P/Q/ S/T/V/W/Y substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position RI 16 (e.g., a
Rl 1 eA C D FTF/G H I/P/S/TAVA A substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position LI 17 (e.g., a
L 117A/D/E/G/I1''K. P/Q/R/S/T ?/W/Y substitution) . In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position P148 (e.g., a
PU O/E/F/GM/l/K/lJMfN/Q/R Si /WiY substitution). In some embodiments, the mutated PYR'PYL receptor comprises a mutation at position G 150 (e.g., a G ISQI/NAVW substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position N151 (e.g., a N15 IGD/E/F/G/EJliKJlJM/P/Q/RN/WFY substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position D 154. In some embodiments, the mutated PYR'PYL receptor comprises a mutation at position D155 (e.g., a D155C/F/G/1/K/L/M/P/R/VAWY substitution). In some embodiments, the mutated PYR PYL receptor comprises a mutation at position T156 (e.g., a
T156E/F/G H/I L/M N/P/Q/R/W/Y substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position Ml 58 (e.g., a M158P substitution). In some embodiments, the mutated PYR PYL receptor comprises a mutation at position F159 (e.g., a F159D E/G H K/ P/Q/R S/W/Y substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position T162 (e.g., a T162D/E F/P substitution). In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position VI 63. In some embodiments, the mutated PYR PYL receptor comprises a mutation at position LI 66. In some embodiments, the mutated PYR/PYL receptor comprises a mutation at position K 170 (e .g . , a K 170P substitution) .
[0089] In some embodiments, the mutated PYR/PYL protein comprises one or more mutations at amino acids corresponding to position F61 , S85, T156, or T162 in PYR1. In some embodiments, the mutated PYR PYL protein comprises one or more substitutions selected from F61 D/E/G/H I K/N/P/Q/R/S, S85A/C/D E/F/G/WI/¾^/M/N P/Q/R,^AV/Yr, T 156E/F/G/H/L'X/L/M/N/P/Q/R'W/Y, T 162D/E/F/P, and combinations thereof In some embodiments, the mutated PYR/PYL protein comprises one or more substitutions selected from F61K, S85P, T156P, T162D, and combinations thereof.
Mutations that promote agonization by an orthogonal ligand
[0090] In addition to comprising one or more mutations that disrupts binding to a wild-type PP2C some embodiments, the mutated PYR PYL receptor polypeptides of the present invention further comprise one or more mutations (e.g., one, two, three, four, five, six, seven, eight, nine, or more substitutions) that confers sensitivity to an orthogonal ligand. In some embodiments, a muated PYR PYL receptor comprises 1-10 mutations, 5- 10 mutations, 1-7 mutations, 1-5 mutations, 1-3 mutations, 1-2 mutations, 2-7 mutations, or 2-5 mutations, relative to wild-type PYR/PYL, that confer sensitivity to an orthogonal ligand. Mutated
PYR/PYL receptor polypeptides that are agonized by orthogonal ligands are described, e.g., in LTS 201 1/0271408 and WO 2014/159394, incorporated by reference herein. In some embodiments, the orthogonal ligand is an agrochemical. Agrochemicals are often prepared and applied to plants as esters or salts, which may improve uptake and efficacy. The action of ubiquitous cellular esterases can convert esters (or homologous compounds such as the S- methyl derivatives of acibenzolar) into free acids or alcohols, which are the bioactive forms. In some embodiments, the agrochemical comprises a fungicide, an herbicide, a pesticide, a nematicide, a plant activator, a synergist, an herbicide safener, a plant growth regulator, an insect repeilant, or a fertilizer. In some embodiments, the agrochemical is mandipropamid, bromoxynil, chloroxynil, loxynil, fludioxonil, coumatetralyl, dichiobenil, fenhexamid, benoxacor, ΒΤΉ (acibenzolar-s-methyl), or benzothiadiazoie.
[0091] In some embodiments, an orthogonal ligand (e.g., mandipropamid) agonizes a mutated PYR/PYL receptor polypeptide, but does not significantly agonize a wild-type PYR PYL receptor polypeptide, when the orthogonal ligand is contacted to the PYR/PYL receptor polypeptide. As used herein, a agent "agonizes" a PYR PYL receptor protein if the presence of the agent results in activation or up-regulation of activity of the receptor, e.g., to increase downstream signaling from the PYR/PYL receptor. For the present invention, an agent agonizes a PYR/PYL receptor if, when the agent is present at a concentration no greater than 200 μΜ, contacting the agent to the PYR PYL receptor results in activation or up- regulation of the activity of the P YR/PY L receptor. If an agent does not induce activation or up-regulation of a PYR/PYL receptor protein's activity when the agent is present at a concentration no greater than 200 μΜ, then the agent does not significantly agonize the PYR PYL receptor. As used herein, "activation" requires a minimum threshold of activity to be induced by the agent. Determining whether this minimum threshold of activity has been met can be accomplished, e.g., by using an enzymatic phosphatase assay that sets a minimum value for the level of enzymatic activity that must be induced (e.g., enzymatic activity of a wild-type PP2C), or by using an enzymatic phosphatase assay in the presence of a colorimetric detection reagent (e.g., para-nitrophenylphosphate) wherein the minimum threshold of activity has been met if a color change is observed.
[0092] In some embodiments, the mutated PYR/PYL receptor comprises a substitution at a residue corresponding to amino acid position 59 in PYR1 (SEQ ID NO: 1). As described in US 2011/0271408, in some cases, a K59 mutation is not only sufficient to abolish ABA sensitivity in a modified PYR/PYL receptor protein, it is also sufficient to confer sensitivity to an orthogonal ligand (i.e., a molecule other than ABA) on a modified PYR/PYL receptor protein. In some cases, the K59 mutation that results in receptor activation by an orthogonal ligand is a substitution of an alanine residue for the wild-type residue, a substitution of a cysteine residue for the wild-type residue, a substitution of an aspartic acid residue for the wild-type residue, a substitution of a glutamic acid residue for the wild-type residue, a substitution of a phenylalanine residue for the wild-type residue, a substitution of a glycine residue for the wild-type residue, a substitution of a histidine residue for the wild-type residue, a substitution of a leucine residue for the wild-type residue, a substitution of a methionine residue for the wild-type residue, a substitution of an asparagine residue for the wild-type residue, a substitution of a glutamme residue for the wild-type residue, a substitution of an arginine residue for the wild-type residue, a substitution of a serine residue for the wild-type residue, a substitution of a threonine residue for the wild-type residue, a substitution of a valine residue for the wild-type residue, a substitution of a tyrosine residue for the wild-type residue, or a substitution of a tryptophan residue for the wild-type residue. In some embodiments, the mutation at position K59 is a K59R substitution. In some embodiments, the modified PYR/PYL receptor protein may comprise at least one more mutation in addition to the K59 mutation. [0093] In some embodiments, the modified PYR/PYL receptor protein comprises one or more mutations (e.g., one, two, three, four, five, six, seven, eight, nine, or more substitutions) that confers sensitivity to an orthogonal ligand (e.g., mandipropamid), wherein the mutations comprise substitutions at one or more amino acid residues corresponding to positions 58, 59, 81, 83, 87, 89, 108, 122, 158, 159, 160, and/or 164 in PYR 1 (SEQ ID NO: l). In some embodiments, the modified PYR PYL receptor protein comprises one or more substitutions selected from Y58H, V81C, YK ! i . V81T, V83L, L87A, A89W, F108A, F108C, F108E, F108G, F108I, F108L, F108N, F1Q8Q, F108S, F 108T, F108V, S122G, M158I, M158V, F159A, F159C, F159I, F159L, F159M, F159T, F159V, A160V, V164I, or combinations thereof. In some embodiments, the mutated PYR PYL receptor protein comprises a mutation at one or more amino acids corresponding to positions Y58, 59, V81, A89, Fl 08, S 122,
M158, F159, or A160 in PYRl (SEQ ID NO: l), wherein the mutation is selected from Y58H, K59R, V81C, V81I, V81T, A89W, F108A, F108C, F108E, FI08G, F108I, F108L, F108N, F108Q, F108S, F108T, F108V, S122G, M158I, Ml 58V, F159A, F159C, F159I, FI59L, F159M, F159T, F159V, A160C, A160V, or combinations thereof. [0094] In some embodiments, the mutated PYR/PYL receptor polypeptide that is agonized by an orthogonal ligand (e.g., mandipropamid) that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and that comprises one or more mutations that disrupts binding to a wild-type PP2C comprises mutations at one or more ammo acid residues corresponding to positions 58, 59, 81, 108, 122, 158, 159, 160, and 162 in PYR! (SEQ ID NO: I). In some embodiments, the mutated PYR/PYL receptor comprises one or more substitutions selected from Y58H, V81C, V81I, V81T, F108A, F108C, F108E, F108G, F108I, F108L, F108N, F108Q, F108S, F108T, F108V, SI22G, M158I, M158V, F159A, F159C, F159I, F159L, F159M, F159T, F159V, A 160V, T162D, T162E, T162F, T162P, and combinations thereof. In some embodiments, the mutated PYR PYL receptor comprises one or more substitutions selected from Y58H, K59R, V8 H, F108A, S122G, M158I, M158V, F159V, A160C, A160V, and T162D.
[0095] In some embodiments, a mutated PYR PYL receptor that is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and that is disrupted binding to a wild-type PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%>, at least 96%>, at least 97%, at least 98%, or at least 99% identical to) any of SEQ ID NO: ! , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 and compnses mutations corresponding to Y58H, K59R, V81I, F108A, S 122G, M158I, F159V, A160V, and T162D in PYRI . In some embodiments, the mutated PYR/PYL receptor polypeptide is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) SEQ ID NO: 19. In some embodiments, the mutated PYR/PYL receptor polypeptide comprises the sequence of SEQ ID NO: 19.
[0096] In some embodiments, a mutated PYR/PYL receptor that is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and that is disrupted binding to a wild-type PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%>, at least 96%>, at least 97%, at least 98%, or at least 99% identical to) any of SEQ ID NO: !, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 and comprises mutations corresponding to Y58H, K59R, V81 I, F108A, S 122G, M158V, F159V, A160V, and T162D in PYRI . In some embodiments, the mutated PYR PYL receptor polypeptide is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) SEQ ID NO:20. In some embodiments, the mutated PYR PYL receptor polypeptide comprises the sequence of SEQ ID NO: 20. [0097] In some embodiments, a mutated PYR/PYL receptor that is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and that is disrupted binding to a wild-type PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) any of SEQ ID NO: ! , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 and comprises mutations corresponding to Y58H, K59R, V81 I, F108A, S 122G, M158I, F159V, A160C, and T162D in PYR1. In some embodiments, the mutated PYR/PYL receptor polypeptide is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) SEQ ID NO:21. In some embodiments, the mutated PYR/PYL receptor polypeptide comprises the sequence of SEQ ID NO:21.
III. Mutated Type 2C Protein Phosphatases
[0098] In another aspect, mutated PP2Cs that (I) comprise one or more mutations that disrupts binding to a wild-type PYR/PYL receptor polypeptide and that (2) optionally comprise one or more mutations that disrupts the catalytic activity of the PP2C are provided. Also provided herein are polynucleotides encoding polypeptides comprising the mutated PP2Cs; expression cassettes and expression vectors comprising said polynucleotides; cells (e.g., plant, animal, mammalian, bacterial, or fungal cells), plants, and plant parts comprising the mutated PP2Cs; methods of making cells or plants comprising the mutated PP2Cs;
methods of making the mutated PP2Cs; methods of activating an orthogonal PYR PYL-PP2C interaction in cells or plants comprising the mutated PP2Cs and mutated PYR/PYL receptor polypeptides as described above; and methods of controlling gene expression in ceils or plants comprising the mutated PP2Cs and mutated PYR/PYL receptor polypeptides as described herein.
[0099] A wide variety of wild-type (naturally occurring) PP2C protein sequences are known in the art. PP2Cs, such as the PP2Cs within the "Clade A" cladogram, are key negative regulators of ABA signaling. For example, HAB1, ABI1, ABI2, and PP2CA have been shown to affect both seed and vegetative responses to ABA. See, e.g., Rubio et al., Plant Physiology, 2009, 150: 1345-1355, incorporated by reference herein. ABA signaling via PP2Cs is modulated by PYR/PYL receptor polypeptides. In the absence of ABA, PYR/PYL proteins are not bound to PP2Cs, and therefore, PP2C activity is high, which prevents phosphorylation and activation of snRK2s (subfamily 2 SNF1 -related kinases) and downstream factors. In the presence of ABA, PYR/PYL proteins bind and inhibit PP2Cs, which allows accumulation of phosphoiylated downstream factors and ABA transcriptional responses. See, e.g., Park et al., Science, 2009, 324: 1068-1071, incorporated by reference herein.
[0100] PP2Cs are found in Arabidopsis and other species of plants as well as across kingdoms, and are characterized in part by the presence of a serine/threonine phosphatase catalytic site. In some embodiments, a wild-type PP2C protein comprises a Clade A PP2C protein. In some embodiments, a wild-type PP2C protein comprises any of SEQ ID NOs:22, 23, 24, 25, 26, 27, 28, or 29. In some embodiments, a wild-type PP2C protein is substantially identical to (e.g., at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% 95%, 96%, 97%, 98%, or 99% identical to) any of SEQ ID NOs:22, 23, 24, 25, 26, 27, 28, or 29.
Mutations that disrupt binding to a wild-type PYR/PYi. receptor polypeptide
[0101 ] In some embodiments, a mutated PP2C protein is substantially identical to a SEQ ID listed herein and further comprises at least one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) mutation at an amino acid position. In some embodiments, a mutated PP2C is substantially identical to any of SEQ ID NOs:22-29 and further comprises at least one mutation at any amino acid position.
[0102] In some embodiments, a mutated PP2C protein comprises one or more mutations that disrupts binding to a wild-type PYR/PYL receptor protein (e.g., wild-type PYR1). In some embodiments, a mutated PP2C exhibits "disrupted" binding to a wild-type PYR/PYL receptor protein if the level of binding between the mutated PP2C protein (e.g., a mutated HAB1 protein) and the wild-type PYR/PYL receptor protein is decreased by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90% or more in the presence of ABA as compared to the le v el of binding between the corresponding wild-type PP2C protein (e.g., wild-type HAB1) and the wild-type PYR/PYL receptor protein in the presence of ABA, In some embodiments, a mutated PP2C protein exhibits disrupted binding to a wild-type PYR/PYL receptor protein if no detectable binding occurs in the presence of ABA, Binding between a mutated PP2C and a wild-type PYR/PYL protein can be measured as described herein, e.g., in Section II above,
[0103] In some embodiments, a mutated PP2C that comprises one or more mutations that disrupts binding to a wild-type PYR/PY L receptor protein comprises a mutation at one or more residues of the PYR PYL binding interface. The PYR/PYL binding interface of a PP2C protein comprises amino acid residues that are in close proximity (e.g., within about 5 A) to die PYR/PYL receptor when PP2C, the PYR PYL receptor, and ABA are all bound together in a ternary complex. In some embodiments, the PYR/PYL binding interface is determined with reference to the PYR/PYL protein PYR1. In some embodiments, the PYR/PYL binding interface in HAB i is made up of the following 20 amino acid residues: R199, S200, E20I , E203, H245, G246, G247, S322, E323, T324, K381 , 1383, Q384, W385, Q386, R389, F391, G392, V393, and Y404. The residues of the PYR PYL binding interface are conserved among other PP2C family members. Thus, in some embodiments, corresponding mutations can be made in the PYR/PYL binding interface of other PP2C proteins of interest by aligning tlie sequences of HAB 1 (SEQ ID N():22) and the PP2C protein of interest. [0104] In some embodiments, a mutated PP2C comprises one, two, three, four, five, six, seven, eight, nine, or more ammo acid substitutions in the PYR PYL binding interface relative to wild-type PP2C. In some embodiments, a muated PP2C comprises 1 -10 mutations, 5-10 mutations, 1 -7 mutations, 1-5 mutations, 1 -3 mutations, 1-2 mutations, 2-7 mutations, or 2-5 mutations in the PYR/PYL binding interface relative to wild-type PP2C. In some embodiments, a mutated PP2C comprises a substitution at one or more of residues selected from E201, E203, H245, G246, G247, E323, K381 , 1383, W385, R389, F391 , G392, V393, and Y404 in HAB I . In some embodiments, a mutated PP2C comprises one or more substitutions selected from E201H/K, E203A/CfD/F/GMfU¥JUMm/P/R/Sn:fV/W/Y, m45A/C/D/E F/G/I K L/ /N/P/Q R/S rA^/WAr,
G246A/C/D E/F/H I K/L /P/Q/R7S/T/V/W Y, G247A/E/F/I/T TVT/P/Q R/T/V/W/Y, E323L, K381W, I383D E/G/H/K/ P/Q R/S/T/W/Y,
W385A/C/D/E/F/G/m/K/L/MWP/Q/R/S/T/VA'",
R?8 A/C7D.;iv F/G/i l/i/K T ^i/i Q/i / YA\ Ύ. i- « i D/ivp.
G392A/D/C/E/F/H/I/I^^
Y404D E/G/K/N/P/Q/R/S/T, and combinations thereof.
[0105] In some embodiments, the mutated PP2C comprises a mutation at position R199. In some embodiments, die mutated PP2C comprises a mutation at position S200. In some embodiments, the mutated PP2C comprises a mutation at position E201 (e.g., a E201H/K substitution). In some embodiments, the mutated PP2C comprises a mutation at position E203 (e.g., a E203A/C/D/F/G/H/I /IJM N/P R/S TArAV' Y substitution). In some embodiments, die mutated PP2C comprises a mutation at position H245 (e.g., a
m45A/C D/E F/G/I L/M N P/Q/R/S/Γ/VAVA, substitution). In some embodiments, the mutated PP2C comprises a mutation at position G246 (e.g., a G246A/C/D E/F/H I/K/UM/N/P/Q/R S/T/V W/Y substitution). In some embodiments, the mutated PP2C comprises a mutation at position G247 (e.g., a
G247A/E F/I K !ViyP/Q/R rA W Y substitution). In some embodiments, the mutated PP2C comprises a mutation at position S322. In some embodiments, the mutated PP2C comprises a mutation at position E323 (e.g., a E323L substitution). In some embodiments, the mutated PP2C comprises a mutation at position T324. In some embodiments, the mutated PP2C comprises a mutation at position K381 (e.g., a K381W substitution). In some embodiments, die mutated PP2C comprises a mutation at position 1383 (e.g., a
1383D/E/G/H/ /N/P/Q/R/S/TAV/Y substitution). In some embodiments, the mutated PP2C comprises a mutation at position Q384. In some embodiments, the mutated PP2C comprises a mutation at position W385 (e.g., a W385A/(^/E F/G/H/I K/IJM/N P/Q/R/S/TA^ Y substitution). In some embodiments, the mutated PP2C comprises a mutation at position Q386. In some embodiments, the mutated PP2C comprises a mutation at position R389 (e.g., a, R3%9A/C/D/EiF/G/H/l/KAJM/P/QriN/W/Y substitution) . In some embodiments, the mutated PP2C comprises a mutation at position F391 (e.g., a F391D/E/P substitution). In some embodiments, the mutated PP2C comprises a mutation at position G392 (e.g., a
Figure imgf000038_0001
substitution). In some embodiments, the mutated PP2C comprises a mutation at position V393 (e.g., a V393D E/G/K/N/P/Q R/S substitution). In some embodiments, the mutated PP2C comprises a mutation at position Y404 (e .g . , a Y404D/E/G/K/N/P/Q/R/S/T substitution) .
[0106] In some embodiments, the mutated PP2C protein comprises one or more mutations at amino acids corresponding to position E203, 1383, or V393 in HAB 1. In some embodiments, the mutated PP2C protein comprises one or more substitutions selected from E2Q3A/Cfo/F/G/H/I/K/UMn /P/R/S/T/V/W/Y, I383D E/G H/K/N P/Q/R/S TAV/Y, V393D E/G /N/P/Q R/S, and combinations thereof. In some embodiments, the mutated PP2C protein comprises one or more substitutions selected from E203D, E203T, E203W, I383G, V393K, V393R, V393Q, and combinations thereof.
Mutations that disrupt PP2 catalytic activity
[0107] In some embodiments, the mutated PP2C further comprises one or more mutations that disrupts the catalytic activity of the mutated PP2C. In some embodiments, the mutated PP2C exhibits "disrupted" catalytic activity if the level of phosphatase activity of the mutated PP2C (e.g., a mutated HAB i) is decreased by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%> or more relative to a corresponding wild-type PP2C (e.g., wild-type HAB I). In some embodiments, the mutated PP2C does not have a detectable level of phosphatase activity. In some embodiments, phosphatase activity is measured in a phosphatase assay, e.g., as described herein in the Examples section. In some embodiments, the catalytic activity of the mutated PP2C is measured by measuring the activity of a downstream signaling pathway component (e.g., measuring the activity of a downstream snRK2 kinase).
[0108] In some embodiments, the mutated PP2C comprises a mutation at a residue within die PP2C catalytic active site. In some embodiments, the mutated PP2C comprises a mutation at one or more amino acid residues corresponding to the positions D204 or R505 in HAB 1 (SEQ ID NO:22). In some embodiments, the mutated PP2C comprises one or more substitutions selected from R505A and D204A.
[0109] In some embodiments, the mutated PP2C further comprises one or more substitutions that stabilizes or strengthens interactions with a mutated PYR/PYL protein (e.g., at a site within the PYR/PYL interface). In some embodiments, the mutated PP2C further comprises a mutation at one or more amino acid residues corresponding to the positions R199 and S322 in HAB1. In some embodiments, the mutated PP2C further comprises one or more substitutions selected from R199A, S322D, and S322E.
