WO2017158168A1 - Inhibitors of talin-vinculin binding for the treatment of cancer - Google Patents
Inhibitors of talin-vinculin binding for the treatment of cancer Download PDFInfo
- Publication number
- WO2017158168A1 WO2017158168A1 PCT/EP2017/056410 EP2017056410W WO2017158168A1 WO 2017158168 A1 WO2017158168 A1 WO 2017158168A1 EP 2017056410 W EP2017056410 W EP 2017056410W WO 2017158168 A1 WO2017158168 A1 WO 2017158168A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- talin
- compound
- seq
- vinculin
- peptide
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/10—Tetrapeptides
- C07K5/1002—Tetrapeptides with the first amino acid being neutral
- C07K5/1016—Tetrapeptides with the first amino acid being neutral and aromatic or cycloaliphatic
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- the present invention relates to the fields of medicine and cancer. BACKGROUND ART
- Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors may be benign (not cancerous), or malignant (cancerous). Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas.
- Treatment decision-making for cancer takes into account the stage and biology of the tumor, the risks vs. benefits of planned therapy, the wishes of the characteristics patient regarding treatment, and the economic costs associated with therapy.
- the best approach to treat cancer provides a balance between therapeutic effectiveness and minimization of treatment- associated side effects.
- Successful pharmacotherapy of solid tumors remains an unfulfilled medical goal.
- the identification of novel cellular targets, and the availability of increased numbers of potential therapeutic agents chemotherapy often fails because adequate cytotoxic concentrations are not achieved.
- anticancer drugs must gain access to all viable cells within the tumor in sufficient concentrations to cause lethality.
- many solid tumors have a poorly formed blood vascular system with variable rates of blood flow and much larger intercapillary distances than those found in normal tissues.
- WO95/20601 discloses a peptide, pVIN12.1 , which competes with talin for the binding to vinculin.
- the present inventors have analyzed the behaviour of talin and vinculin, in a cell model which, under specific force conditions applied thereon, simulates the cell found in a rigid tissue such as a solid tumor.
- the present inventors have found that when the interaction between talin and vinculin is disrupted, no YAP translocation occurs, being found in the cytosol. In addition, the present inventors have also found that tissue rigidity triggers talin unfolding.
- YAP (Yes-associated protein), also known as YAP-1 or YAP65, is a potent oncogene, which is amplified in various human cancers, and it is one of the two main effectors of the Hippo tumor suppressor pathway. Its proliferative and oncogenic activity is driven by its association with the TEAD family of transcription factors, which up-regulate genes that promote cell growth and inhibit apoptosis.
- TEAD family of transcription factors, which up-regulate genes that promote cell growth and inhibit apoptosis.
- YAP and TAZ are phosphorylated on a serine residue and sequestered in the cytoplasm by 14- 3-3 proteins.
- YAP1/TAZ enter the nucleus and regulate gene expression. The translocation of YAP into the nucleus has been widely disclosed in the prior art as contributing in derregulating the cell proliferation, death, and migration, which turns the cell a tumoral/cancerigen cell.
- an inhibitor of the interaction talin-vinculin can be useful in the treatment of a solid cancer. In this way, if a subject is diagnosed of cancer, it can be treated with an inhibitor of talin-vinculin interaction in such a way that said inhibitor "sequesters" the YAP protein already present in the cytosol and avoids its translocation to the nuclei.
- the present invention provides a compound inhibiting the interaction between talin and vinculin for use in the treatment of a solid cancer.
- This aspect can be alternatively formulated as the use of a compound inhibiting the interaction between talin and vinculin for the manufacture of a medicament for the treatment of a solid cancer.
- This aspect can also be formulated as a method for treating a solid cancer, the method comprising the step of administering a therapeutically effective amount of a compound inhibiting the interaction between talin and vinculin, to a subject in need thereof.
- VD1 has already been disclosed as dominant over endogenous vinculin for talin binding (Hirata, H. et al., "Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions" Am. J. Physiol. Cell Physiol. 306, C607-620 (2014)) but prevents normal vinculin function (Cohen, D.M. et al., "A conformational switch in vinculin drives formation and dynamics of a talin-vinculin complex at focal adhesions", J. Biol. Chem. 281 , 16006-16015 (2006)) due to the lack of remaining functional domains.
- VD1 a well-known inhibitor of talin- vinculin interaction
- tissue rigidity something characteristic of solid tumors, triggers talin unfolding.
- talin is a cytoskeletal protein having vinculin binding site. Under health physiological conditions, talin is folded and this vinculin binding site is of difficult access for vinculin.
- talin unfolds and exposes the vinculin binding site. Consequently, there is a stronger interaction between talin and vinculin, and as a consequence of the interaction, YAP protein translocates to the nucleus and contributes to cell proliferation, death and migration deregulation.
- the present inventors have also identified the specific talin-1 domain involved in the interaction with vinculin.
- the talin-1 domain involved in the interaction with vinculin is the "R3" domain (positions 787-91 1 of the talin-1 mouse full-length sequence protein available in Uniprot database with the accession number P26039, July 27, 201 1 , version number 2).
- Mouse talin-1 protein sequence is 100% homologous to human talin-1 protein sequence. Therefore, the results provided below support also the identification of the domain specifically involved in the interaction with vinculin in the human talin-1 protein sequence.
- the present inventors have developed a new peptide with the ability of binding to the R3 region of talin and which shows anticancer activity in several types of solid tumors, such as pancreas, prostate or colon cancer.
- the tests provided below show that even when the peptide is conjugated to a voluminous group in comparison to the peptide, such as rhodamine, it shows a remarkable anticancer activity, which is indicative of the therapeutic potency of the peptide of the invention .
- the present invention provides a peptide or a pharmaceutically acceptable salt of formula (I) X Xz-Xa Q (I) wherein
- Xi represents a compound of formula (II)
- Ri is selected from the group consisting of -H, -C(O)-(CrCi 0 )alkyl, and a detactable label;
- R 2 is selected from -H, (CrC 5 )alkyl, (C 2 -C 5 )heteroalkyl, and a known ring system having from 5 to 6 carbon atoms, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; and the ring system being optionally substituted by one or more radicals
- R 3 is a ring system having from 5 to 6 carbon atoms, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; the ring system being optionally substituted by one or more radicals independently selected from the group consisting of -OH, halogen, (CrC 5 )alkyl, (C C 5 )haloalkyl, and -O-(C C 5 )alkyl; and
- the wavy line represents the site through which X-, binds to X 2 ;
- X 2 is a basic amino acid
- X 3 is a compound of formu
- R 4 is a known ring system having from 5 to 6 members, the members being selected from C, CH, CH 2 , N, NH, O, and S, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; and the ring system being optionally substituted by one or more radicals independently selected from the group consisting of -OH, halogen,
- the wavy line represents the site through which X 3 binds to Xi and X 2 ;
- X 4 represents a compound of formula (IV):
- R 5 is selected from the group consisting of -NHR 6 , and -OH;
- R 6 is selected from -H and (C -C 10 )alkyl
- n is an integer value which is 1 or 2;
- the wavy line represents the site through which )Q binds to X 3.
- the present invention provides a conjugate comprising the peptide as defined in the first aspect of the invention.
- the present invention provides a peptide as defined in the second aspect of the invention or the conjugate as defined in the third aspect of the invention for use as a medicament.
- FIG. 1 Quantification of nuclear/cytosolic YAP ratio (n > 20 cells) in Talin 1 -/- MEFs cells (a) and Talin 1 -/- MEFs cells transfected with Talin 2 shRNA (b) plated on fibronectin-coated polyacrylamide gels of increasing rigidity
- FIG. 3 Nuclear/cytosolic YAP ratios (b, n > 20 cells per condition) on fibronectin-coated gels of increasing rigidity by talin 2 shRNA cells (a) or talin 2 shRNA cells co-transfected with FL Talin 1 (b) or FL talin 1 IWI (c).
- the present invention provides a compound inhibiting the interaction between talin and vinculin for the treatment of a solid cancer.
- a therapeutically effective amount refers to the amount of a compound that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disease which is addressed.
- the particular dose of compound administered according to this invention will of course be determined by the particular circumstances surrounding the case, including the compound administered, the route of administration, the particular condition being treated, and similar considerations.
- the term "treatment" when referred to solid tumors includes partial or total inhibition of the cancer growth, partial or total destruction of the cancer cells, prevention of the onset of clinically evident cancer, prevention of the onset of a preclinical ⁇ evident stage of cancer in individuals at risk, prevention of initiation for malignant cells and the reversion of the progression of premalignant cells to malignant cells, among others.