[0110] In some embodiments, the mutated PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) any of SEQ ID NO:22~29 and comprises mutations corresponding to D204A, V393R, and R505A in HAB 1 . In some embodiments, the mutated PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%>, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%>, at least 98%, or at least 99% identical to) any of SEQ ID NQ:22~29 and comprises mutations corresponding to R199A, D204A, S322D, V393R, and R505A in HAB1. In some embodiments, the mutated PP2C is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%>, at least 90%, at least 91%, at least 92%, at least 93%>, at least 94%>, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) SEQ ID NO: 30 or 31. In some embodiments, the mutated PP2C comprises the se uence of SEQ ID NO:30 o 31. IV. Methods of Making Mutated PYR/PYL Receptor Polypeptides and Mutated PP2Cs
[0111] Embodiments of the present invention provide for use of the above proteins and/or nucleic acid sequences, encoding such polypeptides, in the methods and compositions (e.g., expression cassettes, plants, cells, etc.) of the present invention. The isolation of a polynuc eotide sequence encoding a plant wild-type PYR/PYL receptor and/or PP2C (e.g., from plants where PYR/PYL sequences and/or PP2C sequences have not yet been identified) may be accomplished by a number of techniques. For instance, oligonucleotide probes based on the PYR/PYL coding sequences disclosed herein (e.g. , as listed in the SEQUENCE LISTING) can be used to identify the desired wild-type PYR PYL gene in a cDNA or genomic DNA library, or oligonucleotide probes based on the PP2C coding sequences disclosed herein can be used to identify the desired wild-type PP2C gene in a cDNA or genomic DNA library. To construct genomic libraries, large segments of genomic DNA are generated by random fragmentation, e.g., using restriction endonucleases, and are ligated with vector DNA to form concatemers that can be packaged into the appropriate vector. To prepare a cDNA library, mRNA. is isolated from the desired tissue, such as a leaf from a particular plant species, and a cDNA library containing the gene transcript of interest is prepared from the mRNA. Alternatively, cDNA may be prepared from mRNA extracted from other tissues in which the PYR/PYL gene and/or PP2C gene is expressed. [0112] The cDNA or genomic library can then be screened using a probe based upon the sequence of a PYR/PYL gene and/or PP2C gene disclosed here. Probes may be used to hybridize with genomic DN A or cDNA sequences to isolate homologous genes in the same or different plant species. Alternatively, antibodies raised against a polypeptide can be used to screen an mRNA expression library. [0113] Alternatively, the nucleic acids encoding a PYR/PYL or a PP2C can be amplified from nucleic acid samples using amplification techniques. For instance, polymerase chain reaction (PCR) technology can be used to amplify the coding sequences of a PYR PYL and/or a P.P2C directly from, genomic DNA, from cDNA, from genomic libraries or cDNA libraries. PCR and other in vitro amplification methods may also be useful, for example, to clone polynucleotide sequences encoding the PYR/PYL and/or PP2C to be expressed, to make nucleic acids to use as probes for detecting the presence of the desired mRNA in samples, for nucleic acid sequencing, or for other purposes. For a general overview of PCR see PCR Protocols: A Guide to Methods and Applications . (Innis, M., Gelfand, D., Smnsky, J. and White, T., eds.), Academic Press, San Diego (1990). Appropriate primers and probes for identifying sequences from plant tissues are generated from comparisons of the sequences provided here with other related genes. [0114] In some embodiments, the partial or entire genome of a number of plants has been sequenced and open reading frames identified. By a BLAST search, one can identify the coding sequence for a wild-type PYR/PYL or wild-type PP2C in various plants.
[01 IS] Embodiments of the present invention also provide for methods of making mutated PYR/PYL receptor proteins and mutated PP2Cs as described herein. Mutated PYR/PYL receptor polypeptides can be constructed by mutating the DNA sequences that encode the corresponding wild-type PYR/PYL receptor polypeptide (e.g. , a wild-type PYR/PYL polypeptide of any of SEQ ID NOs: 1 -14 or a corresponding variant from which the mutant PYR PYL receptor polypeptide of the invention is derived), such as by using techniques commonly referred to as site-directed mutagenesis. Similarly, mutated PP2Cs can be constructed by mutated the DNA sequences that encode the corresponding wild-type PP2C protein (e.g. , a wild-type PP2C of any of SEQ ID NOs:22-29 or a corresponding variant from which the mutant PP2C of the invention is derived). Nucleic acid molecules encoding the wild-type PYR/PYL receptor polypeptide and/or PP2C protein can be mutated by a variety of polymerase chain reaction (PCR) techniques well-known to one of ordinary skill in the art. (See, e.g., PCR Strategies (M. A. Innis, D. H. Gelfand, and J. J. Sninsky eds., 1995,
Academic Press, San Diego, CA) at Chapter 14; PCR Protocols : A Guide to Methods and Applications (M. A. Innis, D. 1 1. Gelfand, J. J. Sninsky, and T J. White eds., Academic Press, NY, 1990),
[0116] By way of non-limiting example, mutagenesis may be accomplished by means of error-prone PCR amplification (ePCR), which modifies PCR reaction conditions (e.g., using error-prone polymerases, varying magnesium or manganese concentration, or providing unbalanced dNTP ratios) in order to promote increased rates of error in DNA replication. Kits for ePCR mutagenesis are commercially available, such as the GeneMorph® PCR Mutagenesis kit (Stratagene) and Diversify® PCR Random Mutagenesis Kit (Clontech). Briefly, DNA polymerase (e.g., Taq polymerase), salt (e.g.. MgC32, MgS04, or MnS04), dNTPs in unbalanced ratios, reaction buffer, and DNA template are combined and subjected to standard PCR amplification according to manufacturer's instructions. Following ePCR amplification, the reaction products are cloned into a suitable vector to construct a mutagenized library, which can then be transformed into suitable cells (e.g., yeast cells) for subsequent screening (e.g., via a two-hybrid screen) as described below.
[0117] Alternatively, mutagenesis can be accomplished by recombination (i.e. DNA shuffling). Briefly, a shuffled mutant library is generated through DNA shuffling using in vitro homologous recombination by random fragmentation of a parent DNA followed by reassembly using PCR, resulting in randomly introduced point mutations. Methods of performing DNA shuffling are known in the art (see, e.g., Stebel, S.C. et al., Methods Mol Biol 352: 167-190 (2007)). [0118] Optionally, multiple rounds of mutagenesis may be performed in order to improve the efficiency of mutant proteins isolated. Thus, in some embodiments, PYR/PYL mutants and/or PP2C isolated from ePCR and subsequent screening may be pooled and used as templates for later rounds of mutagenesis.
V. Screening Mutated PYR/PYL Receptor Polypeptides and Mutated PP2Cs
[0119] Embodiments of the present invention provide for methods of screening mutated PYR/PYL receptor proteins and mutated PP2C proteins to identify sets of mutually suppressing mutations in the mutated PYR/PYL protem and mutated PP2C protein, which as a pair, prevent a PYR/PYL-PP2C complex from forming in the presence of ABA. In some embodiments, the method comprises expressing a mutated PYR/PYL protein (e.g., as described in Section Π above) and expressing a mutated PP2C protein (e.g., as described in Section III above) in the presence of ABA in an in vitro or in vivo assay, and evaluating the level of downstream activity in response to the addition of ABA, relative to a corresponding wild-type PYR/PYL protein and wild-type PP2C. In some embodiments, the combination of the mutated PYR PYL protein and the mutated PP2C protein exhibits at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9- fo3d or more of a decrease in sensitivity to ABA, relative to a corresponding wild-type PYR/PYL protem and PP2C protein. In some embodiments, the downstream activity is measured by an enzymatic phosphatase assay in the presence of a colorimetric detection reagent (for example, para-nitrophenylphosphate). See, e.g.. Park et al., Science, 2009, 324: 1068-1071, and the Examples section below; see also. US 2010/0216643, US
2011 /0271408, and US 2014/0259226, incorporated by reference herein. [0120] Embodiments of the present invention also provide for methods of screening mutated PYR/PYL receptor proteins and mutated PP2C proteins to determine whether the mutated PYR/PYL receptor protein and the PP2C protein interact with each other. In some embodiments, the mutated PYR/PYL receptor protem and the PP2C protein interact with each other if there is a physical interaction between the mutated PYR PYL protein and the mutated PP2C protein that is detectable in a biochemical assay, e.g., in a yeast-two hybrid assay. Methods for detecting a biochemical interaction between a mutated PYR/PYL protein and a mutated PP2C protein by yeast two-hybrid assay are described herein in the Examples section, and are also described, for example, in Park et al., Science, 2009, 324: 1068-1071, incorporated by reference herein.
[0121] Optionally, binding assays can be used for determining whether the mutated PYR/PYL receptor protein and the PP2C protein interact with each other. Binding assays can involve contacting the mutated PYR PYL receptor polypeptide with the mutated PP2C and allowing sufficient time for the proteins to form a binding complex. Any binding complexes formed can be detected using any of a number of established analytical techniques. Protein binding assays include, but are not limited to, methods that measure co-precipitation or co- migration on non -denaturing SDS-polyacrylamide gels, and co-migration on Western blots (see, e.g., Bennet, J.P. and Yamamura, H.I. (1985) "Neurotransmitter, Hormone or Drug Receptor Binding Methods," in Neurotransmitter Receptor Binding (Yamamura, H. I., et al., eds.), pp. 6.1 -89. The PYR/PYL and PP2C proteins utilized in such assays can be naturally- expressed, cloned or synthesized.
[0122] In some embodiments, the mutated PYR/PYL proteins and mutated PP2Cs that are initially identified by any of the foregoing screening methods can be further tested to validate the apparent activity and/or determine other biological effects of the mutated PYR/PYL receptor polypeptide and mutated PP2C. In some cases, the mutated PYR/PYL receptor polypeptide and the mutated PP2C are expressed in plants and tested for the ability to effect plant stress (e.g. , drought tolerance), seed germination, or another phenotype affected by ABA. A number of such assays and phenotypes are known in the art and can be employed according to the methods of the invention. VI. PYR/PYL-PP2C Interaction Module for Regulation of Gene Expression
[0123] In another aspect, the mutated PYR/PYL proteins and mutated PP2C proteins described herein can be used to regulate gene and protein expression in vivo (e.g., in cells such as plant, animal, mammalian, bacterial, or fungal cells, or in plants such as crops). n some embodiments, the mutated PYR/PYL proteins and mutated PP2C proteins described herein, when expressed in a plant or plant cell, are able to interact with each other (e.g., in the presence of an orthogonal ligand such as mandipropamid) without activating endogenous ABA responses the plant or plant cell. This orthogonal interaction between mutated
PYR/PYL and PP2C proteins can be utilized to generate an inducible protein-protein interaction module for regulating gene and protein expression in a cell or in a plant, such as for engineering crops in which a desired protein function or phenotype is regulated agrochemically. [0124] In some embodiments, a PYR PYL-PP2C interaction module utilizes fusion constructs in which one of the mutated PYR/PYL receptor protein and mutated PP2C protein is fused to a transcriptional activation domain (AD) and the other of the mutated PYR/PYL receptor protein and mutated PP2C protein is fused to a DNA binding domain (BD). In this PYR/PYL-PP2C interaction module, interaction between the mutated PYR/PYL protein and mutated PP2C protein is regulated by the presence or absence of an orthogonal ligand (e.g., an agrochemical such as mandipropamid). In the absence of the orthogonal ligand, the mutated PYR PYL protein and mutated PP2C do not significantly interact with each other (e.g., do not interact with other at a detectable level). In the presence of the ortiiogonal ligand, however, the mutated PYR/PYL protein and the mutated PP2C protein interact with each other, which results in the physical association of the AD and BD fused to the mutated PYR PYL and mutated PP2C, and enables control of transcription of a target gene.
[0125] In some embodiments, the mutated PYR/PYL receptor protein is fused to a transcriptional activation domain and the mutated PP2C protein is fused to a DNA binding domain. In some embodiments, the mutated PP2C protein is fused to a transcriptional activation domain and the mutated PYR/PYL receptor protein is fused to a DNA binding domain. In some embodiments, the AD is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) the AD having the amino acid sequence of SEQ ID NO:35. In some embodiments, the AD comprises the sequence of SEQ ID NO:35. In some embodiments, the BD is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%>, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%>, at least 98%, or at least 99% identical to) the BD having the amino acid sequence of SEQ ID NO:36. In some embodiments, the BD comprises the sequence of SEQ ID NO:36.
[0126] In some embodiments, one or more expression cassettes comprising the fusion proteins is expressed in a plant or plant cell. In some embodiments, one expression cassette comprises both a mutated PYR/PYL receptor protein fused to a transcriptional activation domain and a mutated PP2C protein fused to a DNA binding domain, or comprises both a mutated PP2C protein fused to a transcriptional activation domain and a mutated PYR/PYL receptor protein fused to a DNA binding domain, under the control of a heterologous promoter. In some embodiments, a first expression cassette comprises a first heterologous promoter for expressing a mutated PYR/PYL receptor protein fused to one of a
transcriptional activation domain or a DNA binding domain, and a second expression cassette comprises a second heterologous promoter for expressing a mutated PP2C protein fused to the other of a transcriptional activation domain or a DNA binding domain. In some embodiments, the first promoter and the second promoter are the same promoter. In some embodiments, the first promoter and the second promoter are different promoters. In some embodiments, the promoter comprises a sequence that is bound by the DNA binding domain.
[0127] In some embodiments, one or both of the mutated PYR/PYL receptor protein (or mutant PYR/PYL fusion protein) and mutated PP2C protein (or mutant PP2C fusion protein) further comprises a sequence for localizing the expression of the mutated PYR/PYL protein or mutated PP2C protein, e.g., in the nucleus, in the cytoplasm of a cell, or in an organelle
(e.g., mitochondria or chioropiast). Localization of the PYR/PYL-PP2C interaction module to the nucleus of the cell can be advantageous, e.g., for regulating transcription factors or other nuclear proteins that require access to their DNA targets in order to control phenotypic outputs. [0128] In some embodiments, one or both of the mutated PYR/PYL receptor protein (or mutant PYR/PYL fusion protein) and mutated PP2C protein (or mutant PP2C fusion protein) is localized to the nucleus. Thus, in some embodiments, the mutated PYR/PYL receptor protein or fusion protein, or the mutated PP2C protein or fusion protein, further comprises a nuclear localization sequence. In some embodiments, the nuclear localization sequence is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) the nuclear localization sequence having the amino acid sequence of SEQ ID NO: 37. In some embodiments, the nuclear localization sequence comprises the sequence of SEQ ID NO: 37.
[0129] In some embodiments, one or both of the mutated PYR/PYL receptor protein (or mutant PYR/PYL fusion protein) and mutated PP2C protein (or mutant PP2C fusion protein) is localized to the cytoplasm.. Thus, in some embodiments, the mutated PYR/PYL receptor protein or fusion protein, or the mutated PP2C protein or fusion protein, further comprises a nuclear export sequence. In some embodiments, the nuclear export sequence is substantially identical to (e.g., at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to) the nuclear export sequence having the amino acid sequence of SEQ ID NO: 38 or 39. In some embodiments, the nuclear export sequence comprises the sequence of SEQ ID NO:38 or 39.
VII. Expression Cassettes and Expression Vectors
[0130] Once a polynucleotide sequence encoding a polypeptide comprising a mutated PYR/PYL receptor polypeptide and a polynucleotide sequence encoding a polypeptide comprising a mutated PP2C protein are obtained, the polynucleotide sequences can be used to prepare an expression cassette for expressing the mutated PYR/PYL receptor polypeptide and mutated PP2C in a cell (e.g., a plant, animal, mammalian, bacterial, or fungal cell) or in a transgenic plant, directed by a heterologous promoter. In some embodiments, the
polynucleotide sequence encoding the polypeptide comprising the mutated PYR/PYL receptor polypeptide and the polynucleotide sequence encoding the polypeptide comprising the mutated PP2C protein are expressed in a single expression cassette (e.g., under the control of a single heterologous promoter or each polynucleotide under the control of its own promoter). In some embodiments, a first expression cassette is generated comprising the polynucleotide sequence encoding the polypeptide comprising the mutated PYR/PYL receptor polypeptide under the control of a first promoter, and a second expression cassette is generated comprising the polynucleotide sequence encoding the polypeptide comprising the mutated PP2C protein under the control of a second promoter. In some embodiments, the first promoter and the second promoter are identical to each other. In some embodiments, the first promoter and the second promoter are not identical to each other.
[0131 ] To use a polynucleotide sequence for a mutated PYR PYL receptor polypeptide or a mutated PP2C protein in the above techniques, recombinant DNA vectors suitable for transformation of cells or plants are prepared. Techniques for transforming a wide variety of cells and higher plant species are well known and described in the technical and scientific literature. See, e.g., Weising et al. Ann. Rev. Genet. 22:421-477 (1988). A DNA sequence coding for the mutated PYR/PYL receptor polypeptide preferably will be combined with transcriptional and translational initiation regulatory sequences which will direct the transcription of the sequence from the gene in the intended tissues of the transformed plant.
[0132] For example, a promoter fragment may be employed to direct expression of the mutated PYR/PYL polynucleotide or mutated PP2C polynucleotide in all tissues of a regenerated plant. Such promoters are referred to herein as "constitutive" promoters and are active under most environmental conditions and states of development or cell differentiation. Examples of constitutive promoters include the cauliflower mosaic vims (CaMV) 35S transcription initiation region, the Γ- or 2'- promoter derived from T-DNA of Agrohacterium tumafaciens, and other transcription initiation regions from various plant genes known to those of skill. [0133] Alternatively, the promoter may direct expression of the mutated PYR/PYL receptor protein or mutated PP2C in a specific tissue (tissue-specific promoters) or may be otherwise under more precise environmental control (inducible promoters). Examples of tissue-specific promoters under developmental control include promoters that initiate transcription only in certain tissues, such as leaves, vegetative tissue, or guard cells (including but not limited to those described in WO/2005/085449; U.S. Patent No. 6,653,535; Li et al. , Sci China C Life Sci. 2005 Apr;48(2): 181-6; Husebye, et al, Plant Physiol, April 2002, Vol. 128, pp. 1180- 188; and Plesch, et al , Gene, Volume 249, Number 1 , 16 May 2000 , pp. 83- 89(7)). Examples of environmental conditions that may affect transcription by inducible promoters include anaerobic conditions, elevated temperature, or the presence of light. [0134] In some embodiments, the promoter comprises a sequence that is bound by a DNA binding domain (e.g., by a PYR/PYL- BD or PP2C-BD fusion protein as described herein).
[0135] In some embodiments, an upstream activating sequence (UAS) can also be included for enhancing gene expression.
[0136] If proper protein expression is desired, a polyadenylation region at the 3f-end of the coding region should be included. The polyadenylation region can be derived from a naturally occurring PYR/PYL gene or PP2C gene, from a variety of other plant genes, or from T-DNA, [0137] The vector comprising the sequences will typically comprise a marker gene that confers a selectable phenotype on plant cells. For example, the marker may encode biocide resistance, particularly antibiotic resistance, such as resistance to kanamycin, G418, bleomycin, hygromycin, or herbicide resistance, such as resistance to chlorosluforon or Basta.
[0138] In some embodiments, the mutated PYR/PYL nucleic acid sequence or the mutated PP2C nucleic acid sequence is expressed recombinantly in the cell or plant. A variety of different expression constructs, such as expression cassettes and vectors suitable for transformation of plant cells can be prepared. Techniques for transforming a wide variety of higher plant species are well known and described in the technical and scientific literature. See, e.g. , Weising et al. Ann. Rev. Genet. 22:421-477 (1988). A DNA sequence coding for a PYR/PYL protein can be combined with cis -acting (promoter) and frans -acting (enhancer) transcriptional regulatory sequences to direct the timing, tissue type and levels of transcription in the intended tissues of the transformed plant. Translational control elements can also be used.
Constitutive promoters
[0139] A promoter fragment can be employed to direct expression of a mutated PYR/PYL nucleic acid and/or mutated PP2C nucleic acid in all transformed cells or tissues, e.g., as those of a regenerated plant. The term "constitutive regulatory element" means a regulator}' element that confers a level of expression upon an operatively linked nucleic molecule that is relati v ely independent of the ceil or tissue type in which the constituti ve regulatory element is expressed. A constitutive regulator],' element that is expressed in a plant generally is widely expressed in a large number of cell and tissue types. Promoters that drive expression continuously under physiological conditions are referred to as "constitutive" promoters and are active under most environmental conditions and states of development or cell differentiation.
[0140] A variety of constitutive regulatory elements useful for ectopic expression in a transgenic plant are well known in the art. The cauliflower mosaic virus 35S (CaMV 35S) promoter, for example, is a well-characterized constitutive regulatory element that produces a high level of expression in ail plant tissues (Odell et al., Nature 313:810-812 (1985)). The CaMV 35S promoter can be particularly useful due to its activity in numerous diverse plant species (Benfey and Chua, Science 250:959-966 (1990); Futterer et al, Physiol. Plant 79: 154 (1990); Odell et al., supra, 1985). A tandem 35S promoter, in which the intrinsic promoter element has been duplicated, confers higher expression levels in comparison to the unmodified 35S promoter (Kay et al., Science 236: 1299 (1987)). Other useful constitutive regulatory elements include, for example, the cauliflower mosaic virus 19S promoter; the ubiquitin promoter; the Figwort mosaic vims promoter; and the nopaline synthase (nos) gene promoter (Singer et ai . Plant Mol. Biol. 14:433 (1990); An, Plant Physiol. 81 :86 (1986)).
[0141] Additional constitutive regulatory elements including those for efficient expression in monocots also are known in the art, for example, the pEmu promoter and promoters based on the rice Actin-1 5' region (Last et al. , Theor. Appl. Genet. 81 :581 (1991); Mcelroy et al., Mol. Gen. Genet. 231 : 150 (1991); Mcelroy et al. , Plant Cell 2: 163 (1990)). Chimeric regulatory elements, which combine elements from different genes, also can be useful for ectopically expressing a nucleic acid molecule encoding a mutated PYR/PYL receptor protein and/or mutated PP2C protein (Comai et al.. Plant Mol. Biol. 15:373 (1990)).
[0142] Other examples of constituti ve promoters include the Γ- or 2'- promoter deri ved from T-DNA of Agrobacterium tumafaciens (see, e.g., Mengiste (1997) supra; O'Grady (1995) Plant Mol. Biol. 29:99-108); actin promoters, such as the Arabidopsis actin gene promoter (see, e.g., Huang ( 1997) Plant Mol. Biol. 1997 33: 125-139); alcohol dehydrogenase (Adh) gene promoters (see, e.g. , Millar (1996) Plant Mol. Biol. 31:897-904); ACT 11 from Arabidopsis (Huang et al. Plant Mol. Biol. 33 : 125-139 (1996)), Cat 3 from Arabidopsis (GenBank No . U43147, Zhong et al. , Mol. Gen. Genet. 251 : 196-203 ( 1996)), the gene encoding stearoyl-acyl carrier protein desaturase from Brassica napiis (Genbank No.
X74782, Solocom.be et al. Plant Physiol. 104: 1167-1176 (1994)), GPcl from maize
(GenBank No. X15596, Martmez et al. J. Mol. Biol 208:551-565 (1989)), Gpc2 from maize (GenBank No. U45855, Manjunath et al.. Plant Mol. Biol. 33:97-112 (1997)), other transcription initiation regions from various plant genes known to those of skill. See also Holtorf Plant Mol. Biol. 29:637-646 (1995).
Inducible promoters
[0143] Alternatively, a promoter may direct expression of the mutated PYR/PYL polynucleotide and/or mutated PP2C polynucleotide under the influence of changing environmental conditions or developmental conditions. Examples of environmental conditions that may effect transcription by inducible promoters include anaerobic conditions, elevated temperature, drought, or the presence of light. Such promoters are referred to herein as "inducible" promoters. For example, the invention can incorporate a drought-specific promoter such as a drought-inducible promoter of maize (e.g., the maize rab!7 drought- inducible promoter (Vilardell et al . (1991) Plant Mol. Biol. 17:985-993; Vilardell et al. (1994) Plant Mol. Biol. 24:561 -569)); or alternatively a cold, drought, and high salt inducible promoter from potato (Kirch (1997) Plant Mol. Biol. 33:897-909).
[0144] Alternatively, promoters which are inducible upon exposure to plant hormones, such as auxins, can be used to express the mutated PYR/PYL polynucleotide and/or mutated PP2C polynucleotide. For example, the invention can use the auxin-response elements El promoter fragment (AuxREs) in the soybean (Glycine max L.) (Liu (1997) Plant Physiol. 1 15:397-407); the auxin-responsive Arabidopsis GST6 promoter (also responsive to salicylic acid and hydrogen peroxide) (Chen (1996) Plant J. 10: 955-966); the auxin-inducibie parC promoter from tobacco (Sakai (1996) 37:906-913); a plant biotin response element (Streit (1997) Mol. Plant Microbe Interact. 10:933-937); and, the promoter responsive to the stress hormone abscisic acid (Sheen (1996) Science 274: 1900-1902). [0145] Plant promoters inducible upon exposure to chemicals reagents that may be applied to the plant, such as herbicides or antibiotics, are also useful for expressing the mutated PYR/PYL polynucleotide. For example, the maize Iii2-2 promoter, activated by
benzenesulfonamide herbicide safeners, can be used (De Veylder (1997) Plant Cell Physiol. 38:568-577); application of different herbicide safeners induces distinct gene expression patterns, including expression in the root, hydathodes, and the shoot apical meristem. A PYR/PYL and/or PP2C coding sequence can also be under the control of, e.g. , a
tetracycline-inducible promoter, e.g., as described with transgenic tobacco plants containing the Avena sativa L. (oat) arginine decarboxylase gene (Masgrau (1997) Plant J. 11 :465-473); or, a salicylic acid-responsive element (Stange (1997) Plant J. 11 : 1315-1324; Uknes et al., Plant Cell 5: 159-169 (1993); Bi et a\., Plant J. 8:235-245 (1995)).
[0146] Examples of useful inducible regulatory elements include copper-inducible regulatory elements (Mett et al., Proc. Natl. Acad. Sci. USA 90:4567-4571 (1993); Furst et al , Cell 55:705-717 (1988)); tetracycline and chlor-tetracycline-inducible regulatory elements (Gatz et al. , Plant J. 2:397-404 (1992); Roder et al., Mol. Gen. Genet. 243:32-38 (1994); Gatz, Meth. Cell Biol. 50:411-424 (1995)); ecdysone inducible regulatory elements (Chnstopherson et al., Proc. Natl. Acad. Sci. USA 89:6314-6318 (1992); Kreutzweiser et al, Ecotoxicol. Environ. Safety 28: 14-24 (1994)); heat shock inducible regulatory elements (Takahashi et al. Plant Physiol. 99:383-390 (1992); Yabe et al, Plant Cell Physiol. 35: 1207- 1219 ( 1994); Ueda et αί , Μοί. Gen. Genet. 250:533-539 (1996)); and lac operon elements, which are used in combination with a eonstitutively expressed lac repressor to confer, for example, IPTG-inducible expression (Wilde et al , EMBO J. 11: 1251-1259 (1992)), An inducible regulatory element useful in the transgenic plants of the invention also can be, for example, a nitrate-inducible promoter derived from the spinach nitrite reductase gene (Back et al, Plant Mol. Biol. 17:9 (1991)) or a light-inducible promoter, such as that associated with tlie small subunit of RuBP carboxylase or the LHCP gene families (Feinbaum et al., Mol. Gen. Genet. 226:449 (1991 ); Larn and Chua, Science 248:471 ( 1990)). Tissue-specific promoters
[0147] Alternatively, the promoter may direct expression of the mutated PYK/PYL polynucleotide and/or mutated PP2C polynucleotide in a specific tissue (tissue-specific promoters). Tissue specific promoters are transcriptional control elements that are only active in particular cells or tissues at specific times during plant development, such as in vegetative tissues or reproductive tissues.
[0148] Examples of tissue-specific promoters under developmental control include promoters that initiate transcription only (or primarily only) in certain tissues, such as vegetative tissues, e.g. , roots or leaves, or reproductive tissues, such as fruit, ovules, seeds, pollen, pistols, flowers, or any embryonic tissue, or epidermis or mesophyll. Reproductive tissue-specific promoters may be, e.g. , ovule-specific, embryo-specific, endosperm-specific, integument-specific, seed and seed coat-specific, pollen-specific, petal-specific, sepal- specific, or some combination thereof. In some embodiments, the promoter is cell -type specific, e.g., guard cell-specific.
[0149] Other tissue-specific promoters include seed promoters. Suitable seed-specific promoters are derived from the following genes: MAC I from maize (Sheridan (1996)
Genetics 142: 1009-1020); Cat3 from maize (GenBank No. L05934, Abler {1993) Plant Mol.
Biol. 22: 10131-1038): vivparous-1 from Arabidopsis (Genbank No. U93215); atmycl from
Arabidopsis (Urao ( 1996) Plant Mol. Biol. 32:571 -57; Conceicao (1994) Plant 5:493-505); napA from Brasswa nanus (GenBank No. J02798, Josefsson (1987) JBL 26: 12196-1301); and the napm gene family from Brassica napus (Sjodahi (1995) Plania 197:264-271).
[0150] A variety of promoters specifically active in vegetative tissues, such as leaves, stems, roots and tubers, can also be used. For example, promoters controlling patatin, the major storage protein of the potato tuber, can be used, see, e.g., Kim (1994) Plant Mol. Biol. 26:603-615; Martin (1997) Plant J. 11 :53-62. The ORF13 promoter from Agrobactenum rhizogenes that exhibits high activity in roots can also be used (Hansen (1 97) Λίο/, Gen. Genet. 254:337-343. Other useful vegetative tissue-specific promoters include: the tarin promoter of the gene encoding a globulin from a major taro (Colocasia esculenta L. Schott) corm protein family, tarin (Bezerra (1995) Plant Mol. Biol. 28: 137-144): the curculin promoter active during taro conn development (de Castro (1992) Plant Cell 4: 1549-1559) and the promoter for the tobacco root-specific gene TobRB7, whose expression is localized to root meristem and immature central cylinder regions (Yamamoto (1991) Plant Cell
3:371-382).
[0151] Leaf-specific promoters, such as the ribulose biphosphate carboxylase (RBCS) promoters can be used. For example, the tomato RBCS1, RBCS2 and RBCS3A genes are expressed in leaves and light-grown seedlings, only RBCS 1 and RBCS2 are expressed in developing tomato fruits (Meier (1997) FEBSLett. 415:91-95). A ribulose bisphosphate carboxy lase promoters expressed almost exclusively in mesophyli cells in leaf blades and leaf sheaths at high levels, described by Matsuoka (1994) Plant J. 6:311-319, can be used.
Another leaf-specific promoter is the light harvesting chlorophyll a/b binding protein gene promoter, see, e.g. , Shiina (1997) Plant Physiol. 115:477-483: Casal (1998) Plant Physiol. 116: 1533-1538. The Arahidopsis thaliana myb-related gene promoter (AtmybS) described by Li (1996) FEBSLett. 379: 117-121, is leaf-specific. The AtmybS promoter is expressed in developing leaf trichomes, stipules, and epidermal cells on the margins of young rosette and cauline leaves, and in immature seeds. Atmyb5 mRNA appears between fertilization and the 16 cell stage of embryo development and persists beyond the heart stage. A leaf promoter identified in maize by Busk (1997) Plant J. 11 : 1285-1295, can also be used. [0152] Another class of useful vegetative tissue-specific promoters are meristematic (root tip and shoot apex) promoters. For example, the " ' SliOOTMERISTEMLESS" and
"SCARECROW promoters, which are active in the developing shoot or root apical meristems, described by Di Laurenzio (1996) Cell 86:423-433; and, Long (1996) Nature 379:66-69; can be used. Another useful promoter is that which controls the expression of 3-hydroxy-3- methylglutary! coenzyme A reductase HMG2 gene, whose expression is restricted to meristematic and floral (secretoiy zone of the stigma, mature pollen grains, gynoecium vascular tissue, and fertilized ovules) tissues (see, e.g. , Enjuto (1995) Plant Cell. 7:517-527). Also useful are knl -related genes from maize and other species which show meristem-specific expression, see, e.g. , Granger (1996) Plant Mol. Biol. 31 :373-378;
Kerstetter (1994) Plant Cell 6: 1877-1887; Hake (1995) Philos. Trans. R. Soc. Lond. B. Biol. Set 350:45-51 , For example, the Arabidopsis thaliana KNATl promoter (see, e.g. , Lincoln (1994) Plant Cell 6: 1859- 876). [0153] One of skill in the art of skill will recognize that a tissue-specific promoter may drive expression of operably linked sequences in tissues other than the target tissue. Thus, as used herein a tissue-specific promoter is one that drives expression preferentially in the target tissue, but may also lead to some expression in other tissues as well.
[0154] In another embodiment, the mutated PYR/PYL polynucleotide and/or mutated PP2C polynucleotide is expressed through a transposabie element. This allows for constitutive, yet periodic and infrequent expression of the constitutively active polypeptide.
The invention also provides for use of tissue-specific promoters derived from viruses including, e.g., the tobamovirus subgenomic promoter (Kurnagai (1995) Proc. Natl. Acad.
Sci. USA 92: 1679-1683; the rice tungro baciiiiform virus (RTBV), which replicates only in phloem cells in infected rice plants, with its promoter which drives strong phloem-specific reporter gene expression; the cassava vein mosaic virus (CVMV) promoter, with highest activity in vascular elements, in leaf mesophyii cells, and in root tips (Verdaguer (1996) Plant
Mol. Biol. 31 : 1129-1139).
VIII. Production of Transgenic Cells and Plants
[0155] As detailed herein, embodiments of the present invention provide for transgenic cells (e.g., plant, animal, mammalian, bacterial, or fungal cells) or plants comprising recombinant expression cassettes for expressing a mutant PYR/PYL receptor protein and a mutant PP2C protein as described herein. In some embodiments, a transgenic plant or cell is generated that contains a complete or partial sequence of a polynucleotide that is derived from a species other than the species of the transgenic plant or cell. It should be recognized that transgenic plants encompass the plant or plant cell in which the expression cassette is introduced as well as progeny of such plants or plant cells that contain the expression cassette, including the progeny that have the expression cassette stably integrated in a chromosome. [0156] Recombinant expression vectors comprising a PYR/PYL coding sequence and/or a PP2C coding sequence driven by a heterologous promoter may be introduced into the genome of the desired host (e.g., cell or plant host) by a variety of conventional techniques. For example, the DNA construct may be introduced directly into the genomic DNA of the plant cell using techniques such as electroporation and microinjection of plant ceil protoplasts, or the D A construct can be introduced directly to plant tissue using ballistic methods, such as DNA particle bombardment. Alternatively, the DNA construct may be combined with suitable T-DNA flanking regions and introduced into a conventional Agrohacterium tumefaciens host vector. The virulence functions of the Agrohacterium tumefaciens host will direct the insertion of the construct and adjacent marker into the plant cell DNA when the cell is infected by the bacteria. While transient expression of mutated PYR/PYL or mutated PP2C is encompassed by the invention, generally expression of construction of the invention will be from, insertion of expression cassettes into the plant genome, e.g., such that at least some plant offspring also contain the integrated expression cassette.
[0157] Microinjection techniques are also useful for this purpose. These techniques are well known in the art and thoroughly described in the literature. The introduction of DNA constructs using polyethylene glycol precipitation is described in Paszkowski et al. EMBO J. 3:2717-2722 (1984). Electroporation techniques are described in Fromm et al. Proc. Natl. Acad. Sci. USA. 82:5824 (1985). Ballistic tra sformation techniques are described in Klein et ai Nature 327:70-73 (1987).
[0158] Agrohacterium turn e facie ns-m &ialed transformation techniques, including disarming and use of binary vectors, are well described in the scientific literature. See, for example, Horsch et al. Science 233:496-498 (1984), and Fraley et al. Proc. Natl. Acad. Sci. USA 80:4803 (1983),
[0159] Transformed plant cells derived by any of the above transformation techniques can be cultured to regenerate a whole plant that possesses the transformed genotype and thus the desired phenotype such as enhanced abiotic stress resistance. Such regeneration techniques rely on manipulation of certain phytohormones in a tissue culture growth medium, typically- relying on a biocide and/or herbicide marker which has been introduced together with the desired nucleotide sequences. Plant regeneration from cultured protoplasts is described in Evans et al.. Protoplasts Isolation and Culture, Handbook of Plant Cell Culture, pp. 124-1 76, MacMillilan Publishing Company, New York, 1983; and Binding, Regeneration of Plants, Plant Protoplasts, pp. 21-73, CRC Press, Boca Raton, 1985. Regeneration can also be obtained from plant callus, explants, organs, or parts thereof. Such regeneration techniques are described generally in Klee et al. Ann, Rev. of Plant Phys. 38:467-486 (1987).
[0160] One of skill in the art will recognize that after the expression cassette is stably incorporated in transgenic plants and confirmed to be operable, it can be introduced into other plants by sexual crossing. Any of a number of standard breeding techniques can be used, depending upon the species to be crossed.
[0161] The expression cassettes of the invention can be expressed in a broad range of cells, such as plant, animal, mammalian, bacterial, or fungal cells. In some embodiments, the cells are eukaryotic cells, including but not limited to fungal cells, algal cells, insect cells, mammalian cells, or plant cells. In some embodiments, the cells are bacterial cells. In some embodiments, the cells are yeast cells. In som embodiments, the cells are plant cells. In some embodiments, the cells are mammalian cells.
[0162] The expression cassettes of the invention can also be used over a broad range of plants, including species from the genera Asparagus, Atropa, Avena, Brassica, Citrus, Citrullus, Capsicum, Cucumis, Cucurhita, Daucus, Fragaria, Glycine, Gossypium,
Hehanthus, Heterocallis, Hordeum, Hyoscyamus, Lactuca, Linum, Lolium, Lycopersicon, Mains, Manihot, Majorana, Medicago, Nicotiana, Oryza, Panieum, Pannesetum, Persea, Pisum, Pyrus, Primus, Raphanus, Secale, Senecio, Sinapis, Solarium, Sorghum, Trigonella, Triticum, Vitis. Vigna, and, Zea. In some embodiments, the plant is selected from the group consisting of rice, maize, wheat, soybeans, cotton, canola, turfgrass, and alfalfa. In some embodiments, the plant is an ornamental plant. In some embodiment, the plant is a vegetable- or fruit-producing plant. In some embodiments, the plant is Arabidopsis.
[0163] Those of skill in the art will recognize that a number of plant species can be used as models to predict the phenotypic effects of transgene expression in other plants. For example, it is well recognized that both tobacco (Nicotiana) and Arabidopsis plants are useful models of transgene expression, particularly in other dicots.
[0164] In some embodiments, for a transgenic plant or cell as described herein, expression of a desired gene, protein, or phenotype can be regulated by contacting the plant or cell with an orthogonal ligand (e.g., an agrochemical such as mandipropamid). For example, in some embodiments, the transgenic plant or cell comprises a first polynucleotide encoding a first polypeptide comprising a mutated PYR/PYL receptor polypeptide fused to one of a transcriptional activation domain or a DNA binding domain, and a second polynucleotide encoding a second polypeptide comprising a mutated PP2C fused to the other of a transcriptional acti vation domain or a DNA binding domain, under the control of a promoter that comprises a polynucleotide sequence that binds the DN A binding domain. In some embodiments, contacting the plant or cell with the orthogonal gand (e.g., mandipropamid) activates an interaction between the mutated PYR/PYL and the mutated PP2C, thereby associating the DN A binding domain and the transcriptional activation domain and activating transcription of a target gene.
[0165] In some embodiments, methods of controlling gene, protein, or phenotype expression in a transgenic cell or plant as described herein are provided. In some embodiments, the method comprises: contacting the transgenic cell or plant with an orthogonal ligand, wherein the step of contacting the cell or plant with the orthogonal ligand activates an interaction between tlie mutated PYR/PYL and the mutated PP2C, thereby associating the DNA binding domain and the transcriptional activation domain and activating transcription of a target gene. [0166] Those of skill in the art will recognize that the PYR/PYL-PP2C interaction modules described herein can be used for regulating the expression of any desired gene, protein, or phenotype of interest. In some embodiments, the mutated PYR/PYL proteins, mutated PP2C proteins, PYR/PYL-PP2C interaction modules, expression cassettes, and/or expression vectors described herein can be used for regulating the expression of a gene, protein, or phenotype relating to cell growth, development, metabolism, cell structure or architecture, stress response, or cell signaling. In some embodiments, the mutated PYR/PYL proteins, mutated PP2C proteins, PYR/PYL-PP2C interaction modules, expression cassettes, and/or expression vectors described herein can be used for regulating a phenotype relating to plant growth (e.g., growth rate or size), yield (e.g., biomass yield or seed yield), plant development (e.g., shoot development, root development, vegetative development, reproductive development, stem elongation, flowering, pattern formation, differentiation, senescence, or time of flowering), plant architecture (e.g., shape, size, color, texture, or patterning), stress tolerance (e.g., environmental stress such as salinity, drought, heat, chilling, freezing, dehydration, flooding, anaerobic stress, aerobic stress, osmotic stress, temperature stress, pollutant, or pathogen-induced stress), or metabolism. In some embodiments, the mutated
PYR/PYL proteins, mutated PP2C proteins, PYR/PYL-PP2C interaction modules, expression cassettes, and/or expression vectors described herein can be used for regulating the expression of a particular gene or protein of interest.
EXAMPLES [0167] The following examples are offered to illustrate, but not to limit, the claimed invention.