- Talin is a high-molecular-weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts. It is capable of linking integrins to the actin cytoskeleton either directly or indirectly by interacting with vinculin and alpha-actinin.
- Talin consists of a large C-terminal rod domain that contains bundles of alpha helices and an N- terminal FERM (band 4.1 , ezrin, radixin, and moesin) domain with three subdomains: F1 , F2, and F3.
- the F3 subdomain of the FERM domain contains the highest affinity integrin-binding site for integrin ⁇ tails and is sufficient to activate integrins.
- Talin also has a middle domain, which has a structure consisting of five alpha helices that fold into a bundle. According to recent publications, this protein comprises several vinculin binding sites (Bass M. D. et al., "Further characterization of the interaction between the cytoskeletal proteins talin and vinculin", Biochem. J., 362, 761 -768, 2002;
- talin-2 protein is similar to talin-1 , and is relatively similar (74% identity, 86% similarity); the size of the talin-2 gene (200 kb) is however much larger than that of talin-1 (30 kb), due to differences in intron size.
- talin protein refers to either “talin-1 protein” and “talin-2 protein”.
- Human talin-1 protein shows a high homology with the talin-1 protein isolated from other organisms, such as mouse (Uniprot database accession number P26039, July 27, 201 1 , version no. 2) and chicken (Uniprot database accession number P54939, November 8, 2005 version no. 2), among others; and, analogously, human talin-2 protein shows high homology with talin-2 protein isolated from other organisms, such as mouse (Uniprot database accession number Q71 LX4, July 27, 201 1 , version no. 3).
- Vinculin is a membrane-cytoskeletal protein in focal adhesion plaques that is involved in linkage of integrin adhesion molecules to the actin cytoskeleton.
- Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane.
- the Uniprot accession number of human protein is P18206, January 23, 2007, version number 4.
- Vinculin peptides have also been disclosed in other animals such as mouse (Uniprot database accession number Q64727, January 23, 2007, version number 4) and chicken (Uniprot database accession number P12003, January 23, 2007, version number 4), among others, all of them showing a substantial matching with human vinculin.
- the compound inhibiting the binding talin-vinculin is a peptide, a small molecule, or an antibody.
- the present inventors have found that when the cell suffers forces of the same magnitude as those suffered in a rigid tissue such as a solid tumor, talin protein unfolds and the vinculin binding sites are available for vinculin protein.
- the compound binds to talin protein.
- the compound binds to either talin-1 or talin-2 sequence portion comprised from 400 to 2541 , the positions being in respect to the protein sequence available in Uniprot database provided above.
- the compound binds to a vinculin binding site of talin protein. In another embodiment, the compound binds to the vinculin binding domain "R3" of mouse talin-1 protein sequence (corresponding to positions 787-91 1 , SEQ ID NO: 1 ):
- the compound is highly selective and specific for cancer cells because this region is non-accessible when the cell is in a normal state (i.e., the talin is folded) and accessible when it becomes tumoral (i.e., the talin is unfolded). And, consequently, the compound has the ability of inhibiting the talin-vinculin interaction, and consequently the therapeutic effect, when the binding domain is accessible.
- the compound binds to a talin fragment selected from the group consisting of: talin fragment of positions 787-91 1 , talin fragment of positions 1328-2268, talin fragment of positions 1929-2029, talin fragment of positions 1653-1898, talin fragment of positions 1948-1963, talin fragment of positions 482-889, and a variant of any of said fragments, the variant having an identity of at least 85% with said talin fragments,
- each one of the fragments is provided with respect to either the chicken talin protein with the Uniprot accession number P54939, the mouse talin protein with the Uniprot accession number P26039 or the human talin protein isoforms with Uniprot database accession numbers Q9Y490 and Q9Y4G6.
- the compound is a peptide.
- Peptides can be designed using well-known bioinformatics tools. Peptide synthesis can be performed following routine protocols, such as the solid-phase protocol.
- the peptide binding to talin comprises a sequence SEQ ID NO; 2, SEQ ID NO: 3 (also so-called VD1 ) or a variant of SEQ ID NO: 3 having an identity of at least 85%.