Example I: Generation and Characterization of an Orthogonal PYR1/HAB1 Response Module
[0168] The plant abscisic acid (ABA) response module has been coopted to build a CIP system controlled by ABA, which is a non-toxic dietary metabolite (Liang, Ho, & Crabtree, 2011). ABA is perceived by the soluble receptor PYRl (Pyrahactin Resistance 1), and related PY R l -l ike (PYL) ABA receptors (Cutler, Rodriguez, Finkelstein, & Abrams, 2010). These proteins indirectly control the activity of a subfamily of three Sucrose non-fermenting 1 -related (SnR 2) protein kinases in response to drought and other environmental stresses. The SnRK2s autoactivate by cis- and trans-autophosphorylation on their activation loops, but are continuously inactivated by clade A type 2,C protein phosphatases (PP2Cs), which results in low basal kinase activity(Ng et al, 201 1 ; Soon et a! ,, 2012). When ABA rises during stress it binds to PYRl and PYRl-like (PYL) receptors and stabilizes their activated conformations, enabling them, to bind to and inhibit the PP2Cs (Ma et al., 2009; Melcher et al., 2009;
Miyazono et al, 2009; S.-Y. Park et al., 2009; Yin et al, 2009), This in turn allows accumulation of activated SnR 2 kinases, which triggers downstream signaling events. ABA's ability to stabilize a complex between ABA receptors and PP2Cs has been exploited to create a new CID module regulated by ABA, as have other plant hormones and their perception systems. [0169] Although valuable, plant hormones are not well-suited for use in plants as ligands for CID. In this invention we describe mutant proteins that enable CID to be controlled using the agrochemical mandipropamid. The system is based on a modified ABA response module that has the following properties: (I) the receptor contains mutations that enable it to bind mandipropamid, (2) the mutant receptor and phosphatase contain mutations that disrupt their interactions with endogenous ABA signaling components and (3) the PP2C contains a combination of mutations that remove its intrinsic phosphatase activity and enhance its binding affinity for the receptor. This new system, can be used to engineer crops in which a desired protein function / phenotype is regulated agrochemically. Due to the broad range of regulatory functions that can be controlled by CID, the agrochemical induced dimerization module described can be used to engineer many different types control systems analogously to other CID systems, Construction of an orthogonal PYR1/HAB1 response module
[0170] The PYRl/HABl interaction enables ABA-regulated CIP, but is not appropriate for use in plants. We therefore set out to engineer an orthogonal response module, denoted PYRl ' / HAB:, that is insulated from the endogenous ABA signaling pathway. To reach this engineering target we took the following strategy: we first used site saturation mutagenesis of both PYRl and HAB1 , followed by functional assays of the mutant proteins, to
systematically identify disniptive binding-interface mutants. Specific combinations of "dead" alleles that could function together were then identified by co-transforming both set of mutants into S. cerevisiae strains and selecting for mutually suppressing mutant
combinations. The best mutant pair identified (PYRl r i6 D HAB1 Vl9jR) introduces an acid/base residue pair in close proximity that likely form a salt bridge that stabilizes the mutant PYR1 !/HAB1 ! interaction but destabilizes both PYRl vHABl and PYR1/HAB11 interactions.
Use of site saturation mutagenesis to identify mutations in PYRl that disrupt its interaction with HAB1
[0171] To systematically identify mutations in PY'Rl that disrupt its binding to HAB1, we utilized a collection of saturating mutations that contain all possible single amino acid substitutions in 24 conserved interface residues involved in binding HAB1 , which was previously constructed for the purpose of engineering constitutively active ABA receptor variants (Mosquna et al., 201 1). The interface residues previously mutagenized in this collection are the following: H60, F61, 162, K63, 184, S85, G86, L87, P88, A89, HI 15, Rl 16, LI 17, P148, G 150, N151, D154, D 155, T156, M158, F159, T162, 1,166, K 170. This set was made by mutagenizing a pBD-PYRl template that encodes a GAL4-DNA binding domain fusion to PYRl, which can be used to assess receptor -HAB 1 binding in S. cerevisiae strains co-transformed with pACT-HABl, which expresses a GAL4 activation domain fusion to HAB1 . Mutant pBD-PYRl clones from the collection are maintained in S. cerevisiae strain Y190 co-transformed with pACT-HABl . The test strains were spotted onto agar plates containing synthetic dextrose dropout media lacking leucine and tryptophan [SD (-Leu, - Tip)] medium supplemented with 10 μΜ ABA. After incubating the test plates at 30°C for two days, colonies were chloroform lysed and stained to reveal β-galactosidase expression levels and "dead" mutants w ere defined by lack of visible staining in comparison to a wild type control. This effort defined 237 mutations that disrupt ABA-induced binding of PYRl to HABl (Table 1), Premade yeast drop out supplements (Clontech) were utilized in this and other examples for media preparation, amino acids and other standard chemicals were purchased from Sigma- Aldrich (USA). The naturally occurring )-ABA isomer was used in all experiments and purchased from Biosynth Ag (Switzerland).
Table L Mutations in PYRl that disrapt ABA-induced binding to PYRl to HABl
Figure imgf000059_0001
Use of site saturation mutagenesis of HABl to identify mutations that disrupt its interaction with PYRl
[0172] To systematically define mutations in HAB l that disrupt its binding to PYRl , we used site saturation mutagenesis to create a collection all possible single ammo acid substitutions in 20 residues lining the PYRl binding interface, and then assayed the ability of each mutant to bind PYRl using the yeast two hybrid assay described above. We targeted the following residues for mutagenesis: R199, S200, E201, E203, H245, G246, G247, S322, E323, T324, K381, 1383, Q384, VV385, Q386, R389, F391, G392, V393, and Y404. To create the collection of mutations, mutagenic ΊΝΝΚ" site directed mutagenesis primers were synthesized for each of the 20 positions and the primers used in QuickChange site-directed mutagenesis reactions using a previously described pACT-HABl template (Park et al., 2009). We note that this clone uses a HAB1 cDNA lacking its three N-terminal amino acids. The reaction products were digested with Dpnl, and transformed into competent Escherichia colt DH5cx cells and plasrnid DNA for 96 colonies per site was isolated using Bioneer AccuPrep® Plasmid Mini Extraction Kit (Alameda, CA) and sequenced to identify mutants. This process identified most of the 19 desired mutations per target site; the remaining mutations were constructed directly using specific mutagenic primers. To interrogate the effects of the mutations on PYRl-HABl interactions, the mutant clones were individually transfoimed into S. cerevisiae strain Y190 containing pBD-PYRl (Park et al., 2009). Yeast transformants were selected for the presence of plasmids on selective SD (-Leu,-Trp) plates and then spotted onto SD (-Leu,-Trp) agar plates supplemented with 10 μΜ ABA . After incubating the test plates at 30°C for two days, the colonies were lysed with chloroform and stained to reveal β- galactosidase expression levels. "Dead" mutants were defined by lack of detectable staining in comparison to a wild type pBD-PYRl/pACT-HABl control. This screening effort defined 163 mutations that disrupt the ABA-induced PYR1 / HAB 1 interaction (Table 2). Table 2. Mutations in HAB1 that disrupt HAB1 interaction with PYR1
A C D E F G H I L P Q S T V W Y
Figure imgf000060_0001
Selection for mutually suppressing PYRl-dead/HABl-dead mutant alleles
[0173] The preceding efforts identified sets of interface "dead" mutations in both PYR1 and HAB 1 that in isolation prevent the PYR1/HAB1 complex forming in response to ABA. We next attempted to identify mutually suppressing mutant pairs (i.e. pairs of allele specific suppressors). To do so, a pool of mini-prepped plasrnid DNAs for non-functional pACT- HABl-dead mutants was prepared and transformed into the S. cerevisiae strain Y190, yielding -3200 colonies. The -3200 yeast colonies were pooled and subsequently transformed with pooled pBD-PYRl-dead mutant piasmids, to generate a library of -400,000 yeast colonies containing random mutant combinations. The pooled cells were plated onto SD(-Leu,-Trp,-His, + 10 mM 3-ammotriazole, + 10 μΜ ABA) and positive, best-growing clones isolated and spotted onto both SD(-Leu,-Trp, -His) and SD(~Leu,~Trp, -His, +10 μΜ ABA) plates, grown for 2 days growth at 30°C, and stained for β-galactosidase activity after chloroform lysis. This identified 7 pairs of ABA-dependent interacting mutants (Table 3), the strongest of which (PYR1 ' HAB1 " '* ) showed an interaction strength -4-fold less sensitive to ABA than wild type pBD-PYRl/pACT-HAB l control cells (Figure 1). This orthogonal PYRl I l62D / HAB 1 J93R mutant pair was selected for subsequent engineering and denoted PYR11 and HAB1 !.
Table 3. Mutually suppressing PYR1 and HAB1 mutant pairs
Figure imgf000061_0001
Biochemical characterization of PYR1! and HAB1! interaction
[0174] In the presence of ABA, wild type PYR1 binds to HAB1 and docks into its active site, which inhibits its enzymatic activity by blocking access of substrates. To characterize the orthogonal PYR1 ! and HAB 1 ! interaction biochemically, we produced recombinant forms of each protein in E. coli, along with the wild type form, and tested the wild type and orthogonal mutant for their ability to inhibit HABl and ΗΑΒ Γ activities in vitro. We cloned PYRl' into pET28 to generate 6x-His tagged receptor and cloned HABl 1 into pGEX-4T-l to create a GST-fusion protein. The previously constructed (S.-Y. Park et aL, 2009} wild type 6x-His-PYRl and GST-HABl constructs were used for producing recombinant wild type proteins. The 6x-His-tagged receptors and GST-tagged PP2Cs were expressed and purified as previously described. Briefly, the proteins were expressed in BL21 [DE3]pLysS E. coli host cells at 18°C overnight. Fusion proteins were purified from sonicated lysates using Ni- NTA agarose (Qiagen, USA) or Pierce™ Glutathione Agarose (Thermo Scientific) according to the manufacturer's instructions. PP2C assays were conducted in 96-weii polystyrene flat- bottom microtitre plates (Greiner). Assays were conducted using the following assay conditions: 100 nM 6x-His-PYRl or 6x-His-PYRl !, 50 nM GST-HAB l or 50 nM GST- HABl/, 100 mM I ris ! K i (pH 7.9), 100 mM NaCl, 1 mM nCl2, 1% β-mercaptoethanol (β- me) and 0.3% bovine serum albumin (BSA). Reactions were mixed with ABA,
mandipropamid, or mock dimethylsulphoxide (DMSO) carrier solvent, equilibrated for 30 minutes, after which 4-methylumbeliferyl phosphate was added (1 mM final concentration). The plates were read using a Victor 2 plate reader (PerkinEimer) (355 nm excitation, 460 nrn emission) and assays am in triplicate. The PP2C activity values reported are expressed as percent control values, which were calculated by including the carrier solvent (1 % DMSO) and the specific receptor assayed, but no ligand. We note that the recombinant GST-HABl1 had -50% activity per mg protein in comparison to GST-HAB 1. As the data in Figure 2 show, PYRl 1 does not strongly inhibit ΗΛΒ ! in response to ABA. Therefore, the physical interaction indicated by yeast two hybrid assays does not correlate with strong inhibition HABT's phosphatase activity in vitro. This suggests that PYRl ' binds to HAB l1 in a different orientation than the wild type PYRl / HAB l interaction. Example 2 - Engineering a sensitive orthogonal mandipropamid response module
[0175] Having generated an orthogonal PYRl1 / HABl ' ABA-response module, we next set out to build a mandipropamid responsive orthogonal interaction module insulated from the endogenous ABA signaling pathway. Although the interaction of PYRl' / HABl 1 is orthogonal, HAB 11 may still interact with downstream. SnRK2 kinases and alter ABA responses in planta. It has previously been shown that the HABl / SnRK2.6 interaction is stabilized by two modular interactions, one between HABl 's C-terminal basic domain and an SnRK2 "ABA-box" motif, and a second between HABl's active site and the SnRK2 kinase- domain (Soon et al., 2012). The formation of a stable HABl/SnRK2 complex in vitro can be abolished by the double mutant HABI VJ9JR/R5(bA, which disrupts both HABl/ABA-box and HABl/kinase-domain interactions (Soon et al., 2012). The V393R mutation is fortuitously present in HABI ', so we introduced R505A to pACT-ΗΑΒ using QuickChange mutagenesis, to create pACT-HABl1'2. This mutant protein should, in principle, affect ABA responses less than ΗΑΒ or HABI would irrplanta.
[0176] To engineer orthogonal mandipropamid responsiveness, we introduced the PYRi! mutation into the PYR] i ! ND! receptor to create a septuple mutant called PYRI !-M^ IDI
(PYR1Y58H;K59R;V81I;F108A;S!22G(F159L;T162D) ^ ^ HABI1 and HABM 111 response to low μΜ mandipropamid in yeast two-hybrid assays, but is ~ 100-fold less sensitive than the PYR lMANDi / HABI interaction, which responds to concentrations in the low nM range (Figure 3).
[0177] To improve sensitivity, we mutagenized ligand contacting and interface residues in PYRJ !-MANDI usmg isj jx rimerS; pooled the mutant libraries, and used the mutagenized receptors in selection experiments using to identify enhancer mutations. The NNK mutagenesis screen targeted the following residues: P55, H60, F61, 162, K63, V83, S85, G86, L87, P88, A89, S92, E94, 1110, HI 15, R116, LI 17, Y120, E141, P148, G150, N151, D154, D155, T156, M158, A160, V I 63. V164, 1.1 6. N167, and K170. This pilot screen established that Ml 581 and A160C increase mandipropamid sensitivity. Since Ml 58 and A 160 flank the F159V mutation present in PYR1MAND!, we inferred that the closely located orthogonalizmg T162D mutation in PYR1 !_MA DI may have reduced mandipropamid sensitivity by altering the local structure of the C-termmai a3 -helix, which participates in ligand -induced
conformational changes needed for PP2C binding (Nishimura et al., 2009). We therefore simultaneously mutagenized positions M158, F159 and A160 using a primer with degenerate NNK codons at all three positions. F159 was included in this mutagenesis because we have previously observed that multiple substitutions at F159 (A,C,i,L,M,T, or V) are permissive for mandipropamid responsiveness (S. Y. Park et al., n.d.), and sought to test whether residues oilier than leucine at position 159 might function better in the context of
simultaneous changes to both A160 and M158. The mutagenic primer was used in
QuickChange mutagenesis reactions using pBD-PYRl!_MAJ,<Dl template, and a library of ~12,000 clones was generated. Plasmid DNA for the librar' was prepared from pooled E. coli transformants, and subsequently transformed into S. cerevisiae strain MAV99 harboring pACT-HABl1"2. -20,000 yeast transformants were generated, pooled, and plated onto SD(- Leu,-Trp) agar media supplemented with 0.1% fluorotic acid (to select against mutants that interact in a ligand-independent fashion). The surviving cells were collected and plated onto SD(Leu,-Trp,-Ura) plates supplemented with 50 nM mandipropamid. The colonies displaying the best uracil-independent growth were isolated and retested on different mandipropam id concentrations and then stained in β-galactosidase assays to rank their relative strength. The most sensitive mutant obtained contained the following 9 mutations:
ργίι 1Υ58Η;Κ59Κ81,;Γ !08Α;8122α;ΜΪ58Ι;Ρ159ν;Α160ν;Τ162Β_ ^ refef fo ^ py R , s -VA >i
: 19; See also Figure 4). The mutants PYR i^SH;K59R;V81l;F108A;S122G;M158V;Fl59V;A160V;TI62B
(SEQ ID NO:20) and PYR1 V5«H^WIWIO8A;S1220^158^159V^60C(TI62D (SEQ ID N0 ; 2 ] ) A] SO supported nM responses to mandipropamid, but were slightly less sensitive than PYR1 *" Α ΰΐ ^e note t]iat PYRl*-MANDI weakly interacts with wild type HAB1 in yeast two hybrid assays, however as we show below, PYR }*"MA iD! does ΏΟχ inhibit HABl 's enzymatic activity in vitro, nor does it activate ABA responses in plan (a.
Example 3 - Engineering a analytically inactive orthogonal module
[0178] To investigate the effects of overexpressing HAB 1 in Arabidopsis, we used Agrobacterium mediated transformation to generate 35S: :GFP-HAB1 !""' transgenic plants. HAB 1 1-2 was cloned from pACT-ΗΑΒΓ"2 into pEGAD, a binary vector suitable for plant transformation, generating a 35S-driven GFP-HABl !_i fusion protein. The clone was transformed into Agrobacterium and the floral dip method used to transform Arabidopsis. After selection of To seed on soil containing glufosinate, several ΊΊ seedlings were identified. In spite of the V393R/R505A mutations present (previously reported to prevent SnRK2 binding), the Ί plants displayed symptoms of severe ABA insensitivity, including dwarf stature and high sensitivity to water deficit, and did not survive to produce T2 seed for subsequent analyses. These observations suggest that HAB 1!"2 retains ability to regulate ABA signaling factors in vivo, in spite of its reported inability to bind SnRK2s, although further characterization of the T; plants is needed to definitively establish this. As an alternate strategy, we eliminated HABl 's catalytic activity by introducing a mutation in a conserved metal-ion binding residue (D204), which is homologous to D131 A mutation in ABI1 , previously shown to eliminate phosphatase activity without disrupting wild type receptor- AB11 interactions (Liang et al., 2011). We used QuickChange mutagenesis to introduce the D204A mutation into pACT-HABF2, generating pACT-HABl ". When tested for mandipropamid induced interactions with pBD-PYRl*" ANDl, ΗΑΒ Γ' 3 is ~ 10-fold less sensitive to mandipropamid relative to ΗΑΒΓ'^ (Figure 5). [0179] D204 is located within HAB 1 's catalytic active site and binds to one of 3 catalytic Mg"1" ions that participate in catalysis. Although D204 does not make direct contacts with PYL receptors, the receptors dock into the active site. It is likely that disruptions to active site structure introduced by D204A destabilize the PYRl *_ ANDl / ΗΑΒΓ' 3 interaction relative to HAB 1 !~2. We reasoned that suppressor mutations in other HAB 1 interface or active site residues could restore sensitivity by strengthening interactions with pYRi*"MA Di χ0 identify such suppressors, we mutagenized the pACT-HAB l ''3 template using NNK mutagenesis in 28 residues located with at the PYRl binding interface. Hie residues targeted were: R199, S200, E201, E203, D243, G244, H245, G246, G247, S322, E323, T324, D346, K365, K381, 1383, Q384, W385, Q386, R389, F391, G392, Y404, S431, G433, D436, D492 and N394. The pACT-HAB 1 !"J template was mutagenized in 28 separate NNK mutagenesis reactions using the QuickChange protocol. Mini-libraries, each containing -1000 clones, were made for each NNK reaction and piasmid DNA for the 28 mutations prepared, pooled, and then transformed into 5'. cerevisiae strain MAV99 co-transformed with pBD-PYRl*": ' ^' ! , and then plated onto selective SD(-Leu,-Trp,-Ura) agar media supplemented with 500 nM mandipropamid. Three mutations in two separate residues were identified that enhance responsiveness of HAB 11-3 (S322D, S322E, and R199A). S322D and R199A were combined using the Lightning Multi-site Mutagenesis™ (Agilent, USA) method, and the resultant pen tuple mutant tested in combination with pBD-PYRl*_MANDI for sensitivity to
mandipropamid using β-galactosidase assays. We refer to the final catalytically inactive orthogonal pentuple mutant (HAB1R199A; D204A; S322D; V393R; R505A) as HAB1* (SEQ ID NO:31); this mutant displays nM sensitivity for binding to pBD-PYRl *"lVlANDl in yeast-two hybrid assays (Figure 6).
[0180] To characterize ΗΑΒ Γ' 3 and HAB 1 * in vitro, we cloned them into pGEX~4T-i to create GST-fusion proteins. Recombinant GST-HAB1, GST-HAB1 *, GST-HAB11"3 and GST-HAB1* were prepared from E. coti, as described above in example 1C, and used in phosphatase assays under the following conditions: 1 μ§; GST-HABl and mutants in a buffer containing, 100 mM Tris-HCl (pH 7.9), 100 mM NaCl, 1 mM MnCl2, 1 % β-mercaptoethanol and 0.3% bovine serum albumin (BSA); 4-methylumbeliferyl phosphate was added (1 mM final) and plates were read by fluorimetry. The PP2C activity values reported are expressed as percent control (GST-HAB I ) from triplicate measurements. Neither HAB 1 !"J or HAB i * display detectable catalytic activity in vitro, indicating that D204A abolishes catalytic activity as expected, and that the suppressors do not increase mandipropamid sensitivity by restoring catalytic activity (Figure 7).
Example 4 - Characterization of PYR1 *~MAj,VDl an [ HABl * interactions in vitro and in vivo [0181] To characterize the orthogonal orthogonal module biochemically, we produced recombinant forms of 6x-His-PYRl *"MANDi, 6x-His-PYRl, GST-HAB 1 *, and GST-HAB 1 in E. coli , as described above, and tested wild type and orthogonal receptors for their ability to inhibit GST-HAB 1 activity in vitro , as well as their physical interactions with one another using pull-down assays. To characterize PYR I *" ' ! and HABl* in vitro, we cloned PYR 1 *_1VlANDl into pET28 to generate a 6x-His tagged receptor and cloned HAB 1 * into pGEX-4T-l to create a GST-fusion protein. Recombinant 6x-FIis-PYRl *-MA DI an(j Qg j_ HABl* were prepared, as described above in example 1C, and used in experiments with previously prepared 6x-His-PYRl and GST-HAB 1. To conduct pull down assays, the specified recombinant receptor and PP2C (20 and 140 ^ig respectively), were combined in 500 μΐ PP2C assay buffer (100 mM Tris-HCi (pH 7.9), 100 mM NaCl, 1 mM MnC32, 1% β- ME and 0.3% BSA) containing either 10 μΜ ABA, 10 μΜ mandipropamid or 1 % DMSO earner solvent as a negative control . The final protein concentrations in the reactions are 1.6 μΜ receptor and 3.4 μΜ PP2C. The reactions were incubated for 90 minutes at room temperature (RT) and 20 μΐ of PrepEase (USB) His-tagged protein purification resin (20 mg) was added. The resin and reaction mixtures were incubated for 30 minutes at RT with gentle shaking at 5 minute intervals. The resin was washed five times and 100 μΐ of SDS- AGE buffer was added and boiled for 5 minutes. After centrifugation 20 μΐ of supernatant was analyzed by SDS-PAGE. The pull -down data, shown in Figure 8, demonstrate that HABl* does not bind to wild type PYR I in the presence of ABA or mandipropamid, however
i jn reSp0nse to mandipropamid, which is consistent
Figure imgf000066_0001
with previous yeast two hybrid results, which indicated binding, although with ~10-fold less sensitivity to mandipropamid than the orthogonal interaction (Figure 6). The pull-down reactions do not reveal obvious differences between the amount of HAB* or HAB l bound by PYRl* lANDl, however this is likely due to the relatively high protein (μΜ) concentrations in the binding reactions, which are in excess of the nM Kd values measured for ligand bound receptor-PP2C binding measured by surface plasmon resonance (Hao et a!., 2011).
[0182] According to our current understanding, in order for ABA signaling to be initiated in vivo, PP2C activity must be inhibited to enable accumulation of active SnRK2 kinases. It is therefore essential that PYR1*"M"NDI not inhibit HAB1 activity. To examine this, the recombinant 6x-His-PYRl*"MAND! and 6x-His-PYRl were tested for their ability to inhibit GST-HAB1 PP2C activity in vitro using the proteins prepared above, GST-HAB1 assays were conducted using the following assay conditions: 100 nM 6x-His-PYRl or 6x-His- 5 5 50 nM GST-HAB1, 100 mM Tris-HCl (pH 7.9), 100 mM NaCl, 1 mM MnCl2, 1% β-me and 0.3% BSA. Reactions were mixed with either differing concentrations of ABA, mandipropamid, or mock DMSO, 4-methylumbeliferyl phosphate was added (1 mM final concentration) was added to the reactions after 30 minutes equilibration and plates were read by fluorimetry. The PP2C activity values reported are expressed as percent control values,0 which was calculated by including the earner solvent (1% DMSO) and the specific receptor assayed, but no ligand. These data (Figure 9) demonstrate that although the PYR1*"^ND! can bind HAB1 in response to mandipropamid, pYRi *~MAND! does nol substantially inhibit wild type HAB1 enzymatic activity.
To characterize the orthogonal interaction in vivo, we conducted pull-down
5 experiments using proteins transiently expressed in N. benthamiana. In these experiments a 6X-His-Tagged GFP-PP2C construct is co-expressed with a GFP-PYR1 construct and the interaction of receptor and PP2C in response to different treatments examined by co- purification using immobilized metal ion affinity chromatography. For these experiments, we made 35 S-promoter driven 6x-His-GFP-HABl, 6x-His-GFP-HAB 1 * , GFP-PYRL and GFP-0 PYR1 *_ ANDi constructs in the binary- plant transformation vector pEGAD and transformed die constructs into Agrohacterhirn tiirnefaciens by electroporation. Overnight cultures were harvested by centrifugation and resuspended in infiltration medium containing 10 mM MES pH 5.6, 10 mM MgCl2 and 2 mM acetosyringone. Cultures of Agrobacterium strains expressing a receptor construct, a HAB1 construct and the silencing suppressor p 19 were5 mixed to final OD6ooS of 0.15, 0.5 and 0.25 in infiltration medium, and infiltrated in N.
benthamiana. The ratio of PP2C to receptor used compensates for reduced expression efficiency of the PP2C relative to receptor. Chemical applications of either 50 μΜ ABA, 50 μΜ mandipropamid or mock (0.1% DMSO, 0.05% Silwet in H20) were made 48 hours after infiltration, and tissue harvested 24 hours later. Harvested leaf tissues (~1 g) were ground in0 liquid N2 by mortar and pestle and extracted in 2 mL of a buffer containing 50 mM Tris-HCl pH 7,6, 150 mM NaCL 0.1% Nomdet-P40, 1 mM DTT, 1 X plant protease inhibitor mix (Sigma), and 10% glycerol. The crude extracts were centrifuged at 4500 rpm for 15 min, and 1.5 ml of supernatant were transferred into a 2 mi tube and 0.025g of PrepEase His-tagged protein purification resin (USB, OH USA) added. After 30 minutes incubation at 4 °C, the resm was collected by brief centnfugation and then washed 3 times with buffer containing 50 mM "fris~HG pi 17.6. 150 mM NaCl, and 0.1% Nonidet-P40. Protein were eluted from the beads by adding 100 \iL of SDS-PAGE sample buffer and boiling for 5 minutes. The eluted proteins were separated by SDS-PAGE and then electro-eluted onto nitrocellulose membranes. The proteins were then detected by Western blotting, using anti GFP primary antibody and anti-mouse IgG-HRP conjugated secondary antibody (GE Healthcare, UK) and detected after enhanced chemiluminescence ECL (PerkinElmer, MA USA). Example 5 - Overexpression of P¥Kl*~MAN ! and HAB1 * in Arabidopsis
[0184] To examine the effects of over-expressing either PY ] *"i ! ND! 0r HAB1* in Arabidopsis thaliana, we made 35S~dnven GFP-PYR1*"MANDI and GFP-HAB1* constructs by cloning the mutant genes into the binary vector pEGAD, and the resultant plasmids were transformed into Agrobacterium tiirnefacieris . The floral dip method was used to generate T0 transgenic seed for both constructs and the T0 seed was germinated in soil containing glufosinate to select for transgenic Tj plants. The PYR i *A| Vsiii l plants isolated were grown for ~5 weeks and then treated with mandipropamid, using comparisons to wild type Columbia plants and a previously constructed 35S::PYR1MAND1 transgenic strain as controls. The treated plants were thermographed 24 hours after chemical applications to examine leaf temperature, which increases after ABA responses are activated, due to reduced transpiration. To examine different mandipropamid concentrations, the plants were first treated with 1 μΜ mandipropamid and then 3 days later were treated again with 10 μΜ mandipropamid. Neither of the treatments elicited substantial alterations in leaf temperature in the 35S::GFP-PYR1*~ MA Di tranSgeniC plants, however the 35 S::PYR1MAND1 plants displayed a strong increase in leaf temperature 24 hours after treatment, consistent with the ability of this protein to bind to endogenous PP2Cs and activate ABA responses. These data are consistent with PYRI *"MAND! being suitably insulated from endogenous wild type signaling factors that it cannot activate ABA responses when activated (Figure 10).
[0185] Several Ί transgenic seed were propagated and 3 homozygous single insertion transgenic lines identified by glufosinate segregation patterns in the T3 seedlings. GFP-
PYRl*" lANDl protein levels were established by western blotting using an anti -GFP antibody, as described above and the three lines had similar levels of protein expression. Two of the 35S:::GFP-PYR1*"MAJ,<D' strains and a wild type Columbia control were treated with 25 μΜ ABA and imaged by thennographv 24 hours after treatment; these experiments reveal similar leaf temperatures between wild type and the two transgenics (Figure 10). Similarly, sibling plants of the same two transgenic Sines were treated with 5 μΜ mandipropamid, and the transgenic plants did not reveal differences in leaf temperature in comparison to the wild type control plants (Figure 1 1 ). Together with the experiments conducted on the Ti plants described above, the data suggest that the orthogonal receptor is insulated from the endogenous ABA response pathway.
[0186] The HAB 1* Tj were propagated and 4 homozygous single insertion transgenic lines identified by glufosinate segregation patterns in the T3 seedlings. GFP-HAB1* protein levels were established by western blotting using an anti-GFP antibody, as described above and two lines with high protein expression le vels were selected for further experimentation.
Overexpression of wild type HAB1 causes ABA insensitivity, which manifests itself in adult plants by drought sensitivity and reduced leaf temperature due to elevated rates of transpiration. The two transgenic lines were grown alongside wild type Columbia and the an allele oi'abil in the Columbia genetic background. The ABA-insensitive abil mutant possesses growth defects and reduced leaf temperature, as expected , and the transgenic GFP- HAB1 * plants show leaf temperatures similar to wild type plants, indicating that the GFP- HAB1* protein does not strongly impair guard cell ABA responses in plants and is insulated from the endogenous ABA response pathway (Figure 12).
Example 6— Agrochemical control of protein localization using the PY 1*" 4ND1 /HAB1 * interaction module
[0187] To es tablish if the orthogonal mandipropamid response module could be used to control protein localization and / or transcriptional responses in vivo, we designed an experimental system where PYR1 *_MAND! was localized to the nucleus and a GFP-HAB 1* fusion protein was sequestered to the cytosol, which was accomplished using nuclear localization or export sequences. The desired outcome of this configuration is that the subcellular localization of a cvtosoiic GFP-HAB 1 * fusion protein shifts towards a nuclear distribution in the presence of mandipropamid via its association with PYR1*"1 " ' " . If successful this could be used to be used to regulate the nuclear localization of transcription factors and / or other nuclear proteins such as CAS9 that require access to their DNA targets to control phenotypic outputs. [0188] The precedent for this logic is exemplified by the ligand controlled association of nuclear hormone receptors (NHRs) with cytoplasmic heat shock proteins (HSPs) as a means of controlling HR nuclear localization (Pratt, Galigniana, Harrell, & DeFranco, 2004). In the absence of agonists, many NHRs form sequestered cytosolic complexes with HSP70, but will dissociate and enter nuclei after ligand binding, which enables activation of target genes. Inducible transcription factors can be engineered by fusing to nuclear hormone receptors, which has been used to create numerous chemically inducible plant transcription factors, for example inducible flowering time using GR fusions to the transcriptional regulator Cons tans (Corbesier et ai., 2007) . Our CIP module can, in principle, be used to engineer similar types of regulation that are under control of an agrochemical and therefore suited for use in agricultural contexts.
[0189] To test this idea, we created a nuclear localized version of PYR J *"MA Di (SEQ ID NO:32) and a cytoplasmicaily localized GFP-HAB1*(SEQ ID NO:33), co-expressed the two components in N. henthamiaria, and subsequently examined the localization of GFP-HAB1* in response to mandipropamid using confocai microscopy . To accomplish this, we cloned PYRl*"MANDi into the yeast two hybrid vector pAD, generating a GAL4 activation domain fusion to PYRl *"lViAND\ The GAL4 activation domain present in pAD contains a synthetic SV40 nuclear localization signal (NLS) at its N-terminus. We used an AD fusion (as opposed to solely adding an NLS to PYR1*": ! ) so that the protein could also be tested in separate experiments for its ability to activate transcription as a split GAL4 system. The AD-PYR1 *" MA Di USj0n was men amplified by PGR and cloned under the control of the 35S promoter in pEGAD (replacing pEGAD's GFP), creating a construct named 35S: :nuc-PYRl*" A DI. We similarly cloned HAB 1* into the yeast two hybrid vector pBD to create a BD-HAB1 * fusion protein (SEQ ID NO:34). In creating BD-HAB1*, we introduced a synthetic 18 amino acid long Gly-Ser rich linker between BD and HAB 1 * and added two synthetic nuclear export sequences (NES) to HABl* 's C-terminus. The nuclear export sequences utilized were derived from previously described NESs (Haasen, Kohler, Neuhaus, & Merkle, 1999;
Ossovskaya, Lim, Ota, Schlaepfer, & Ilk, 2008). To generate this construct, HAB ! * was amplified from pACT-HAB 1 * by PGR using and cloned into pBD downstream of the GAL4 DBD. A Bsal site was introduced by site directed mutagenesis between BD and HAB1, at the same time an internal Bsal site was removed. An 14 amino acid long Gly-Ser rich linker flanked by Bsal sites was synthesized and cloned in between pBD and HAB 1* using GoldenGate assembly (Engler, Kandzia, & Mariiionnet, 2008). The synthetic fusion was then amplified from the resultant plasmid by PCR, using primers that appended 2 nuclear export sequences onto the C-terminus of HAB1. The PCR fragment obtained was cloned into pEGAD in-frame with and downstream of GFP, creating 35 S : :GFP-cyt-HAB 1 * .
[0190] To characterize these components, 35S::GFP-cyt-HABl* and 35S::nuc-PYRl*" : ! were transiently co-expressed in N. henthamiana, as described above, and plants treated with a mock or mandipropamid solution (Figure 13). Agrobacterium strains harboring 35S::GFP-cyt-HABl * and 35S::nuc-PYRl*"IwAOT>I were cultured overnight, centrifuged, and resuspended to a final ODeoo ;= 0.05 of each strain in an infiltration medium composed of 10 mM MES pH 5.6, 10 mM MgCb, and 2 mM acetosyringone. 48 hours after infiltration, plants were treated with either 50 μΜ mandipropamid or a mock treatment (0.1 % DMSO and 0.05% Silwet). 24 hours later 1 -2 leaf segments surrounding infiltration sites were excised and mounted in water for microscopy per treatment. The leaf tissue was scanned manually by epi -fluorescence to identify patches of GFP" cells and then observed by spinning disk confocal microscopy, collecting -10 micron deep sections that spanned the entire epidermal cell layer. The Z-series stacks were reconstructed by brightest-point projections in image J. Eight to ten GFP+ regions were imaged in this manner. Fluorescence imaging was done using a custom built spinning disk system (Solaxnere Technology, Inc) with a Yokagawa Wl spinning disk (Yokagawa), EM-CCD camera (Hamamatsu 9100c) and a Nikon Eclipse TE (Nikon) inverted stand. A 40X water immersion lens (1.15 N A) was used with perfiuorcarbon immersion liquid (RIAAA-678, Cargille). The microscope's stage is fully motorized and controlled by Micromanager software (www.micromanager.org) with ASI Peizo (300 mm range) and 3 axis DC servo motor controller. GFP was excited with a 445 nm light a solid- state laser (Obis from 40-100 mW) and a 480/40 emission filter (Chroma). All lasers are) and emission filters are from Chroma Technology.
Example 7 - Agrochemical control of transcription using the PYR1 *'ΜΑΛΰ1 / ' HAB1 * interaction module
[0191] To establish if the orthogonal mandipropamid response module could be used to control transcriptional responses in vivo, we designed an experimental system where PYR1 *' MAN01 was fUSed to the GAL4 AD, and HAB 1* fused to its BD. Nuclear export sequences were added to the BD-HAB 1* component to reduce its access to the nucleus in the absence of mandipropamid and thereby reduce background transcription from the UAS. The constructs were assembled into a plant transformation vector along with a GAL4-responsive UAS in front of a CaMV minimal promoter driving GFP. The plant transformation vector used was a derivative of pCB308 (Xiang, Han, Lutziger, Wang, & Oliver, 1999) in which a kanamycin resistance marker cassette replaces the vector's centrally located uidA and bar expression cassettes. To construct this derivative (called pCB301K), pCB308 was used as template in inverse PGR using primers internal to the T-DNA border sequences that exclude the uidA and bar genes. To the self ligated inverse PGR product Kanamycin resistance cassette which was amplified from pBI121 by PGR was added in the middle of multi cloning site to generate pCB308K.
[0192] To construct a vector containing all three components, we sequentially added AD- PYR 1 *-MANDi (SEQ 1D NO:32)s BD-HAB1* (SEQ ID NQ:34), and then a UAS::GFP cassette (SEQ ID NO:40) that would enable facile replacement with gene of interest. The AD-PYRI*" MA Di expressjon cassette was amplified by PGR from the 35 S : :nuc-PYRl *"MAilD1 construct described above and cloned into pCB301 , to create pCB308 -AD. [0193] To generate the BD-HAB 1 * construct, HAB 1 * was amplified from, p ACT-HAB 1 * by PGR and cloned into pBD downstream of the GAL4 DBD. A Bsal site was introduced by site directed mutagenesis between the BD and HAB1*, at the same time an internal Bsal site in the vector backbone was removed. A 14 amino acid long Gly-Ser rich linker flanked by Bsal sites was synthesized and cloned in between pBD and HAB ! * using GoldenGate assembly (Engler et aL 2008). The resultant plasmid was used as template to introduce Nes. To make BD-Nes-linker-H*-Nes, imker-H* was amplified by PGR using primers in which Nes sequence were added in both primers and per product was re-cloned to pBD in downstream of BD. BD-Nes-linker-H*-Nes was amplified by PGR and introduced to pEGAD by replacing GFP. The cassette was amplified and introduced pCB308K-AD to make pCB308K-AD_BD.
[0194] A UAS-35S minimal promoter was prepared by primer extension using synthetic oligonucleotides and cloned into pEGAD, replacing its 35S promoter so that GFP expression is controlled by the UAS. The cassette created was amplified from the resultant plasmid by PGR and cloned to pCB301K-AD BD between the activation domain and binding domain modules, yielding a final construct named pUAS GFP mandi.
[0195] The resultant construct (pUAS_GFP_mandi) was tested using transient assays in N benihamiana, as described above. Agrobacterium (strain GV3101), harboring binary vector containing pUAS GFP mandi was mixed with agrobacterium containing the p 19 suppressor in 0.05 OD600. Infiltrated leaves were treated 50 μΜ Mandipropamid or mock in 0.1% ( DMSO and 0.05% silwet) 24 hr after infiltration. 24 hours later, leaf tissue was collected, frozen in liquid N2, and homogenized by bead beating using Precellys instalment (Berlin Technologies), for 6000 rpm for 30 seconds and then resuspended in SDS sample buffer containing protease inhibitor, separated by SDS-PAGE, electro-blotted onto nitrocellulose membrane and detected using an anti-GFP antibody as described in Example 4 above. Figure 14 shows that the pUAS GFP mandi construct enables mandipropamid inducible GFP production.
Example 8— Agrochemical control of gene expression in Arabidopsis
[0196] To test the efficacy of our transcriptional circuit in planta, we constructed a 3 component system for inducing genes of interest using the mandipropamid mediated interaction of a BD-PYR1* / AD-HAB1* to drive genes of interest from a GAL4-responsive UAS (Figure 15A). To do this we constructed a BD~PYRl*"MA Di fusion protein and
NLSsv4o-VP64-HAB l*-N7 fusion protein and used these to drive gene expression from a synthetic UAS-minimal-35S promoter. To make the desired vector, the three required components were separately cloned into vectors that provided necessary elements (such as the Gal4 DNA binding domain, or 35S-promoter-nos-terminator cassettes). After this, the three components were combined into a plant binary transformation vector.
[0197] The BD-PYR1 * -MANDI fragment was create£j as follows. PYRl *"MAND! coding sequence was PCR amplified from plasmid DNA using primers that append Mfel sites and the PCR fragment digested and cloned into pBD-Ga34 (Clontech, USA) at its EcoRl site. The resultant BD-PYR1*"1 ! fusion protein was amplified using PCR primers that appended an XmaJ site on 5 '-end and a Bglll site on 3 '-end; the resultant fragment was cloned into pEGAD at its Age! and Barnlil sites (Cutler et al., 2000), eliminating pEGAD's GFP and multi-cloning site (MCS) locus, yielding pBD-PYRl*; this created a 35S::BD-PYR1*- Terrrinos cassette used in subsequent steps.
[0198] To create the NLSSV4o-VP64-HAB 1 * -N7 component, a synthetic VP64-activation domain linker was prepared by primer extension and cloned at the N-teiminus of HAB 1 * using GoldenGate assembly methods. The resultant VP64-HAB 1 * fragment was cloned to pAD-Gal4 (Clontech), adding an SV40 nuclear localization signal (NLS) to yield an NLS- VP64-HAB1* fragment with Xmal dXhoI sites on its 5'- and 3 '-ends respectively; this fragment was then cloned into pEGAD at its Agel and Xhol sites, which eliminated pEGAD's 35S-GFP unit; the resultant intermediary vector is called pVP64-HAB 1 * . To ensure strong nuclear localization, the plant N7 nuclear localization signal (Cutler et al, 2000; Peterson et al., 2016) was added to the protein. To do this, the N7 sequence was amplified by PGR using primers that appended Sail and Bglll sites at the 5"- and 3 '-ends respectively; this fragment was cloned into pVP64-HABl* at Xhol wd BamHI sites (downstream ofHABl*), yielding pVP64-HABl*-N7.
[0199] The GAL4 UAS component needed to dri ve expression of target genes was constructed as follows: a UAS-35S minimal promoter cassette was created by primer extension using synthetic oligonucleotides harboring multimerized GAL4 binding sequences and and a minimal 35S promoter (-46 from stast site) was cloned into pEGAD at its Sad and Agel sites, replacing pEGAD's 35S promoter; this resulted in an intermediary vectors called pUAS. [0200] To combine all three components into a single vector, a 35 S: :NLS-VP64-HAB 1 *- N7-Nos-terminator cassette was PCR amplified from pVP64-HAB 1 * -N7 and cloned into pBD-PYRl* into its Sacl site, upstream of the BD-PYR1* expression cassette, yielding pAD-BD. Next, the UAS:: :GFP-MCS-terminator cassette was amplified with primers that introduce Mfel sites on both ends, digested, and then cloned into pAD-BD between the 35S:NLS-VP64-HAB l *-N7-terminator and 35 S:BD-PYR1* -terminator components at an EcoRl site. The final vector, called pMANDI-GFP, has a centrally located MCS that can be used to insert genes of interest downstream of UAS: :GFP so that GFP-fusion proteins can be induced by mandipropamid. The T-DNA region of pMANDI-GFP is shown in Figure 15A. The sequence of the T-DNA region of p-MANDI-GFP is provided as SEQ ID NO: 126. [0201 ] Having developed a simple induction system, we tested it by examining the expression of the flowering regulator LEAFY. LEAFY cDNA was amplified by PCR and cloned into pMANDI-GFP at its EcoRI and BamHI sites ("pMANDl-UAS-GFP-LEAFY"; SEQ ID NO: 127). We introduced this construct into Arabidopsis by Agrobacterium mediated transformation using the floral dip method (Clough and Bent, 1998). To test expression, seedlings of Tl plants were identified and a leaf segment cut into two pieces, one of which was transferred to control MS-agar media, and the other transferred to MS-Agar media supplemented with 10 μΜ mandipropamid. 24 hours after transfer, both tissues were examined using a GFP fluorescence dissecting scope and documented under identical camera and microscope settings (Figure 15B). These data reveal GFP-LEAFY induction in response to mandipropamid and validate that the system works in planta.