- the peptide binding to talin is SEQ ID NO: 2, SEQ ID NO: 3 or a variant of SEQ ID NO: 3 having an identity of at least a 85%; SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8:
- Asp Gly Lys Ala lie Pro Asp Leu Thr Ala Pro Val Ser Ala Val Gin
- amino group which corresponds to the N-terminal of the peptide, is in the form of -NHR 6 , R 6 is rhodamine; and the carboxy group corresponding to the C(t) of the peptide, is in the form of -C(O)NH 2 .
- identity refers to the percentage of residues or bases that are identical in the two sequences when the amino group, which corresponds to the N-terminal of the peptide, is in the form of -NHR 6 , R 6 is rhodamine; and the carboxy group corresponding to the C(t) of the peptide, is in the form of -C(O)NH 2 .
- identity refers to the percentage of residues or bases that are identical in the two sequences when the
- sequences are optimally aligned. If, in the optimal alignment, a position in a first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, the sequences exhibit identity with respect to that position.
- a number of mathematical algorithms for rapidly obtaining the optimal alignment and calculating identity between two or more sequences are known and incorporated into a number of available software programs. Examples of such programs include the MATCH-BOX, MULTAIN, GCG, FASTA, and ROBUST programs for amino acid sequence analysis, among others.
- Preferred software analysis programs include the ALIGN, CLUSTAL W, and BLAST programs (e.g., BLAST 2.1 , BL2SEQ, and later versions thereof).
- a weight matrix such as the BLOSUM matrixes (e.g., the BLOSUM45, BLOSUM50, BLOSUM62, and BLOSUM80 matrixes), Gonnet matrixes, or PAM matrixes (e.g., the PAM30, PAM70, PAM120, PAM160, PAM250, and PAM350 matrixes), are used in determining identity.
- the BLAST programs provide analysis of at least two amino acid sequences, either by aligning a selected sequence against multiple sequences in a database (e.g., GenSeq), or, with BL2SEQ, between two selected sequences.
- BLAST programs are preferably modified by low complexity filtering programs such as the DUST or SEG programs, which are preferably integrated into the BLAST program operations. If gap existence costs (or gap scores) are used, the gap existence cost preferably is set between about -5 and -15. Similar gap parameters can be used with other programs as appropriate.
- the BLAST programs and principles underlying them are further described in, e.g., Altschul et al., "Basic local alignment search tool", 1990, J. Mol. Biol, v. 215, pages 403-410.
- the CLUSTAL W program can be used.
- the CLUSTAL W program desirably is run using "dynamic” (versus "fast") settings.
- Amino acid sequences are evaluated using a variable set of
- CLUSTAL W program and underlying principles of operation are further described in, e.g., Higgins et al., "CLUSTAL V: improved software for multiple sequence alignment", 1992, CABIOS, 8(2), pages 189-191 .
- the compound binding talin is an antibody against talin.
- antibodies against talin which can be useful in the present invention to inhibit talin's interaction with vinculin.
- Illustrative non- limitative examples are: Ab 05-1 144 clone TD77 (Merck Millipore); MAB1676- C, clone TA205 (Merck Millipore); MAB1676 NT, a.a.
- TA205 Merck Millipore
- N-Term, Ascites Free Merck Millipore
- Ab57758 Abeam
- Ab71333 Abeam
- antibodies of Santa Cruz Biotechnology A-1 1 ; C-20; C-9; H-18; H-300; T-20; TA205; 2Q1089; TA205; 8D4, and YQ- 16.
- the compound binds to vinculin protein.
- Peptides that bind to vinculin have been widely disclosed in the state of the art (see, for example Bass M. D. et al., 2002, supra).
- the compound binds to a talin binding site. In another embodiment, the compound binds to a vinculin fragment corresponding to positions 1 to 200 or a variant thereof having an identity of at least 85%, the numbering position being in respect of chicken vinculin protein sequence with the Uniprot database accession number P12003, human vinculin protein sequence with the Uniprot database accession number P18206 or mouse vinculin protein sequence with the Uniprot database accession number Q64727.
- the compound binds to a vinculin fragment
- the compound binding to vinculin is a peptide.
- the compound binding to vinculin is a peptide comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5, or a variant having an identity, with respect to any of sequence SEQ ID NO: 4 or SEQ ID NO: 5 of at least 85%.