[0202] We further set out to establish if the constructs performance could be tuned by altering the expression level of BD-PYR1*~MAND1 and/or by adding 5' -UTR elements to our UAS::GFP cassette. The Arabidopsis PEX4 gene (At5g25760) has a moderate expression level that is highly consistent across many environmental conditions (Czechowski et al., 2005): we therefore tested the effect of driving BD-PYRl !"MA JDi expression by the PEX4 promoter by swapping it with the 35 S promoter present in pMANDI-GFP. To do this, we first used PGR to amplify a BD-PYR .1 *"MANDi fragment from pBD-Ga!4-PYRl * ΙΛ Ι Ι and cloned it into pEGAD at Agel and BamHI sites, creating pBD-PYRl *-2, which has slightly different sites available than the pBD-PYRl* vector. To replace the 35 S promoter, we PGR amplified a PEX4 promoter fragment from genomic DNA that extended 887 base pairs upstream of PEX4's annotated start codon using primers containing Sad and Xma I sites; this fragment was cloned into the Sad and Agel sites of pBD-PYRl*-2, resulting in pPEX4-BD-PYRl* . To combine all three components into a single vector, a 35S: :NLS-VP64-HAB l*-N7-Nos- terminator cassette was PGR amplified from pVP64-HABl *-N7 and cloned pBD-PYRl *-2 into its Sad site, upstream of the PEX4::BD-PYR1* cassette, yielding pAD-PEX4-BD. Next, the UAS: ::GFP-MCS-terminator cassette was amplified with primers that introduce Mfel sites on both ends, digested, and then cloned into pAD-PEX4~BD between the 35S:NLS-VP64- H*-N7-terminator and PEX4: :BD-PYRl*-terminator components at an EcoRI site, yielding pPEX4-MANDl-GFP.
[0203] We then appended two different 5'-UTRs upstream of GFP in both pMANDI-GFP and pPEX4-MANDI-GFP. It has previously been observed that the omega sequence from tomato mosaic virus can both increase induction levels and reduce background expression in a copper-inducible promoter system (Saijo and Nagasawa, 2014); we therefore tested this 71 base pair element ("To71") in the 5'-UTR. In addition, we hypothesized that we might impro ve induction/background ratios by exploiting UTRs from genes that naturally possess a low basal expression level but are highly induced in response to an external signal. We, therefore, tested the 5*-UTR of MAPKKK 18 (Atl G05100), a gene that is highly mduced by ABA, but otherwise has very low basal induction levels (Okamoto et al., 2013). To do this, the MAPKKK 18 (69 bp) and ΊΌ71 (71 bp) 5 '-UTRs were prepared by primer extension using synthetic oligonucleotides that appended Xmal and Agel sites at the ends; the resultant fragments were cloned into the Agel site of pEGAD-UAS; the two resultant UAS: :UTR-GFP cassettes were cloned into both pAD-BD and pAD-PEX4-BD to generate pMANDI-GFP and pPEX4-MANDI-GFP deri vatives with either the MAPKKK18 or ΊΌ71 5'-UTRs preceding GFP, To investigate the effects of these alterations, the parent and resultant constructs were transformed into Agrobacterium (strain GV3101) and coinfected with Agrobacterium cells containing the pl9 suppressor into N. benthamiana leaves and subsequently sprayed 24 hr after infiltration with either 50 μΜ mandipropamid or a mock solution (0.1% DMSO, 0.05% Silwet). 24 hours after treatment, leaf tissue was collected, frozen in liquid N2, and homogenized by bead beating using a Precellys (Bertin Technologies), at 6000 rpm for 30 seconds and then resuspended in SDS sample buffer containing protease inhibitor, separated by SDS-PAGE, electro-blotted onto nitrocellulose membrane, and detected using an anti-GFP antibody as described in Example 4 above. The results (Figure 15C) show that replacing the 35S promoter of the BD-PYR1*~MAND! cassette with PEX4 reduces overall induction levels in combination with the base 5 ' -UTR (which is derived from the 35S promoter). However, the MAPKKK 18 or To71 5"-l TRs in combination with PEX4::BD-PYR1 *"MANDi increased induction levels and reduced background relative to the starting pMANDI-GFP vector.
[0204] Collectively, these examples demonstrate that the orthogonal PYR1 *'MAm'/HAB 1 * interaction module can be used to chemically control diverse regulatory processes. The activation domains, nuclear localization and nuclear export sequences, promoters, and terminators can be reconfigured to use native plant-derived sequences (Li et al., 2013; Shieh, Wessler, & Raikhel, 1993; Yamamoto & Obokata, 2008, each of which is incorporated by reference herein).
References
Banaszynski, L. A., Chen, L.-C, Maynard- Smith, L. A., Ooi, A. G. L., & Wandless, T. J. (2006). A Rapid, Reversible, and Tunable Method to Regulate Protein Function in Living Cells Using Synthetic Small Molecules. Cell, 126(5), 995-1004.
Belshaw, P. J., Ho, S. N., Crabtree, G. R., & Schreiber, S. L. (1996). Controlling protein association and subcellular localization with a synthetic ligand that induces
heterodimerization of proteins. Proceedings of the National Academy of Sciences, 93(10), 4604-4607.
Bier, D., Thiel, P., Briels, J., & Ottmann, C. (2015). Stabilization of Protein-Protein Interactions in chemical biology and drag discovery. Progress in Biophysics and Molecular Biology, 119(1), 10-19.
Clough, S.J., and Bent, A.F. (1998). Floral dip: a simplified method for Agrobacterium- mediated transformation of Arabidopsis thaiiana. Plant J. 16, 735-743. Corbesier, L., ei al. (2007). FT protein movement contributes to long-distance signaling in floral induction of Arabidopsis. Science, 3 (5827), 1030-1033.
Cutler, S.R., Ehrhardt, D. ., Griffitts, J.S., and Somerville, C.R. (2000). Random
GFP-cDNA fusions enable visualization of subcellular stractures in cells of Arabidopsis at a high frequency. Proc. Natl. Acad. Sci. U. S. A. 97, 3718-3723.
Cutler, S. R., Rodriguez, P. L., Finkelstein, R. R., & Abrams, S. R. (2010). Abscisic Acid: Emergence ofa Core Signaling Network. Annual Review of Plant Biology, 61(1), 651-679.
Czechowski, T., Stitt, M., Altmann, T., Udvardi, M.K., and Scheible, W.-R (2005). Genome- wide identification and testing of superior reference genes for transcript normalization in Arabidopsis. Plant Physiol. 139, 5-17.
Engler, C, Kandzia, R., & Marillonnet, S. (2008). A one pot, one step, precision cloning method with high throughput capability. PloS One, 3(\ l), e3647.
Haasen, D., Kohier, C, Neuhaus, G., & Merkle, T. (1999). Nuclear export of proteins in plants: AtXPOl is the export receptor for ieucine-rich nuclear export signals in Arabidopsis thaliana. The Plant Journal: For Cell and Molecular Biology, 20(6), 695-705.
Hao, Q., et al. (2011). The molecular basis of ABA-independent inhibition of PP2Cs by a subclass of PYL proteins. Molecular Cell, 42(5), 662-672.
Haruki, H., Nishikawa, J., & Laemmli, U. K. (2008). The anchor-away technique: rapid, conditional establishment of yeast mutant phenotypes. Molecular Cell, 31(6), 925-932. Janse, D. M., Crosas, B., Finley, D., & Church, G. M. (2004). Localization to the Proteasome Is Sufficient for Degradation. The Journal of Biological Chemistry, 279(20), 21415-21420.
Liang, F.-S., Ho, W. Q., & Crabtree, G. R. (2011). Engineering the ABA Plant Stress Pathway for Regulation of Induced Proximity. Science Signaling, 4(164), rs2.
Licitra, E. J., & Liu, J. O. (1996). A three-hybrid system for detecting small ligand-protein receptor interactions. Proceedings of the National Academy of Sciences of the United States of America, 93(23), 12817- 12821. "
Ma, Y., Szostkiewicz, I., Korte, A., Moes, D., Yang, Y., Christmann, A., & Grill, E. (2009). Regulators of PP2C phosphatase activity function as abscisic acid sensors. Science.
324(5930), 1064-1068,
Melcher, K., et al . (2009). A gate-latch-lock mechanism for hormone signalling by abscisic acid receptors. Nature, 462(1213), 602-608.
Miyazono, K., et al. (2009). Structural basis of abscisic acid signalling. Nature, 462(1213), 609-614.
Mosquna, A., Peterson, F. C, Park, S, Y,, Lozano-Juste, J., Volkman, B. F., & Cutler, S. R, (201 1), Potent and selective activation of abscisic acid receptors in vivo by mutational stabilization of their agonist-bound conformation. Proceedings of the National Academy of Sci nces. it/-X(5 l ). 20838 20843.
Ng, L.-M., et al. (2011). Structural basis for basal activity and autoactivation of abscisic acid (ABA) signaling SnRK2 kinases. Proceedings of the National Academy of Sciences of the United States of America, 108(52), 21259-21264.
Nishimura, N., et al. (2009), Structural mechanism of abscisic acid binding and signaling by dimenc PYR1, Science, 326(5958), 1373. Okamoto, M., Peterson, F.C., Defries, A., Park, S.-Y., Endo, A., Nambara, E., Volkman, B.F,, and Cutler, S.R. (2013). Activation of dimeric ABA receptors elicits guard cell closure, ABA-regulated gene expression, and drought tolerance. Proc. Natl. Acad. Sci. U. S. A. 110, 12132-12137,
Ossovskaya, V., Lim, S.-T., Ota, N., Schlaepfer, D. D., & Ilic, D. (2008). FAK nuclear export signal sequences, FEES Letters, 582(16), 2402-2406,
Park, S.-Y., et al . (2009). Abscisic Acid Inhibits Type 2C Protein Phosphatases via the PYR PYL Family of START Proteins. Science, 324(5930), 1068-1071.
Park, S. Y., Peterson, F. C, Mosquna, A., Yao, J., Volkman, B. F., & Cutler, S. R. (n.d.). Agrochemical control of plant water use using engineered ABA receptors. Nature.
http ://doi . org/ 10.1038/nature 14123
Peterson, B.A., Haak, D.C., Nishimura, M.T., Teixeira, P.J.P.L., James, S.R., Dangl, J.L., and Nimchuk, Z.L. (2016). Genome-Wide Assessment of Efficiency and Specificity in
CRISPR/Cas9 Mediated Multiple Site Targeting in Arabidopsis. PLoS One 11, e0162169. Pratt, W. B., Gaiigniana, M. D., Harrell, J. M., & DeFranco, D. B. (2004). Role of hsp90 and the hsp90-binding immunophilins in signalling protein movement. Cellular Signalling, (8), 857-872.
Rutkowska, A., & Schultz, C. (2012). Protein tango: the toolbox to capture interacting partners. Angewandte Chemie , 5/(33), 8166-8176.
Saijo, T., and Nagasawa, A. (2014). Development of a tightly regulated and highly responsive copper-inducible gene expression system and its application to control of flowering time. Plant Cell Rep. 55, 47-59,
Soon, F.-F., et al. (2012). Molecular Mimicry Regulates ABA Signaling by SnRK2 Kinases and PP2C Phosphatases, Science, 555(6064), 85-88,
Yin, P., et al. (2009). Structural insights into the mechanism of abscisic acid signaling by PYL proteins. Nature Structural & Molecular Biology, 16(12), 1230-1236.
Zetsche, B., Volz, S. E., & Zhang, F. (2015). A split-Cas9 architecture for inducible genome editing and transcription modulation. Nature Biotechnology, advance online publication, http://doi.org/10, 1038/nbt.3149
[0205] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
SEQ ID NO:l (Arabidopsis PYR1) MPSELTTEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELV SIVRRFD PQTY
HFIKSCSVEQNFEMRVGCTRDVTVTSGLPANTSTERLDILDDERRVTGFSnGGEFIRLT N^^KSVT FTRFEKENRIWWVLESYVVrJMPEG SEDDTRMFADWV LNLQKLAT VAEAMARNSGDGSGSQVT
SEQ ID NO:2 (Arabidopsis PYL1)
MANSESSSSPVNEEENSQRISTLHFIQTMPSDLTQDEFTQLSQSIAEFHTV'QLGNGRCS
SLLAQRIFL4PPETV VSVVRRFDRPQIYKIiFIKSCNVSEDFEMRVGCTRDVNVISGLPA
NTSRERLDLLDDDRRVTGFSITGGEFiRLRNYKSVTWFiRFEKEEEEERIWTVVLESY VVDVPEGNSEEDTRIJ'ADTVIRLNLQKLASITEAMNRNNNNN SSQVR
SEQ ID NO:3 (Arabidopsis PYL2)
MSSSPAVKGLTDEEQKTLEPVIKTYHQFEPDPT CTSLITQRIHAPASV PLIRRFDN
PERY HFVKRCRLISGDGDVGSVREVWISGLPASTSTERLEFVDDDHRVLSFR rVGG EH LKNYKSVTSVNEFLNQDSGKVYWVLESYWDIPEGNTEEDTKMFVDTVVKLN LQKLGVA ATS APMHDDE
SEQ ID NO:4 (Arabidopsis PYL3)
MNLAPIHDPSSSSTTTTSSSTPYGLTKDEFSTLDSIIirrHHTFPRSPNTCTSLIAHRVDAP AHARVRFVRDFANPNKYKIiFIKSCTIRVNGNGIKEIKVGTIREVS rVSGLPASTSVEIL EVLDEEKRILSFRVLGGEFIRLNN^^RSVTSVNEFVVLE DKKKRVYSVVLESYIVDIPQ GNTEEDTRMFVDWVKSNLQNLAVISTASPT
SEQ ID NO:5 (Arabidopsis PYL4)
MI VHRPSSAVSDGDSVQIPMMIASFQKRFPSLSRDSTAARFHTHEVGPNQCCSAVI QEISAPISTVWS RRFDNPQAYKHFLKSCSVIGGDGDNVGSLRQVHVVSGLPAASS
TEi LDILDDEmVlSFSVA'OGDHi LSNYRSVlTLHPSPlSGTVVVESYVVDVPPGNTK EETCDFVDVIVRCNLQSLAKIAENTAAESKK MSL SEQ ID NO:6 (Arabidopsis PYL5)
MBSPVQLQHGSDAT GFm QPHDQTDGPIKRVCLTmMHVPEHVAMHHTHDVGP DQCCSSWQMlHAPPES ALVRRFbNPKWKNFIRQCRIVQGDGLHVGDLREVMV VSGLPAV^STEl LElLDEEmVISFSVVOGDHi LKNYRSVTTLHASDDEGWVVESYl VDVPPGNTEEETLSFVDTIVRCNLQSLARST RQ
SEQ ID NO:7 (Arabidopsis PYL6)
MPTSIQFQRSSTAAEAANAWRm Fn-niQKQVQKVSLTRGMADVPFJWELSHWI\'V GPSQCFSVVVQDVEAPVSTV\VSiLSRFEHPQAYKHFVKSCHVVIGDGREVGSVREVR VVSGLPAAFSLF;RLEIMJ3DDRHVISFSVVGGDHRLM^YKSVTTVHESFEDSD
RVVESYVVDVPAGNDKEETCSFADTIVRCNLQSLAKLAENTSKFS
SEQ ID NO:8 (Arabidopsis PYL7)
MEMIG iDDTDTE GAIA AQSLRLRHIi-fflCRENQCTSVIA'KYIQAPVFnA^WSLV RRFDQPQKY PFISRCT TsfGDPEIGCLRF^WKSGLPATTSTERLEQLDDEEFiILGLNII GGDHRLKNYSSILTVHPEMIDGRSGTMVMESFVVDVPQGNTKDDT KSLAC VSERLAAQDITN S1ATFCN ASN GYREKJNHTETNL
SEQ ID NO:9 (Arabidopsis PYL8)
MEANGIENLT P QEREFI m-Πi™ELVDNQCSSTLV HINAP ΉI SLV FDQP Q YKPFISRCVVKGNMFXGWREVDV SGLPATRSTERLELIIJDNEFIILSIRIVGGDH RL NYSSIISLHPETIEGRIGTLVIESFVVDVPEGNTKDETCYFVEALIKCNLKSLADISE RLAVQDTTESR.V
SEQ ID NO: 10 (Arabidopsis PYL9)
MMDGVEGGTAMYGGLETVQYVliTFfflQHLCl ENQCTSALVKHlKAPLHLVWSLVR 1 FDQPQKYKPFV¾RCTV1GDPEIGSLRE;VNVKSGLPATTSTERLELLDDEEHILG1K11G GDFIRL NYSSILWFiPEnEGRAGTNiVIESFVVDVPQGNT DETCYFVEALIRCNLKS LADVSERLASQDITQ SEQ ID NO: 11 (Arabidopsis PYL 10)
MNGDETKKVESEYIKKHHBHELVESQCSSTLVKHIKAPLHLVW IVRRFDEPQKYKP
FlSRCVVQGKKLEVGSVi EVDLKSGLPATKSTEVLElLDDNEHlLGlRIVGGDHl LKN YSSTISLHSETIDGKTGTLAIESFVVOVPEGNTKEETCFFVEALIQCNLNSLADVTERL QAESMEK I
SEQ IB NO: 12 (Arabidopsis PYL1 1 )
METSQKYHTCGSTLVQTIDAPLSLVWSILRRFDNPQAYKQFVKTCNLSSGDGGEGSV REVTVVSGLPAEFSRERLDELDDESFiVMMISIIGGDFiRL-VT^RSKTMAFVAADTEEK
TVVVESYVVDVPEGNSEEETTSFADTIVGFNLKSLAKLSERVAHLKL
SEQ ID NO:13 (Arabidopsis PYL 12)
MKTSQEQIWCGS VQTINAPLPIA^VSILRRFDNP TFKHFVKTCKLRSGDGGEGS r REVTWSDLPASFSLE LDELDDESHVMVTSnGGDHRLVNYQSKTTVFVAAEEEKTV VVESYVVDVPEGNTEEEITLFADTIVGCNLRSLAKLSEKMMELT
SEQ ID NO: 14 (Arabidopsis PYL13)
MESSKOKRCRSSVVETIEAPLPLVVVSILRSFDKPQAYQRF'VKSCTMRSGGGGGKGGE GKGSVRDVTLVSGFPADFSTERLEELDDESHVMVVSIIGGNHRL\WKSKTKVVASP EDMAKK VVESYV TDVPEGTSEEDTIFFVDNIIRYNLTSLAKLTKKMM
SEQ ID NO: IS (consensus sequence)
CxSxxxxxxxAPxxxxWxxxxxFxxPxxxxxFxxxC
SEQ ID NO: 16 (consensus sequence)
GxxRxVxxxSxxPAxxSxExLxxxD
SEQ ID NO:17 (consensus sequence)
ESxxVDxPxGxxxxxTxxFxxxxxxxNLxxL
SEQ ID NO: 18 (consensus sequence)
HxxxxxxxxCxSxxxxxxxAPxxxxWxxxxxFxxPxxYKxFxxxC
K59R, V8I I, FIO8A, S122G, MI58I. FI59V, AI60V, TI62D _„PYR1 * -
Figure imgf000080_0001
MPSELTPEERSELKNSIAEFH1TQLDPGSCSSL Q1 1 \PPELVWSIV1¾ FDKPQTHR HFlKSCSVEQNFEMRVGCTl DllVlSGLPANTSTERLDlLDDERl VTGASllGGEHRLTN YKGVTWFIRFE ENmWT 'A?LESWVDMPEGNSEDDTRlVVDDVVKLNLQKLAW AEAMARNSGDGSGSQVT SEQ ID NO:20 (Arabidopsis pYRi^ ^R. ven. FiosA. smc Misev. F^v. Aieov. T^
MPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPEL\WSIVRRFDKPQTHR
HFI SCSVEQNFEMR JCTRDIIVISGLPANTSTERLDILDDERRVTGASIIGGEHRI,TN
YKGVTTVHRFEKEN AEAMARNSGDGSGSQVT
SEQ ID NO:21 (ArabldopSIS pYR i^8¾ K59R, V811, F108A, S122G, Mi58l Fi59V, A160C T162D )
MPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELV SIVRRFD PQTHR HFIKSCSVEQNFEMRVGCTRDIIVISGLPANTSTERLDILDDERRVTGASIIGGEFIRLTN YKGVTTVHRFEKENRJWTVVLESYYVDMPEGNSEDDTRIVCDDVVKLNLQKLATVA EAMARNSGDGSGSQVT
SEQ ID NO:22 (HAB 1)
MEEMTPAVAM TLSLAANTMC ESSPVEITQL NVTDAADLL SDSENQSFCN GGTECTMEDV SELEEVGEQD LLKTLSDTRS GSSNVFDEDD VLSWEDNSA VISEGLLVVD AGSELSLSNT AMETDNGRVL ATAIIVGESS IEQVPTAEVL IAGVNQDTNT SEVVIRLPDE NSNHLVKGRS VYELDCIPLW GTVSIQGNRS EMEDAFAVSP HFLKLPIKML MGDHEGMSPS LTHLTGHFFG VYDGHGGHKV ADYCRDRLHF ALAEEIERIK DELCKRNTGE GRQVQWDKVF TSCFLTVDGE
lEGKIGRAVV GSSDKVLEAV ASETVGSTAV VALVCSSHIV VSNCGDSRAV
LFRGKEAMPL SVDHKPDRED EYARIENAGG KVIQWQGARV FGVLAMSRSI GDRYLKPYVI PEPEVTFMPR SREDECLILA SDGLWDVMNN QEVCEIARRR ILMWHKKNGA PPLAERGKGI DPACQAAADY LSMLALQKGS KDNISIIVID
LKAQRKFKTR T
SEQ ID NO:23 (ABU)
MEEVSPAIAG PFRPFSETQM DFTGIRLGKG YCNNQYSNQD SENGDLMVSL PETSSCSVSG SHGSESRKVL ISRINSPNLN MKESAAADIV WDISAGDEI NGSDITSEKK MISRTESRSL FEF SVPLYG FTSICGRRPE MEDAVSTIPR FLQSSSGSML DGRFDPQSAA HFFGVYDGHG GSQVANYCRE RMHLALAEEI AKEKPMLCDG DTWLEKWKKA LFNSFLRVDS EIESVAPETV GSTSWAVVF
PSHIFVANCG DSRAVLCRGK TALPLSVDHK PDREDEAARI EAAGGKVIQW
NGARVFGVLA MSRSIGDRYL KPSUPDPEV TAVKRVKEDD CLILASDGVW DVMTOEEACE MARKRILLWH K NAVAGDAS LLADERRKEG KDPAAMSAAE YLSKLAIQRG SKDNI SVV VV D LKPRRKL S KPLN SEQ ID NO:24 (ABI2)
MDEVSPAVAV PFRPFTDPHA GLRGYCNGES RA'TLPESSCS GDGAMKDSSF EINTRQDSLT SSSSAMAGVD ISAGDEINGS DEFDPRSMNQ SEKKVLSRTE SRSLFEFKCV PLYGVTSICG RRPEMEDSVS T1PRFLQVSS SSLLDGRVTN
GFNPHLSAHF FGVYDGHGGS QVANYCRERM HLALTEEIVK EKPEFCDGDT WQEKWK ALF NSFMRVDSEI ETVAHAPETV GSTSWAVVF PTHIFVANCG DSRAVLCRGK TPLALS VDHK PDRDDEAARI EAAGGKVIRW NGARVFGVLA MSRSIGDRYL KPSVIPDPEV TSVRRVKEDD CLTLASDGLW DVMTNEEVCD LARKRILLWH KKNAMAGEAL LPAEKRGEGK DPAAMSAAEY LSKMALQKGS KDNISWWD LKGIRKFKSK SLN
SEQ ID NO:25 (HAB2)
MEEISPAVAL TLGLANTMCD SGISSTFDIS ELENVTDAAD MLCNQKRQRY SNGVVDCIMG SVSEEKTLSE VRSLSSDFSV TVQESEEDEP LVSDATIISE GLIWDARSE ISLPDTVETD NGRVLATAII LNETTIEQVP TAEVLIASLN HDVNMEVATS EWIRLPEEN PNVARGSRSV YELECIPLWG TISICGGRSE MED AYR A LPH FLKTPIKMLM GDHEGMSPSL PYLTSHFFGV YDGHGGAQVA DYCHDRIHSA LAEEIERIKE ELCRRNTGEG RQVQWEKVFV DCYLKVDDEV KGKINRPWG SSDRMVLEAV SPETVGSTAV VALVCSSH11 VSNCGDSRAV LLRGKDSMPL SVDHKPDRED EYARIEKAGG KVIQWQGARV SGVLAMSRSl GDQYLEPFVI PDPEVTFMPR AREDECLILA SDGLWDVMSN QEACDFARRR ILAWHK NGA LPLAERGVGE DQACQAAAEY LSKLAIQMGS KDNISIIVID LKAQRKFKTR S
SEQ ID NO:26 (HAI1)
MAEICYENET MMIETTATVV KKATTTTRRR ERSSSQAARR RRMEIRRFKF VSGEQEPVFV DGDLQRRRRR ESTVAASTST VFYETAKEW VLCESLSSTV VALPDPEAYP KYGVASVCGR RREMEDAVAV HPFFSRHQTE YSSTGFHYCG VYDGHGCSHV AMKCRERLHE LVREEFEADA DWEKSMARSF TRMDMEVVAL ADGAAKCRC ELQRPDCDAV GSTAWSVLT PEKJIVANCG DSRAVLCRNG KAIALSSDHK PDRPDELDRI QAAGGRVIYW DGPRVLGVLA MSRAIGDNYL KPYVISRPEV TVTDRANGDD FLILASDGLW DWSNETACS WRMCLRGKV NGQVSSSPER EMTGVGAGNV WGGGDLPDK ACEEASLLLT RLALARQSSD NVSVVVVDLR RDT
SEQ ID NO:27 (HAI2)
MADICYEDET SACESRPLWS SRKWRIGVQR FRMSPSEMNP TASTTEEEDK SEGIYNKRNK QEEYDFMNCA SSSPSQSSPE EESVSLEDSD VSISDGNSSV NDVAV1PSKK TVKETDLRPR YGVASVCGRR RDMEDAV ALH PSFVRKQTEF SRTRWHYFGV YDGHGCSHVA ARCKERLHEL VQEEALSDKK EEWKKMMERS FTRMDKEVVR WGETVMSANC RCELQTPDCD AVGSTAVVSV ITPEKIIVAN CGDSRAVLCR NGKAVPLSTD HKPDRPDELD RIQEAGGRVI YWDGARVLGV LAMSRAIGDN YLKPYVTSEP EVTVTDRTEE DEFLILATDG LWDWTNEAA CTMVRMCLNR KSGRGRRRGE TQTPGRRSEE EGKEEEEKW GSRKNGKRGE ITDKACTEAS VLLTKLALAK HSSDNVSVVV IDLRRRRKRH VA
SEQ ID NO:28 (HA13)
MAEICYEVVT DACPSSVYES TPAHSRRRPR FQTVMHEDWE KNCKRSKQEA LATRYSSIPR SSREDFSDQN VDVSSPRYGV SSVCGRRREM EDAVAIHPSF
SSPKNSEFPQ HYFGVYDGHG CSHVAARCRE RLHKLVQEEL SSDMEDEEEW KTTMERSFTR MDKEWSWGD SWTANCKCD LQTPACDSVG STAVVSVITP DKI ANCGD SRAVLCRNGK PVPLSTDHKP DRPDELDRIE GAGGRVIYWD CPRVLGVLAM SRAIGDNYLK PYVSCEPEVT ITDRRDDDCL ILASDGLWDV VSNETACSVA RMCLRGGGRR QDNEDPAISD KACTEAS VLL TKLALAR SS DNVSVVVIDL RR
SEQ ID NO: 29 (Atlg43900 - protein phosphatase 2C family protein)
MKKTRNVASS PIECVHLQTK PTTTLVRSFF FFLFNSQTIS SFIIFYLFLC SFFWTCQSPN LTNPSPPPLS V APLRGD A S PPPESSSSPA TKSSLMISSR
DPNALFSGGG ISFLAGVRTV KFSYGYSSLK GKRATMEDYF ETRISDVNGQ MVAFFGVFDG HGGARTAEYL KNNLFKNL V S HDDFISDTKK AIVEVFKQTD EEYLIEEAGQ PKNAGSTAAT AFLIGDKLIV ANVGDSRVVA SRNGSAVPLS DDHKPDRSDE RQRIEDAGGF IIWAGTWRVG GILAVSRAFG DKQLKPYVIA EPETQEEDIS TLEFIVVASD GLWNVLSNKD AVAIVRDISD AETAARKLVQ EGYARGSCDN ITCIWRFEV S
SEQ ID NO:30 (Arabidopsis HAB 1R199A' D203A' S322D' V393R- R505A - ΉΑΒ 1 * ")
MEEMTTAVAMTLSLAANTMCESSPVEITQLKNVTDAADLLSDSENQSFCNGGTECT MEDVSELEEVGEQDLLKTLSDTRSGSSNVFDEDDVLSVVEDNSAVISEGLLVVDAGS ELSLSNTAME1DNGRVLATA1IVGESSIEQVPTAEVL1AGVNQDTNTSEVV1RLPDENS NHLVKGRSWELDCIPLWGTVSIQGNASEMEAAFA rSPHFLKLPIKMLMGDHEGMS PSLTHLTGHFFGWDGHGGIiKVADYCRDRLHFALAEEIERIKDELCKRNTGEGRQV QWDKVFTSCFL DGEIEGKIGRAVVGSSDKVLEAVADETVGSTAVVALVCSSHIVV SNCGDSRAVLFRGKEAMPLSVDFiKPDREDEYARIENAGrGKVIQWQGARVFGRLAM SRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVIVIN QEVCEIARRRILAIW HKKNGAPPLAERGKG1DPACQAAADYLSMLALQKGSKDNIS1IVIDLKAQAKFKTRT
SEQ ID NO:31 (HAB 1 * with 3 amino-acid N-terminal truncation)
MTPA rAMTLSLAANTMCESSPVEITQLKNVTDAADLLSDSE QSFCNGGTECTMED VSELEEVGEQDLLKTLSDTRSGSSNVFDEDDVLSVVEDNSAVISEGLLVVDAGSELSL SNTAMEIDNGRVLATAIIVGESSIEQVPTAEVLIAGVNQDT TSEVVIRLPDENSNHLV KGRSVYELDCIPLWGTVSiQGNASEMEAAFAVSPHFLKLPIKMLMGDHEGMSPSLTH LTGHFFGVYDGHGGHKVADYCRDRLHFALAEE1ER1KDELCKR TGEGRQVQWDK VFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVADETVGSTAVVALVCSSfflVVSNCG DSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGRLAMSRSIG DRYLKPYYIPEPEVTTMPRSREDECLILASDGLWDVM nSiQEVCETARRRILMWTiKKN GAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISITVIDLKAQAKFKTRT SEQ ID NO:32 - Amino acid sequence for nuclear localized PYR1 *"MA DI (Activation domain in bold: pYRi *"M^ Di m italics; nuclear localization sequence underlined)
MDKAELIPEPPKKKRKVELGTAANFNOSGNIADSSLSFTFTNSSNGPNLITTOTNS QALSQPIASSNVHDNF NNEITASKIDDGNNSKPLSPGWTDQTAYNAFGITTGMF
KTJTMBOYYNYLFOBEOT¥¥K¥KKFAEIMPSEI PF£RSEIJ<NSIAEFHTYQLDPGSC SSLHAQRIHAPPELVWSIVRRFDKPQTHRHFIKSCSiΈQAΨEMRVGCTRDΠ}'^SGLPANTS TERLLmDIJEMRVTGASIIGGEHRLTM^
nm il!l Ί 7 )/ )l ί .' .\'.' ( K!.A Ω AEA S RXS( UH iS( iSOl 7 *
SEQ ID NO:33 - Amino acid sequence for cytoplasms cally localized GFP-FLAB l * (GFP in gray shadow; binding domain in bold; linker underlined; HAB 1 * in italics; nuclear export sequence in double underline)
MG S H H H H H H V S G EEL FTG V V P [ L V E I.. DG D VN G H FS V SG EG EG DA TYG KLTLK.Fi CTTOKlJ^VPWmA'lTLTYGVQCFSRYPDHM QHDFF SAMPEGYVQERTiFFKD G Y KTR A E V K F EG DTL V N 1 E L G I D F E DG 1 LG H K L E Y N Y S H N V Y ί A D K.Q KN GI VN FKI RHN I EDGSVOLADHYQQNTPIGDGPVLLPDNHYLSTQSALS DPNEKRD HM V L L E F VTA AG ITLG D ELY SG AAA^ SSIEQ ACDIC RLK L CS E P CA
FPREDLDMILKMDSLQDIKALLTGLFVQDNVNKDAVTDRLASVETDMPLTLRQ
Figure imgf000083_0001
AMMCESSPJ^ITOLKNVTDAADIZSDSENQSFCNGGTECJMEDVSELEEVGEQDLLnZ SDTRSGSSNVFDEODVLSVVEDNSAVISEGLLVVDAGSELSLSMA' MEIDNG LATAIIVGE SSIEQVPTAEVLlAGVNQDTNTSEVVIRLPDENSmLVKGRSVYELDCIPLWGTVSIQGNASE AiEAAFA VSPIiFLKLPJ ilMGDHEGMSPSLmLTGHFF^
FALAEEIERIKDELCKRI^GEGRQVQWDKVFTSCFLTVDGETEGKIGRAVVGSSDKVI,EA V ADEWGSTAVlAIJ^SSHIlVSNCGDSRAVI^FRGKEAAiPLSVDHKPDREDEYARIENAGG KV10W()GARV X AMSRSIGDRYLKPYVIPEPI^^
QEVCEIARRRRMWHKKNGAPPT ERGKGIDPACQAAADYI MIALQKGSKDMSIB'IDL ^/lg.4A3¾ R7LDLASLILLOLPPLERLTLD*
SEQ ID NO:34 - Ammo acid sequence for BD-HAB1* (cytoplasiriically localized GFP- HAB1* (binding domain in bold; linker in underline; HAB1* in italics; nuclear export sequences in double underline)
M LLSSIEQACDICRLK L CS E P CA CL NWECRYSPKT MSPLTRAH LTEVESRLERLEQLFLLIFPREDLDMILK DSLQDIKALLTGLFVQDNV KDAV TDRLASW.TDMPLTT.RQHRTSATSSSEESSN GOROT.TVSPET .TJJLAJLTI.GGGGS
GGGSGGGSGRDLVEMWAVAMTLSLA4N7' MCESSPVEITQLF VVTDAADLLS∑)SENOSFC
NGGJECIMEDVSELEEVGEQDLLKT
AGSELSLSM'AMEIDNGRVLATAIIVGESSIEI^TAEVLIAGVNQDTNTSEVVLRI.PDENSN HLVKGRSVYELDCIPLWGWSIQGNASEMEAAFA VSPHFLKLPIKMLMGDHEGMSPSLTH LTGHFFGVYDGHGGHKLADYCRDRIJFFALAEEIERIKDELCKRI^GEGRQVQWDK^FTS CFLWDGEIEGKIGRA V^RGSSDKVJ^A VADEWGSTA VVALVCSSHIV^^NCGDSRAVI,FRG KEAMPLSVDHKPDREDEYARIENAGGKIRQWQGARWGRLAMSRSIGDRYLKPWIPEPE
VTFMPRSREDECLl SDGLWDVM 2EVCElARmU \lWHKKNGAP
COAAADYLSMLALOKGSKDNlSIIVIDLKAOAKP l i DLASLlL*
SEQ ID NO:35 - Activation Domain (AD) amino acid sequence
MDKAELIPEPPKKKRKVELGTAANFNQSGNIADSSLSFTFTNSSNGPNLITTQTNSQA
LSQPIASSNVHDNFMNNEITASK^
MDDVYNYLFDDEDTPP PKKEI
SEQ ID NO:36 - DNA Binding Domain (BD) ammo acid sequence
MKLLSSIEQACD1C1 LKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPL1"RJ HLTEV ESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNKDAVTDRLASVE
TDMPLTLRQHRTSATSSSEESSNKGQRQLTVSP
SEQ ID NO:37 - Nuclear localization sequence
PKKKRKV
SEQ ID NO:38 - Nuclear export sequence
LASLILLQLPPLERLTLD
SEQ ID NO:39 - Nuclear export sequence
LDLASLIL SEQ ID NO:40 - UAS: :GFP (GFP underlined)
AGCTCCGGAGTACTGTCCTCCGAGCGGAGTACTGTCCTCCGAGCGGAGTACTGTC
CTCCGAGCGGAGTACTGTCCTCCGAGCGGAGTACTGTCCTCCGAGGCAAGACCCT TCCTCTATATAAGGAAGTTCATTTCATTTGGAGAGAACACGGGGACTCTAGCGCT ACCGGTATGGGCAGCCATCATCATCATCATCACGTGAGCAAGGGCGAGGAGCTG TTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCAC
A^GTTC^O^TOCCG^
CTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGA CCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCA GCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATC TTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGC GACACCCTXJGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGC
AACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATC ATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAAC ATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATC GGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCC TGAG^
CCGCCGCCGGGATCACTCTCGGCATXSGACGAGCTGTACAAGTCCGGAGCTGCGG
CCGCTGCCGCTG(:GGCAGCGGC(:GAATTC(;CCGGGCT{:GAGAAG-CTTGGATCCTA GGTCGAGGCGAATTTCCCCGATCGTTCAAACATTTGGCAATAAAGTTTCTTAAGA TTGAATCCTGTTGCCGGTCTTGCGATGATTATCATATAATTTCTGTTGAA
TAAGCATGTAATAATTAACATGTAATGCATGACGTTATTTATGAGATGGGTTTTT ATGATTAGAGTCCCGCAATTATACATTTAATACGCGATAGAAAACAAAATATAG CGCGCAAACTAGGATAAATTATCGCGCGCGGTGTCATCTATGTTACTAGATCGGG AATTAATTCGATAAGCTAGAGA
SEQ IB NO:41
Brasska oieracea {89257688}
mpsqltpeerselaqsiaeflity gpgscsslh^
pantsterldiiddem^gfsiiggehrltnyksvtw^
amarnagdgsgaqvt
SEQ IB NO:42
Brasska oleracea {89274227}
g MM Ji
mpseltqeerekltqsisefhtyhlgpgscsslha^
pantsteridntlddem^gfsiiggeMknyksvttvhrfererri
eamamagdgfgsfettcrest itafekqrqiieptvy
irqlqrprqsfgerqsi
SEQ ID NO:43
Visis..viis¾ra {157341954}
mqmkylegkqnlmeekgekqcipmdlavreaqfkgslldritw^
scsφvfstnlh hghkqtsqfhv rfeyqeggren a
lilqeiekyktsshfsspaslfaamnkaetssmaeaese^^
haplptvwsvvixfdkpq!ykhfikschvedgfemrv^
ggeiwtvvleswvclmpegnteedtrlfadtvvklnlqklasvt^
vamkdgstss
SEQ ID NO:44
Vitisjrinifera (147789129)
an ! 52Ji
maeaesedsetttptthhltippgltqpeiqelahsis^^
dgfemrvgclrdvnvisglpaetsterldildderhvtgfsi^^
dtrlfadtv vklnl seaxrr
SEQ IB NO:45
Medk&go iraneatok {217073334 ?
gbL ^026Ji
mekaesstastsdqdsdenhrtqhhltipsglrqhefdslipfinshlityiigpnqcstilaqrih kscslkegfqmkvgctrdvnvisglpaatsterldvldde tgfsiig^
vpegnteedtrlfadtvvklnlqklas^egknrdgdgksh
SEQ ID NO: 6
Orysis saliva Japoaica Grasp {1JS 836 0^
refj.NP 0Q106547Q.i l
meqqeevppppaglgliaeeyaqvrat^ ^a hryavgpgqcssllaqrihappaavwavvrrfdcpqvykhfirscvlrpdphh ddngnd^grlrevsvisglpaststerldllddahrvfgfUtggehrlmyrsvttvsqldeirtlvles}dvdv dgn^ virlnlqklksvseananaaaaaaappppppaaae
SEQ IB NO:47
Zeis raa s {i SS4ie6S¾
^£G4j Ji
mdqqgaggdaevpaglgltaaeyeqli^daliJiryavgegqcssllaqrihappeavwawrf
eagdalcpgrlrevsvisglpaststerldllddaan'fgfsitg^
adtv irlnl qklksvaeanaaeaaattnsvllprpae
SEQ IB NO:48
is ssays > 9ί5625286!
bl ^liiZlJi
mdqqgaggdaxvpaglgltaaeyeqlrstvdahhsyavgegqcssllaqrihappeavwavvrrM
eagdalcpgrlrevsvisglpaststerldllddaarvfgfsitgge^^
adtvirlnlqklksvteanaaeaaattnsvllprpae
SEQ ID NO:49
Vitis viaifera ( 157339249}
mdphhhhglteeefralepiiqnyhtfepspntet^
sglpaststeriei3ddekhilsfrvvgge.M^
vaitslheneeiadnegpsreislqsetesaergderrdgdgpskacnniewhcttke
SEQ ID NO:50
Oryza sasiva Jassofska Groses {4 388537}
mephmeralreavaseaerrelegv τahhtφ
gdgatvgsvrevavvsglpaststerleildddr
edtmiftdtvvklnSqkiaavatsssppaagnlih
SEQ ID NO:51
On¾a sali a Indka Group {12S538682
Figure imgf000086_0001
gdgat\' ·gsvre avvsglpaststerleildddrhvlsf ggdhΓlmyrsvtsvlefsspss pspp ycvvves ' vdv eg nteedtrn ftdtvvklnlqklaavatsssppaagnhh
SEQ ID NO:52
Zea mays (194695858}
£b|ACF82013Ji
mpytapφs qqhsrvlsgggakaashgascaavpaevarhhehaaragqccsavvqaiaapvgavvvsvvrrfdφqaykhfi rscrlvgggdvavgsvrevn'Vsglpatssrerleildderrvisfn'VggehrlanyrsvltvheagagagtgU'vvesyvvdvph gntadetrvfvdtivrcnlqslartaerla SEQ IB NO:53
Figure imgf000087_0001
mpsnppksslvvhrinspnsitiattasaaamhntstmpphkqvpdavsrhl^
dnpqaykhfvksclivvvgdgdvgtte
vvdippgntkedicvfvdtivfcnlqslaqiaenaagckrsss
Figure imgf000087_0002
mppsspdssvllqrissnttpdfackqsqqlqiTtmpipcttqvpdsvvrflithpvgpnqccsaviqris
qayl&fvkschvivgdgdvgtlreroi^^
dvppgntrdetcvfv'dtivkcnltslsqiavnvnrrkds
SEQ ID NO:55
OrvKi saii a fcsdka Group 25'52823S)
m yaav s ppqls igsgagggkacpavpcevar hehavgagqccs1ΛΎqaiaa ada vsvvrrfdφqaykk^ crlvdgdggevgsvreviwsglpatssrerievlddd^
weetrvfvdtivrcnlqslartv'erlapeaprangsidha
SEQ ID NO:56
Orj¾;i_saiiva_ JapQfskaJiroisp ^5624049}
d [ AB6J5102;i!
mpyaavφspppqlsφigsgagggkacpaγ cevaryhehavgagqcfstvvqaiaapada
rlvdgdggevgsvrevTvvsglpatssrerlevldddrrvdsfnvggehrlanjTsvttvheaaapamavvvesyvvdvppgnt weetn'fvdtivrcnlqslartverlapeaprangsidha
SEQ ID NO:57
Ptcea siteheasss (1 16783434}
£b|A 2294QJl
mdiiagfdqlsfrlsgaskqitktgavqylkgeegygewlkevmgiyhyhshdgarecrcssvvvqqveapvsvvwslvrrf^^ qpqvykhfvsncfmrgdlkvgclrevrvvsglpaatsterldildeerhilsfsivggdhrlnnyrsittlhetl^
dvphgntkeetclfvdtivkcnlqslahvsnhlnsthrcl
SEQ ID NO:58
Oryza ssrtivs Japonica Greap |ί 15468550}
mealiveralreglteeeraalepavmahhtfppstttatt^
svgsvfe\tvvsglpaststerlemldddrhiisfrvvggqhrlmyrsvtsviefqppaagpgpappycvvvesy edtnnftdtvvklnlqmlaavaedsssasrrrd
Figure imgf000087_0003
lπpytapη^sppqhsπggcggggvlkaaga ghaascvavpaevarhhehaagvgqccsavvqaiaapvdavwsvvΓrfdφ qaykhfirscilldgdgdggavavgsvrevryvsglpatssrerleM
syvvdvphgniadetrmfvdtivrcnlqslartaeqlalaapraa
SEQ ID NO:60 Vstis ¾ns 157351249}
mpsslqlhrinnidpttvavaataavnchkqsrtylrcatpvpda
aykhflksch\nfgdgdigtlrevhwsglpaessterleild
pgntkedtcv i,'dtivkc!i3qslaqmsekltonnmss
SEQ ID NO:61
jssavs {193017008?
ablACG30334.1 ;
mpclqasspgsmpyqhhgrgvgcaaeagaavgasagtgtrcgahdgevpaeaarhhehaapgpgrccsavvqrvaapaeav wsvvrrfdqpqaykrfvrscdlagdggvgtlrevm'sglpaassrerlevld
daatw^esyv^?dvppgntpedtr 'f\'dtivkcniqs]attaeklalaav
SEQ ID NO:62
Physcomitretta pateas sisfesp. p&tem {168051209}
icfjXP 001778048.il
mqtkgrqadfqtllegqqdlicrfliilielqphqcgsillqH^
ipatssierleilddeehiisfrvlggghrlqnywsvtslhsheidgqm
e
SEQ ID NO:63
Oryza saliva ίηύί ι Grossp {12SS43492}
gb!EAY89631J]
mpcφasspgiphqhqhqhhralagvgmavgcaaeaavaaagvagίfcgahdgevpmevafhhehaepgsgfccsavvqh vaapapavwsvvrrfdqpqaykrfvrscallagdggvgtlrevn^^
hpspsaptaatwvesyvvdvppgntpedtrvfvdtivkcnlqslaktaeklaagaraags
SEQ ID NO:64
Oryza saliva Jamaica Gs¾ap {115452475}
idl PjH £8mil
inpcipasspgiphqhqhqhhraSagvgmavgcaaeaavaaagvagtrcgahdgevpmevarhhehaepgsgrccsavvqh vaapaaavwsvvrrfdqpqaykrfVrscallagdggvgtlrevrw^
hpspsaptaatvvvesyvvdvppgntpedtrefvdtivkcnlqslaktaekiaagaraags
SEQ ID NO:65
Meclka¾© tnincatala {2 7075076}
mpspvqfqrfdsntaitngw!cpkqiqac^
qgykhfvkscnwasgdgiivgalrevrlvsglpavssterldUdeeihvisfswgg ¾rcm
vdvpqgntkeetcsfadtivrcnlq slvqiaekl
SEQ ID NO:66
Zea mavs {1 56 8 8 }
g jACC 2 ]
mpfaasrtsqqqhsrvatngravavcaghagvpdevarhhehavaagqccaamvqsiaapvdavwslvrrfdqp ch]vdgdga,evgsvreίllysglpaessrerίeirddem sfrvlggdhrlanyrs\1;t 4leaapsqdgφltmvvesyv /dvpp gntveetri fvdtivrcnlq slegtvirql eiaamphddnqn
SEQ ID NO:67
Zea mavs {194705858}
g iACF870mi mremssidqehqrgsssretapfaasrtsqqqhsrvatagravavcaghagv^
avwslvrrfdqpqrykrfirschlvdgdgaevgsvrelllvsglp^
dgφ] tmvvesyv vdvppgntveetri fvdti vrcn Iqslegtvirql ei aamphddn qn
SEQ ID NO:68
Phvsconiitretta pateas sabsa. patem {168039160}
mrnqekqgrpdfqf!legqqdlicrfhkhellphqcgsillqqikapvqtvwlivrrfdepqvykrfiqrcdivegdgvvgsirevq lvssipatssierleilddeeMisfrvlggg
qvseqkhllnsnekpaap
SEQ ID NO:69
Vlfe vksifera {157354734}
em^CAf i8052Jj,
mkvyspsqilaergpraqamgnlyhlhhllpnqcsslvvqt^
nivsglpaeislerldkldddlhvmrftviggdhrlany
kalaavtetmalkanipsgf
SEQ ID NO:70
PbvsemaitreMa eateas sabsp. patens {168030621}
mqqvkgrqdfqrlleaqqdliery ieikahqcgs^
ssvpatcsierleilddekhiisf gggMqnyssvsslheleveghpctivlesymvdipdgntreeth^
iseqqynkdclqqkqhdqqqmyqqrhpplppipitdknmer
SEQ ID NO:71
Ph s∞ro jn-eiia..paiess.. SMbsp....p&ieas {168028995
mifdighndvrgfficeeehayalhsqtvelnqcgsilmqqih^
sgvpatssierleilddekhvfsfrvlkgghrlqnyis\1t^
qvaewramqgitqqlstssl
SEQ ID NO:72
¾is. imftra {147840019}
mgnlyhthhllpnqcsslwqttdaplpqvwsmvr^^
hvmrf iggdhrlanyhstltUiedeedgvrktv^m^
SEQ ID NO:73
Ptcea siiebeasis {i 16785512}
gb|ABK23752 Jj
medlsswregramwlgnppseselvcrhhrhelqgnqcssflvkhira
nvnvksglpataseerleilddnehvfsikilggdhrlqnyss^
si advserlasqhhtell ert
SEQ ID NO:74
Soiaaam tHbereswat 78191398}
mnaiigfcgvekeyirklihlhepkenqcssflvkhirapvhh'wslvrrfdqpqkykpfisrciv
sterlellddeehilsvrivggdhrlmyssvisvhpevidg gtvvlesfvvdv egnlkdetcyfvealincnlksladiserv'av qdrtepidqv SEQ IB NO: 75
M dkagi! i ra»e;3tsila >2i7 5 i84!
g CI85952Ji
mmigceqqqy svietqy irrhhkh^
glpattsterleqlddeemlgirivggdhrlmyssi^
ermavqgrtdpininp
msgygcikmedeyirrhhrheirdnqcssslv^
tsterlellddeehifgmxivggdhrlkny^
qdrtepidrm
SEQ ID NO:77 mngnglssmeseyiniihrhepaenqcssalvkhikapvplw
tsterlelldddehilsmriiggdhrlmyssM
qdrtepidrm
SEQ ID NO:78
OrvKi saii a Jaisofska Gross 8 U 25597584 S
gb|EAZ 7364Ji
mealn-eralreglteeeraalepavmahhtfppsttt^^^
sfgsvrevtA'vsgpsrlppgterlemldddrhiisfrvvggqhrlmyrsvtsvtefqppaagpgpappycvvvesy aedtrmftdtwklnlqmlaavaedsssasrrrd
SEQ ID NO:79
Capsicum annaum {4?558817f
J^|AAT35532J !
mrr angfsgvekeyirldihlhqpkenqcssfl^
attsterlellddee sfriiggdhrlmyssm^
qdrtepidqv
SEQ ID NO:80
Papaias tricbocarpa {118481075}
mngsdaysateaqyvixhhkheprenqctsalvkhikapal^
attsterlellddeehilgvqivggdhrllmyssimtv^^
mavqdrvepvnqf
SEQ ID NO:81
CaesicusB anm-am {104304209}
innangfsgvekeyirldihlhc|pkenqcssflvk^^
sterlellddeehilsfriiggdhrlrnyssiismpev ^
tepidqv
SEQ ID NO:82 Popu!us tridtocarpa x Populus deitoldes 18489403)
mngsdaysateaqyyrrhhkheprenqctsalvkhto
attsterl ellddeehi Igv qwggdhrlkny ssimtv^
mavqdrvepvnqf
SEQ ID NO:83
Pim saiivwsa {56384584}
ablAAV85833.11
mnnggeqysaietqyirrrhkhdlrdnqcssalvkhikapvhlvwslvrrfdqpqkykpfvsrcimqg
pattsterl eql ddeehilgiri vggdh rimy ssvi tvhpevidgφgtmvi e sfwd' pegntrdetcyfvealirgnlssladvser mavqgrtdpinvnp
SEQ ID NO:84
Vitis_vinifera {157349888}
emb"lCA039744.1|
meaqvicrhhaheprenqcssvlvrhvkapanlvwslviTfdcjpqkykpfvsrcvvqgdlrigsvrevnvkig dddehvlgikildgdhrlmyssvitvh eiidg gtlviesfvvdv egntkddtcyfvralincnlkc^
anav
SEQ ID NO:85
Vlfe vksifera {147856414}
emb'|CAN8250 l
mmeaqvicrhhaheprenqcssvlvfhvkapanlvwslvrrfdqpqkykpfv'srcwqgdlrigsvrevnv
fdddehvlgikildg(ihrlmyssvitvhpeiidgφg^
panav
SEQ ID NO:86
Araehis by asses (196196276}
gbjA XL7 U )£Il
inmngscggggggeaygaieaqyirrhhrheprdnqctsalvkfa
evnvksglpattsterleqlddeehilgir^^^
sladvsermavqgrtdpinq SEQ ID NO:87
Zs?a mays {195639836}
mvvemdggygvaagggggaqtpapappmvrladercdlrametdyvrrfhrheprdhqcssavakhikapvhlvwslvnf dqpqlikpiVsreemkgnieigsvrevnvksg
vdvpdgnikdetcyfveallkcnlrslaevsegqvmidqtepldr
SEQ ID NO:88
Zea mavs {194691986}
g jAOilMlii
mvvemdggygvaaaggggaq^appppmvrladercdlrametdyvn-fhrheprdhqcssavakhikap^hlvwslynf dqpqlfkpfvsrcemkgnieigsyrevm/ksglpatrsterld^
vdvpdgnlkdetcyfveallkcnlrslaevsegqvimdqtepldr
SEQ ID NO:89
Orvaa sativa Japonic* Group {115468346} mngvggaggaaagklpmvshirvqwrladercelreeem
pfvracvmreniia%cirevnvqsglpatrsterleUddnehilkvn gdhmlknys
gntkddisyfienvlrcnlrtladvseerlanp
SEQ ID NO:90
Oryza saliva Issdka Group : - i;5 >¾ :
£b|EAZOU Ji
mngaggaggaaagklpmvshrqvqwrladercelreeemeyirqfhrhepssnqctsfvakhikaplqtvwslvrrf^ pfvrkcvmreniiaigcvrevnvqsglpatrsterlellddnehilkvkfiggdhmlknyssiltihsevidgqlgilv gntkddicyfienilrcnlmtladvseerlanp
SEQ ID NO:91
Oryza s l va Jamaic Gs¾a¾H1.25581 S25}
^!EAZ22456:jj,
mvevgggaaeaaagmvrladercdlfaaete rrfhfheprdhqcssavakhikapvUvwslvrrfdqpq kgmeigsvrevnvksglpatrsterleMdnehilsvriV^
fveallkcnlkslaevserlvcqgpnrapstr
SEQ ID NO:92
Oryza ssrtivs Japonica Gra S4455
mvevgggaaeaaagmvrladercdlraaete ^Tiinrh^
kgnieigsvrevnvksglpatrstefleliddnehilsvrfvggdM
fveallkcnlkslaevserlwkdqtepldr
SEQ ID NO:93
Meclka¾© tnincatala {2.17075288}
mekmngtenngvfhstemeyirrhhnqqpgenqcssa^
dvksglpattsterlevldiiehilsiriiggcihrlmyssimslhpe
dvseghavqdltepldrvhellisg
SEQ ID NO:94
Meclka¾© tnincatala {2.17071196}
gm
mekmngtenngvfhstemeyirrhbiiqqpgOT
dvksgipaftsterlevlddnehilsiriiggdhrlmyssi^
dvseghaaqdltepldrmhellisg
SEQ ID NO:95
Xea mays {I95S2S792)
ACC Z2 i
mvglvggstaraehvvanaggeaeyvrrmhrhaptehqctstlvkhikapvhlvvvqlvrrfdqpqrykpfvmcvvrgdqlev gslrdvnvktglpattsterleqldddlhilgvkfvggdhri^
kcnlnslaevseqlavesptslidq
SEQ ID NO:96
Zea mays {195608384
mvglvggstaraehvvanaggeaeyvTrmhrhaptehqcts^^ gslrdvnvktglpattsterleqldddlhilgvkfvggdhrl^^
kcnlns] aevseqlavesptslidq
SEQ ID NO:97
Zeis raavs a947041.SS¾
g l CF 6|62JI
mvmvemdggvgggggggqtpap vrladercdlrametxlyvrrn^
tkpfVsrcemkgnieigsvrevnvksglpatrsterld^
dgntkdetcyfveallkcnlkslaevserqvvkdqtepldr
SEQ IB NO:98
Orvza saliva Japonica Group {1J54683445
mngaggaggaaagklpmvshrrvqcrladkrcelreeemeyirqft^
pfV'rkcvmreniiv gcvrevnvqsglpalrsterlelldctaehilkvkfiggdhmlknyssiltih
gntkddicyfienvlrcnlmtladvseerlan
SEQ IB NO:99
is issavs Π9470.ί978>
(Μ ΠΙ
mvglvggstaraehwanaggeteyvir^
Irdvnvktgipal erleqldddlfailgykfvg
nlkslaevseqlavesptspidq
SEQ ID NO: 100
Orvza saiiva Indica Growp {125555585}
mngvggaggaaagklpmvsh 'qwriadercelreeemeyirrfc
pfvmcvmreaiiatgcirev^^
gntkddisyfienvlrcnlrtladvseerlanp
SEQ ID NO: 101
OrvKi saiiva Jaisosska Gross 8 mS462647!
mvglvggggwrvgddaaggggggavaagaaaaaeaehmrrlhshapgehqcssalvkhikapvhlvwslvrsfdqpqrykp fVsrcvvrggdleigsvrevm¼glpattsterleildddeh^
ntkdetcyfVeavikcnltslaevserlavqsptspleq
SEQ ID NO: 102
Oryxa saliva Japonica Gt¾up (5025 ½68|
dbilBAD29692.11
mvemdagg epsppsgqcssavtmrinap hlvwsi rrfeephifqpf^ gctorgstslavgc revdfksg aks leilddkehvfgvriiggdhrlknyssvliakpevidgepati^^
aeppaq
SEQ ID NO: 103
Vstis vinifera {147797548}
§mblCAN 68,. lJ,
mngnglssmeseyirrhhiliepaenqcssalvkhikapvplv slvrrfdqpqky^fisrcvv
tsterlelldddehilsmriiggclhrlmyssiislhpeiidgφgtø^
m SEQ ID NO: 104
Orras sasiva fedica Growp {2.18190432}
mvemdaggipepsppsgqcssavtmrinapvhlvwsivrrfeepMfqpfv^^
leilddkehvfgvriiggdhrlknyssvltakpevidgepa^
aeppaq
SEQ ID NO: 105
Oryza saiiva Japoska Group {125585934;
mpcipasspgipliqhqhqhhralagvgmaygcaaeaayaaagvagtrcgalidgevpmevarhhehaepgsgrccsa^vqh vaapaaavwswrrfdqpqaykrfvrscall^^
ves^'vdvppgntpedtrvfvdtivkcnlqslaktaeklaagaraags
SEQ ID NO: 106
heum asisirafe {197 1291 ?
gb| CH 237Ji
mngdgyggseeefvkryhehvladhqcssvlvehinaplhlvwsl\T¾fdqpqkykpfvsrc q
pattsmeelellddkehvlrvkfvggdhrlknyssivslhpeiig^
lavediaeriaqm
Figure imgf000094_0001
mvglvggggvvrvgddaaggggggavaagaaaaaeaehmn-lhsqgpmpvqlrarqa qgscsppriecanfavflaard kivwslvrsfdqpqr 'kpfvsrcvvrggdleigsvTevnv¾glpattsterlelldddehilsvkfvggdhrlmyssivtvhpesi gφgtlviesf dvpdgntkdetcyfveavikOTltslaemvITOislvφ
SEQ ID NO: 108
Oryza sali a J m ica Gross o ! i ;:¾»:¾;
mephmeralreavaseaerrelegvvrahhtgwnaplaavwphrarv^trsgtstsssrassppgdgatvgsvrevavvsglpa ststerleilddckhvlsfrvvggdhrlmyrsvte
atsssppaagnhh
SEQ ID NO: 109
Oryza sativa Japonica Gram U.2S581.S24}
mevvwsivrrfeephifqpfvrgctmrgstslavgcvrevdflcsgfpakssverleilddkehvfg
evidgepatlvsesfv'vdvpegntadetrhfveflircnlrslamvsqrlllaqgdlaeppgq
SEQ ID NO: 110
Qrrm aska Japorska Group {12 59 587^
{ Z i
mpytapφsp qhsriggcggggvlkaagaagha scva / aevarhhehaagygqccsavvqaiaapyda.vwrtstssgaa as\¥taMagplpvgsvrefrvlsglpgtssrerleiidde
tadetmifvdtivrcnlqslartaeqlalaapraa
SEQ ID NC):111 Vstis ymfes 1147770961}
ii li zkHiJ..
mpisslpfslytvtpnplklitthahaftphthiftlkfiTishtycphihhi^
nqhlqvalfsargpnirdfhfqdadllkldilapgsliwaawspn^
vapkgvnxavalyktkrtiqlktsleiae^
yqhvikseriedgfemmigxirdvniisglpta^^
aspkiesiividtskflneedfegkdetsssnqvqiedenwetrfpntdagiw
SEQ ID NO: 112
VKisjrinifera (147828564}
mpsaxksstyplslxqfk]glrhghryipwgdldsla.mlqrq]d^
vlmdidglrvwevyelidetaniikelto
Figure imgf000095_0001
fcpniyMnvapkgvnvavvtvktkrtiqlktsleiachyaginisgingevmpgqweyqvgpgqcsslk
vhrfdkpqryqhvikscriedgfemnngrMvniisgipte
ngpsehlktaax
SEQ ID NO: 113
Oryza sativa ίηύί ι Grossp |149392Θ53¾
eigswevnvktglpattsterlelldddeM
vikcnl
SEQ ID NO: 114
Zea mays ( 9 7 5 ?
mvvemdggygvaaaggggaqipapppp vrladercdlrame^^
dqpqlfltpfvsrcemkgnieigsvrevnvksglpatrsterleilddderilsvrfvggdhrlqvcsvlhlsifc^
leflcqmhldvlpcddaile
SEQ ID NO: 115
Oryza saiiva Jassofska Groses {125597 18;
mngctggaggvaagrlpavslqqaqwklvdercelreeemeyvrrih^
kpfVTkcvmrgnvetgsvreiivqsglpatrsierleflddneyilrv'kfiggdhmlkkripkktyai
itomggvsiqpwlillafFsspsnqtnpdslrdnihpgswfqillvlamftcskgsvlppsek- Tiv
SEQ ID NO: 116 (consensus sequence)
VGRxVxVxSGLPAxxSxExLxxxDxxxxxxxFxxxGGxHRLxNYxSVT
SEQ ID NO: 117 (consensus sequence)
VxESYxVDxPxGNxxxxTxxFxDxxxxxNLQxL
SEQ ID NO:118 (consensus sequence)
HxHxxxxxQCxSxLVKxIxAPxHxVVV^xVl RFDxPQKYKPFxSRCxVxGx
SEQ ID NO:119 (consensus sequence)
ExGxxREVxx SGLPATxSTExLExLDDxEHILxIxIxGGDHRLKNYSSxxxxI-IxExIxGxxGT x SEQ ID NO:120 (consensus sequence)
xxESFVVDVPxGNTKxxTCxFVExLIxCNLxSLAxxxERL
SEQ ID NO:121 (consensus sequence)
CxSxxVxTr¾ PLxLVWSlLR;rfDxPxxxxxFVKxCxxxSGxGG
SEQ ID NO:122 (consensus sequence)
GSVRxVTxVSxxPAxFSxERLxELDDESHVMxxSIIGGxHRLV YxSKT
SEQ ID NO: 123 (PEX4 promoter with added cloning sites in underlined italics)
GAGCrCCCACAACAGACCTGAAAGAGGCTGCAATAGTTGTCATAAGAATCAATC cfcfGCTTCAACGTCGGAGACAACCTCGCATACAAATGTCGAAACCACATCTCAC GGTACAGAAGACAGAACACATGGTCGTTGTCTACGTAAGGAGCAATCGCTTCCA CACTTGGCCACGGCGTGTCCTTGAACAGACGCTCCGATATGCTCTGGAACGATGT CTCACACATCTGGTGGATCTCGTACACGTTCTTATCCCTTATGTGTCTGTACATGT GTGACACGAACGACTTCACCGAATCCGGCACCATATTTGGGTCGTACCCACTCTC CCTCTCCCCCGGACCTTCCTCATACTCATTGCTGCTCGCCATTCTCGCCGGATCAA TTCTTAGCGGCCGCAACAATGTTAGCTCTTAACTCACTACCACCGCCTAGGGTTT CCTTATTACCACCGGTTCTATCATCCGGTTTCGTTrCCTTATTACCACCGGTTCTAT CATCXX JTTATGTTTTTTTATAAAGTCATTTTAATAAAACTTTCTATGGTTCGGAA AAAAAAAACTTCACATAATCATCGCTATTCTCTCTCTCTCTCTCTCTCTCTCTCTCT CTCGCTCTCATATTTGCAGGTAAAGCTTCGTTGATTCGTCCTCTTTATGTTCAATT ATAGTTTCGCATCCCTCCTATGTCTTTCTTTCTAGATCTTAAAGCAGAGTCATTGC TTAACCCTAATTATCACTCTTCT GTATAAAACACTTTTCACCTAATCATTGAGAT
I'GT I'ACGGGA Γ( Ί GA ΓΛ Λ'Π GCGTC 1 GTGA AT TACA AGAAA 1 TAGGG Π 'ΓΛ 1 ΊΊ C TTCTTGATTTTAGATTGATCTTTTTGCAGTTGACAATTCGTrCTCTTTGGGAAATT AGAGCCCGGG
SEQ ID NO:124 (MAPKKK18 5'-UTR with added cloning sites in underlined italics)
CJG JAAACATTCAAAAAAAAAAAAAAACCATTTTTTTTTTCTTACTCAAATCT TTTTTAGTATCATTCTCCA.A CCGGT
SEQ ID NO:125 (To71 5'-UTR with added cloning sites in underlined italics)
C GGGGTATTTTTACAACAATTACCAACAACAACAACAAACAACAACAACATT ACATTTTACATTCTACAACTACA -1 CCGGI'
*EcoRI /Mfel, XmaT/Agel, Xhol/Sall, BamHI/Bglll pairs produce compatible end.
SEQ ID NO: 126 (pMANDI-UAS-GFP T-DNA region; annotations following end of sequence)
GGTnACCXOCCAATATAT CTGTCAAACACTGATAGTTTAAACTGAAGGCGGGA
AACGACAATCTGATCATCAG
··:; \ -ι · ΐ : ; ·■ : ; : \■ ;■ : x ; Γ ; : ·: Ki ■ ATGAC tX'CCGCAGTT'GCAA'l GAC CTTA
GCRAGOAGCCAACACCATGTG rGAATCA'K'ACC G rt' A TCAC r G TAAA GAACGTTAC'^
GAACAGGATTTGTTGAAAACTTTATCCGATACGAGAAG{X}GGTCTTCCAATGTTT 'TTG ATG A AG ACG ATCTATTGTC GTTGTGG AGG ATA ATAGTGC'TGTC ATA AGTG A GG TI-JD^
GAAATAGATAACGGGCGAGTC ATrGAGCA(X}lixCCAC¾
CAAGGGAATGCGTCTGAGATGGAGGCTCCTTTTCCCGTGTCACCTCATTTTCTGA AAC"T'ACCCATCAAAATGCTT'ATGGGGGACCATGAGGGTA'7XJAGTCCAAGCCTCA C AC ACC'TC AC AGGTC A'TTTTf TCGGTGTTT ATGA TGGTC'ATGG AGGCC ATA AGGT TGCiGAC'i ATTGCCGAGA! AGAC
ATA AAAGACGA A n A
GCATAAAC^^
ATTGGTAGAGC(!GTTGTTGGTrCTT(ITGATAAGGTTCTTGAGG( GTTGCGGATG AGACCGTAGGATC!AAC GCrGTTGTrGCCTrGGTTTCCTCATCACATATAGTAGTT TCTAACTGCGGTGATrCGAGGGCGGTriTATrCCGTGGCAAAGAAGCCATGCCCT TCTCAGTTGATCACAAACCAGATAGAGAGGATGAATATCCAAGAATAGAAAATG
iGGAGGCAAACT
GTCTAGG†CCAT GG†GACAGA†AT
CGGTCTTTGGGATGTAATGAACAACCAAGAAGTCTGCGAAATAGCAAGGAGACG GATATTCATGTGGCACAAGAAGAACGGTGCACCGCCTCTAGCAGAGAGAGGCAA AGGAATAGATCCAGCTT'GCCAAGCCGCAGCLXJAC'TACCTCTCAA'RGCTT'GCTCTA CAAAAAGGAAGTAAAGACAACATCTCCATCA'ITGTGATRGACTRGAAAGCTCAA G AAAC iTCAAGACCAGA C
GAAAGTCAACA
A€X G€3GAGA€GTTAAG€3AT€:™
GGAGAGGAAGAGGAA CTAGCTCAAAA€CTAAGAAAC€AAAGGTC €ACT€TC CTAGGTCGAGGCgaataccccgatcgticaaaca¾tggcaai&aagi^
<r Λ ί ' rT'
AGATCGGGAATTAATTiXjATAAGCTAGAGAGAATTGGC
Figure imgf000098_0001
lAGATCCTAGGTCGAGGCgaatttccccgaicgitcaaacatitggca
3iaasgaacia¾¾g3i†g¾3K:ctgUgccggKUgcga g
aigcateacgtaniiaigagatgggtUSa^
ctagaiaaiiiiaicgcgigcggigteaicia^
AACA TGGTGGA GCACGA GA CGCTTGTC7 CTCGAAAAA TA TGAAAGA TAG A GTCTCAGA AGAGGAAA GGGCAA TTGAGA G:rrnX:AA GAAAGGG7AA rA:n^
ΊΧΧ ΊΎ<}'€€€Α <}'€ΤΑΤ€ΊΌΤ€Α€ΤΓΓΑΤΓΟΤΌΜ
TAG:AAXi GGGA lX;A:rTGGGA:i AAA G
GTGGT XXAAAGATGGA CCCCC^CCCACGA G<UGCATCGIGG AGAAGA CG7^TC
CXACJAA rCCCACTA JGCT'IGGGAAGA CGGJTGCJGJATA TAA GGAAGT7GA TT7GA TTTG
Figure imgf000099_0001
Cigcagatogfteaaacaiftggcaataaagitte^
gtiaagcaigiaaxaatiaacsxgiaaigca^
aaaaaacaaaaiaiagc¾cgcaaacu¾g¾ataa.a†iato^
CGAATTAATTCACTGGCCGTC
TTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAG CGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGC
CCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTC
AAGCTC AAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCT
{:GAC(:CCAAAAAACTTGATTTGGGTGATGGTTCACGTAGTGGG(:CATCGCCCTGA
TAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTT
GTTCCAAACTGGAACAACACTCAACCCTATCTCGGGCTATTCTTTTGATTTATAA
GGGATTTTGCCGATTTCGGAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCA
AACCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAA
TCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCCAGTACATTAAAA
ACGTC(:GCAATGTGTTATTAAGTTGTCTAAG(:GTCAATTT(5TTTA<
Annotations:
35S PROMOTER
terminator
Figure imgf000099_0002
Figure imgf000100_0001
SE( ID NO:127 (pMANDI-UAS-GFP-LEAFY; annotations following end of sequence) GGTnACCCGCCAATATATCCTGTCAAACACTGATAGTTTAAACTGAAGGCGGGAAACG
Figure imgf000100_0002
GAAGCAOA€€AAOAAmAGAAT AAGATCCTAGGTCGAGGCg¾atitccccg¾k.gtica 3£ tsti SC8 au;aagU¾img&iigaa†ccig¾gc¾
Figure imgf000101_0001
AACAGCTCCGGAGTACTGTCCTCCGAGCGGAGTACTGTCCTCCGAGCGGA GTACTGTCC?
Figure imgf000101_0002
GACCCTGAAGGTTTCACGAGTGGCTTATTCCGGTGGAACCCAACGAGAGCATTGGT TCAAGCACCACCTCCGGTTCCACCTCCGCTGCAGCAACAGCCGGTGACACCGCAGA
Figure imgf000101_0003
aacaia':ggcaaiaaagUk:iiaag igpa¾^
s¾3igcai a gia«U igagaigg kaa tgak^
Cusaia cgcgcgcggsgsc¾ a¾iiACTAGATCGGGAATTAATTCG
CTCGC-'I TGCCIXiCA GGTCCCCA GA TTA GCGT1TTCAA TTTGA GAAA GAA TGGTAA GGGA CA OA T GGTTTA GA GA GGCTTA GGGA GGA GGTGTGA TCAA GA GG i TGTA GGGGA GGAA TAA TCl'CCA GG AAA TGUA TA GGTTGGGAA GAA GGTTAAA GA TGGA TGAAAA A TTGA GGAGTAA GTGGA TCAA G AA GAGA CA GAAA GA ΊΑ TA TTTCTCAA GA TGA GAA GT4 GTA TTGCA GTA TGGA GAG TTCAA GGGTT GCTTGA GAAA CG4A GGGA A GTA A T4 CA CA TTGGA GTGTGTAAAAA GAGA GTTGCGA CTGAA TGA AAGGCGA TGGA GTCAAA GA TTGAAA TA GA GGAGCTAA GAGA A GTCGCGCTAAAGAGTGGGGAA CA GTTGA TA CA GA GTCTCTTi GGA CTGAA TGA GAA GAA GAAAA TGTTCGTCAA CA TGGTGGA GG A GGA CA CGCTTGTCT4 CTCCAAAAA TA TCAAA GA TA CA GTCTCAGAA GA GGAA A GGGGA ATTGA
Figure imgf000102_0001
Figure imgf000102_0002
CGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGC
ACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCA
ACAGTTGCGCAGCCTGAATGGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCAC
GTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGT
GCTTTACGGCACCTCGACCCCAAAAAACTTGATTTGGGTGATGGTTCACGTAGTGGGCCA
TCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGAC
TCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGGCTLATTCTTTTGATTTATAAGG
GATTTTGCCGATTTCGGAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGC
GTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCC GTCTCACTGGTGAAAAGAAAAACCACCCCAGTACATTAAAAACGTCCGCAATGTGTTATT AAGTTGTCTAAGCGTCAATTTGTTTACACCACAATATATCCTGCCAC
Annotations:
T-DNA BORDER
Figure imgf000103_0001