- the compound binding to vinculin is a peptide selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5, or a variant thereof having an identity, with respect to any of sequence SEQ ID NO: 4 or SEQ ID NO: 5 of at least 85%.
- the compound binding to vinculin is an antibody.
- an antibody there are well-known antibodies against vinculin. Illustrative non-limitative examples are: ab18058 (Abeam), ab73412 (Abeam), Mab1676 (Merck Millipore), among others.
- screening assay to identify an agent which blocks the interaction between talin and vinculin
- the detection and measurement of this binding interaction will be dependent on the type of screening assay performed and the labels used.
- screening assays to detect binding between two proteins in the presence of a test agent are well-known in the art.
- the inhibitors of the invention are administered in combination with one or more anti-cancer agents.
- An anti-cancer agent may be, for instance, methotrexate, vincristine, adriamycin, cisplatin, non-sugar containing chloroethylnitrosoureas, 5-fluorouracil, mitomycin C, bleomycin, doxorubicin, dacarbazine, taxol, fragyline, Meglamine GLA, valrubicin, carmustaine and poliferposan, MMI270, BAY 12-9566, RAS farnesyl transferase inhibitor, farnesyl transferase inhibitor, MMP, MTA/LY231514, LY264618/Lometexol, Glamolec, CI-994, TNP-470, Hycamtin/Topotecan, PKC412, Valspodar/PSC833, Novantrone/Mitroxantrone, Metaret/Suramin, Bat
- Cytarabine HCI Dactinomycin, Daunorubicin HCI, Estramustine phosphate sodium, Etoposide (VP16-213), Floxuridine, Fluorouracil (5-FU), Flutamide, Hydroxyurea (hydroxycarbamide), Ifosfamide, Interferon Alfa-2a, Alfa-2b, Leuprolide acetate (LHRH-releasing factor analogue), Lomustine (CCNU), Mechlorethamine HCI (nitrogen mustard), Mercaptopurine, Mesna, Mitotane
- methyl-CCNU Teniposide
- VM-26 Teniposide
- Vindesine sulfate signal transduction inhibitors (such as MEK, BRAF, AKT, her2, mTOR, and PI3K inhibitors), but it is not so limited.
- the solid tumor is selected from colon, colorectal, prostate, and pancreas cancer.
- the present invention provides a peptide of formula (I) or a pharmaceutically acceptable salt thereof.
- salt refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
- Pharmaceutically acceptable salts are well known in the art.
- Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, trifluoroacetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
- Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate,
- Salts derived from appropriate bases include alkali metal, alkaline earth metal, and ammonium.
- Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
- Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
- the term (CrC 5 )alkyl refers to a saturated straight or branched alkyl chain having from 1 to 5 carbon atoms.
- (C-i-C-io)alkyl refers to a saturated straight or branched alkyl chain having from 1 to 10 carbon atoms. Illustrative non-limitative examples are: methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, neo-pentyl and n-hexyl.
- the peptide of the invention can serve as intermediate in the preparation of labeled peptides.
- label can be molecules or compounds, which when covalently attached to the peptide permit detection of the peptide in vivo, for example, in a patient to whom the peptide has been administered, or in vitro, e.g., in a sample or cells.
- Suitable detectable labels are well known in the art and include, by way of example, radioisotopes, fluorescent labels (e.g., such as rhodamine, fluorescein), and the like.
- the particular detectable label employed is not critical and is selected to be detectable at non-toxic levels. Selection of the such labels is well within the skill of the art.
- Covalent attachment of a detectable label to the peptide is accomplished by conventional methods well known in the art. Labeling usually involves covalent attachment of one or more labels, directly or through a spacer (e.g., an amide group), to non-interfering position(s) on the peptide that are predicted by quantitative structure-activity data and/or molecular modeling. Such non-interfering positions generally are positions that do not form direct contacts with the macromolecule(s) to which the peptidomimetic binds to produce the therapeutic effect.
- Derivatization e.g., labeling
- peptidomimetics should not substantially interfere with the desired biological or pharmacological activity of the peptidomimetic.
- halogen refers to the group in the periodic table consisting of five chemically related elements: fluorine (F), chlorine (CI), bromine (Br), iodine (I), and astatine (At).