Claims

WHAT IS CLAIMED IS:
1. A plant or a cell comprising a heterologous expression cassette, the expression cassette comprising a promoter operably linked to one or more polynucleotides encoding a first polypeptide comprising a mutated PYR/PYL receptor polypeptide and a second polypeptide comprising a mutated type 2C protein phosphatase (PP2C), wherein the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and wherein the mutated PYR/PYL receptor polypeptide comprises one or more mutations that disnipts binding to a wild-type PP2C, wherein the mutated PP2C comprises one or more mutations that disrupts binding to a wild-type PYR/PYL receptor polypeptide, and wherein the mutated PYR/PYL receptor polypeptide and the mutated PP2C interact with each other.
2. The plant or cell of claim 1, wherein the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61, 162, K63, 184, S85, G86, L87, P88, A89, HI 15, R116, LI 17, P148, G150, N151, D155, T156, M158, F159, T162, or ΚΓ70 in PYR1 (SEQ ID NO: l).
3. The plant or cell of claim 2, wherein the one or more mutations in the PYR/PYL receptor polypeptide that disrapts binding to a wild-type PP2C comprises a mutation selected from F61 D E/G H/I/ /N/P/Q R/ S, I62D E/G K R/W /Y, K63P, I84L, S85A/C/D/E/F/G/FL/I/I yL/M/N/P/Q/R VAV/ r,
G86A/C/D/E/F/fM/K/L/l^
P88C/D/E F/G/H/
H 1 15 A/C/D/E F/G I/K/IJM/P/Q/R/S/TA^AV/Y, R 1 16A/C D E F/G/H/I/P/S T/V W Y, L117A/D/E/G/H/K/N/P/Q R/S T/VA\ Y, P148C/D/E F/G/H/I/K/L/M /Q/R/S/TA /W/Y, G150I/N/V/W, N 151C/D/E/F/G/ /K/L/M^/Q/R/ 7W/Y,
D 155 C/T/G/L' /L/M/P/R./V /W/Y, T 156E/F/G/H/I/K/IJM/N/P/Q/R W Y, M 158P,
F159D E G/H/K/N/P/Q/R/S/W Y, T162D/E/F/P, or ΚΓ70Ρ.
4. The plant or cell of claim 2 or 3, wherein the one or more mutations in die PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation at an amino acid corresponding to position F61, S85, T156, or T162 in PYR1.
5. The plant or cell of claim 4, wherein the one or more mutations in the PYR/PYL receptor polypeptide that disrupts binding to a wild-type PP2C comprises a mutation selected from F61K, S85P, T156P, and T162D.
6. The plant or cell of any of claims 1 to 5, wherein the one or more mutations in the PP2C that disaipts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E201, E203, H245, G246, G247, E323, K381, 1383, W385, R389, F391, G392, V393, or Y404 in HABl (SEQ ID NO: 22).
7. The plant or cell of claim 6, wherein the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E201H/K, E203A/OD/F/G/m/¥JL/mifP/R/Sn:/V/W/Y,
H245A/r:/D/E, F/G/l, IUL/M P/Q/R/S/TAW/Y,
G246A/C/D/EyF/H/I/K/L/]^
E323L, K381W, 1383D/E/G/¾'K/N/P/Q/R''S/rAV/ r,
W385A/C, i3/F/F/G/H, l/K/L/]Vl/N/P/Q
R389A/C/D/E/F/G/H/I/T<yL/M/P/Q/T/VA r Y, F391 D/E/P,
G392A/D/C/E/T/I /K/L/M WP/Q/R'TA^/W/Y, V393 D E G K N/P/Q R S, or
Y404D/E/G/K/ /P/Q/R/S/T.
8. The plant or cell of claim 6 or 7, wherein the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation at an amino acid corresponding to position E203, 1383, or V393 in HABl .
9. The plant or cell of claim 8, wherein the one or more mutations in the PP2C that disrupts binding to a wild-type PYR/PYL receptor polypeptide comprises a mutation selected from E203D, E203T, E203W, I383G, V393K, V393R, or V393Q.
10. The plant or cell of any of claims 1 to 9, wherein:
(a) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to F61 K in PYR1 and the mutated PP2C comprises a mutation corresponding to V393Q in HAB l; (b) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYRl and the mutated PP2C comprises a mutation corresponding to E203D in HAB 1:
(c) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYRl and the mutated PP2C comprises a mutation corresponding to E203T in HAB1:
(d) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to S85P in PYRl and the mutated PP2C comprises a mutation corresponding to E203W m HAB l;
(e) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to T156P in PYRl and the mutated PP2C comprises a mutation corresponding to I383G in HAB 1 ;
(f) the mutated PYR PYL receptor polypeptide comprises a mutation corresponding to T162D in PYR l and the mutated PP2C comprises a mutation corresponding to V393K in HAB 1; or
(g) the mutated PYR/PYL receptor polypeptide comprises a mutation corresponding to T162D in PYRl and the mutated PP2C comprises a mutation corresponding to V393R in HAB l .
1 1. The plant or cell of any of claims 1 to 10, wherein the orthogonal ligand is mandipropamid.
12. The plant or cell of claim 1 1, wherein the mutated PYR PYL receptor polypeptide further comprises a mutation at one or more amino acids corresponding to positions Y58, K59, V81, A89, F108, S122, M158, F159, or A160 in PYRl (SEQ ID NO: 1), wherein the mutation is selected from Y58H, K59R, V81C, V81I, V81T, A89W, F108A, F108C, F108E, F108G, F108T, F108L, F108N, F108Q, F108S, F108T, F108V, S122G, M158I, Ml 58V, F159A, F159C, F159I, F159L, F159M, F159T, F159V, A160C, A 160V, or combinations thereof.
13. The plant or cell of any of claims 1 to 12, wherein the mutated PYR/PYL receptor comprises:
(a) mutations corresponding to Y58H, K59R, V81I, F108A, SI 22G, M158I, F159V, A160V, and T162D in PYRl; (b) mutations corresponding to Y58H, 59R, V81I, F108A, S122G, M158V, F159V, A160V, and T162D in PYR1: or
(c) mutations corresponding to Y58H, K59R, V81I, F108A, S122G, Ml 581, F159V, A 160C, and T162D in PYR1.
14. The plant or cell of any of claims 1 to 13, wherein the mutated PP2C further comprises one or more mutations that disrupts the catalytic activity of the mutated PP2C.
15. The plant or cell of claim 14, wherein the mutated PP2C comprises a mutation at one or more ammo acids corresponding to positions R199, D204, S322, or R505 in HAB1 (SEQ ID NO:22) wherein the mutation is selected from R199A, D204A, S322D, S322E, R505A, or combinations thereof.
16. The plant or cell of any of claims 1 to 15, wherein the mutated PP2C comprises:
(a) mutations corresponding to D204A, V393R, and R505A in HAB 1; or
(b) mutations corresponding to R199A, D204A, S322D, V393R, and R 05A in HAB 1.
17. The plant or cell of any of claims 1 to 16, wherein the mutated PYR/PYL receptor polypeptide is substantially identical to any of SEQ ID NOs: 1-14, 19-21, or 41-115.
18. The plant or cell of any of claims 1 to 16, wherein the mutated PP2C is substantially identical to any of SEQ ID NOs:22-31.
19. The plant or cell of any of claims I to 18, wherein the first polypeptide comprises the mutated PYR/PYL receptor polypeptide fused to a transcriptional activation domain and the second polypeptide comprises the mutated PP2C fused to a DNA binding domain.
20. The plant or cell of any of claims 1 to 18, wherein the first polypeptide comprises the mutated PYR/PYL receptor polypeptide fused to a DNA binding domain and the second polypeptide comprises the mutated PP2C fused to a transcriptional activation domain.
21. The plant or cell of claim 19 or 20, wherein the promoter comprises a polynucleotide sequence that binds the DNA binding domain.
22. The cell of any of claims 1 to 21, wherein the cell is a plant, animal, mammalian, fungal, or bacterial cell.
23. A plant cell from the plant of any of claims 1 to 21.
24. A seed, flower, leaf, fruit, processed food, or food ingredient from the plant of any of claims 1 to 21.
25. A method of activating an ortliogonal PYR/PYL-PP2C interaction in the plant or cell of any of claims 1 to 24 by contacting the plant or cell with the orthogonal ligand, wherein the step of contacting the plant or cell with the orthogonal ligand activates an interaction between the mutated PYR/PY L and the mutated PP2C but does not significantly activate an endogenous abscisic acid (ABA) signaling pathway in the plant or cell.
26. A method of controlling gene, protein, or phenotype expression in the plant or cell of claim 21 , the method comprising contacting the plant or cell with an ortliogonal ligand, wherein the step of contacting the plant or cell with the orthogonal ligand activates an interaction between the mutated PYR/PYL and the mutated PP2C, thereby associating the DNA binding domain and the transcriptional activation domain and activating expression of the gene, protein, or phenotype.
27. An expression cassette comprising a promoter operably linked to one or more polynucleotides encoding a mutated PYR/PYL receptor polypeptide and a mutated type 2C protein phosphatase (PP2C), wherein the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal ligand that does not significantly agonize a wild-type PYR/PYL receptor polypeptide and wherein the mutated PYR/PYL receptor polypeptide comprises a mutation that disaspts binding to a wild-type PP2C, wherein the mutated PP2C comprises a mutation that disrupts binding to a wild-type PYR/PYL receptor polypeptide, and wherein the mutated PYR/PYL receptor polypeptide and the mutated PP2C interact with each other.
An expression vector comprising the expression cassette of claim 27.
29. An isolated nucleic acid comprising a polynucleotide encoding a polypeptide comprising a mutated PYR/PYL receptor polypeptide fused to a transcriptional activation domain or a DNA binding domain, wherein the mutated PYR/PYL receptor polypeptide is agonized by an orthogonal ligand that does not significantly agonize a wild- type PYR PYL receptor polypeptide and wherein the mutated PYR/PYL receptor polypeptide comprises a mutation that disrupts binding to a wild-type PP2C.
30. An isolated nucleic acid comprising a polynucleotide encoding a polypeptide comprising a mutated type 2C protein phosphatase (PP2C) fused to a transcriptional activation domain or a DNA binding domain, wherein the mutated PP2C comprises a mutation that disrupts binding to a wild-type PYR/PYL receptor polypeptide.
31. An expression vector comprising the isolated nucleic acid of claim 29 or 30.
PCT/US2017/024153 2016-03-25 2017-03-24 Mutant proteins enabling agrochemical control of plant gene expression Ceased WO2017165855A2 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US16/087,024 US10919943B2 (en) 2016-03-25 2017-03-24 Mutant proteins enabling agrochemical control of plant gene expression

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662313290P 2016-03-25 2016-03-25
US62/313,290 2016-03-25

Publications (2)

Publication Number Publication Date
WO2017165855A2 true WO2017165855A2 (en) 2017-09-28
WO2017165855A3 WO2017165855A3 (en) 2017-11-02

Family

ID=59900782

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/024153 Ceased WO2017165855A2 (en) 2016-03-25 2017-03-24 Mutant proteins enabling agrochemical control of plant gene expression

Country Status (2)

Country Link
US (1) US10919943B2 (en)
WO (1) WO2017165855A2 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN113773373A (en) * 2021-10-12 2021-12-10 成都齐碳科技有限公司 Mutant of porin monomer, protein pore and application thereof
US11603537B2 (en) 2017-09-30 2023-03-14 Cas Center For Excellence In Molecular Plant Sciences Method for improving rice yield by jointly knocking out ABA receptor PYL family genes and use thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025072302A1 (en) * 2023-09-25 2025-04-03 Monsanto Technology Llc Methods for regulating self-incompatibility for generating hybrids

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN106434739A (en) 2009-02-13 2017-02-22 加州大学董事会 Agricultural chemical preparation for controlling plant resistance
AR081242A1 (en) * 2010-04-28 2012-07-18 Univ California MODIFIED PYR / PYL RECEPTORS ACTIVATED BY ORTOGONAL LIGANDS
KR20140056251A (en) * 2011-07-01 2014-05-09 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 Constitutively active aba receptor mutants
EP2970996B1 (en) * 2013-03-14 2019-08-21 The Regents of The University of California Modified pyr/pyl receptors activated by orthogonal ligands
WO2016043985A1 (en) * 2014-09-17 2016-03-24 The Regents Of The University Of California Modified plant water use by cell type expression of pyr/pyl proteins

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11603537B2 (en) 2017-09-30 2023-03-14 Cas Center For Excellence In Molecular Plant Sciences Method for improving rice yield by jointly knocking out ABA receptor PYL family genes and use thereof
CN113773373A (en) * 2021-10-12 2021-12-10 成都齐碳科技有限公司 Mutant of porin monomer, protein pore and application thereof
CN113773373B (en) * 2021-10-12 2024-02-06 成都齐碳科技有限公司 Mutant of porin monomer, protein hole and application thereof

Also Published As

Publication number Publication date
US20190389914A1 (en) 2019-12-26
US10919943B2 (en) 2021-02-16
WO2017165855A3 (en) 2017-11-02

Similar Documents

Publication Publication Date Title
Li et al. The Arabidopsis F‐box E3 ligase RIFP1 plays a negative role in abscisic acid signalling by facilitating ABA receptor RCAR3 degradation
US10221426B2 (en) Constitutively active PYR/PYL receptor proteins for improving plant stress tolerance
EP2563113B1 (en) Modified pyr/pyl receptors activated by orthogonal ligands
CN107207573A (en) Super quick ABA acceptors
US10704056B2 (en) Constitutively active ABA receptor mutants
EP2970996B1 (en) Modified pyr/pyl receptors activated by orthogonal ligands
US10919943B2 (en) Mutant proteins enabling agrochemical control of plant gene expression
US20170088851A1 (en) Methods for improving abiotic stress response
US20250197880A1 (en) Engineered phosphoenolpyruvate carboxylase enzymes
WO2016071829A1 (en) Methods for monocot plant improvement
US11414673B2 (en) Hypersensitive ABA receptors having modified PP2C-binding interfaces
US11618903B2 (en) Methods for improving plant abiotic stress tolerance and yield
WANG GENETIC DISSECTION OF THE JASMONATE PATHWAY IN ARABIDOPSIS
NZ618916B2 (en) Constitutively active aba receptor mutants
OA16804A (en) Constitutively active ABA receptor mutants.

Legal Events

Date Code Title Description
NENP Non-entry into the national phase

Ref country code: DE

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17771296

Country of ref document: EP

Kind code of ref document: A2

122 Ep: pct application non-entry in european phase

Ref document number: 17771296

Country of ref document: EP

Kind code of ref document: A2