- (CrC 5 )haloalkyl refers to a saturated straight or branched alkyl chain having from 1 to 5 carbon atoms wherein at least one of the hydrogen atoms is replaced by an halogen atom selected from F, CI, I, and Br.
- R 2 is a known ring system, as defined above, which is optionally substituted by -C(O)R 3 .
- R 2 is a known ring system substituted by -C(O)R 3 .
- R 2 is a phenyl radical.
- R 3 is a phenyl radical.
- R 2 is a benzophenone radical.
- X- is p- benzoyl-L-phenyl alanine.
- the amino group of p-benzoyl-L-phenyl alanine is acetylated.
- the amino group of p-benzoyl-L-phenyl alanine is conjugated to a detectable label.
- the amino group of p- benzoyl-L-phenyl alanine is conjugated to rhodamine.
- X 2 is a L- or D- basic amino acid.
- the basic amino acid is Arg, either in D- or L-configuration.
- R 4 is a pyridyl radical and X 3 is 3-pyridyl alanine.
- R 5 is -NHR 6 .
- R 5 is -NHR 6 , being R 6 -H.
- n is 1 and R 5 is -NHR 6 .
- n is 1 and R 5 is - NHR 6 , being R 6 -H.
- the peptide of formula (I) is one comprising the sequence SEQ ID NO: 6, SEQ ID NO: 7 or SEQ ID NO: 8.
- the peptides of the invention can be obtained following routine protocols, such as the protocol "deprotection-wash-coupling-wash”.
- the amino acid coupling by condensation of the carboxylic group of one amino acid with the amino group of another amino acid residue can be performed in solid phase (i.e., on a resin).
- the general principle of solid phase peptide synthesis is one of repeated cycles of deprotection-wash-coupling-wash.
- the free N-terminal amine of a solid-phase attached peptide is coupled to a single N-protected amino acid unit. This unit is then deprotected, revealing a new N-terminal amine to which a further amino acid may be attached.
- Amino acids have reactive moieties at the N- and C-termini, which facilitates amino acid coupling during synthesis.
- Many amino acids also have reactive side chain functional groups, which can interact with free termini or other side chain groups during synthesis and peptide elongation and negatively influence yield and purity.
- PG Protecting group
- Suitable amino-protecting groups include methyl carbamate, ethyl
- diphenylmethyl carbamate 2-methylthioethyl carbamate, 2- methylsulfonylethyl carbamate, 2-(p-toluenesulfonyl)ethyl carbamate, [2-(1 ,3- dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl carbamate (Mtpc),
- dimethylthiophosphinamide Mpt
- diphenylthiophosphinamide Ppt
- dialkyl phosphoramidates dibenzyl phosphoramidate
- diphenyl phosphoramidate diphenyl phosphoramidate
- benzenesulfenamide o-nitrobenzenesulfenamide (Nps)
- 2,4- dinitrobenzenesulfenamide pentachlorobenzenesulfenamide, 2-nitro-4- methoxybenzenesulfenamide, triphenylmethylsulfenamide, 3- nitropyridinesulfenamide (Npys), p-toluenesulfonamide (Ts)
- benzenesulfonamide 2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4- methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4- methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6- sulfonamide (Pmc), methanesulfonamide (Ms), ⁇ - trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4',8'- dimethoxynaphthylmethyl)
- suitably protected carboxylic acids further include, but are not limited to, silyl-, alkyl-, alkenyl-, aryl-, and arylalkyl-protected carboxylic acids
- suitable silyl groups include trimethylsilyl, triethylsilyl, t- butyldimethylsilyl, t-butyldiphenylsilyl, triisopropylsilyl, and the like.
- suitable alkyl groups include methyl, benzyl, p-methoxybenzyl, 3,4- dimethoxybenzyl, trityl, t-butyl, tetrahydropyran-2-yl.
- alkenyl groups include allyl.
- suitable aryl groups include optionally substituted phenyl, biphenyl, or naphthyl.
- suitable arylalkyl groups include optionally substituted benzyl (e.g., p-methoxybenzyl (MPM), 3,4-dimethoxybenzyl, O-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6- dichlorobenzyl, p-cyanobenzyl), and 2- and 4-picolyl.
- MPM p-methoxybenzyl
- the amidation of the C(t) end and the alkylation of the N(t) end can be performed using well-known protocols.
- the present invention provides a conjugate comprising the peptide as defined in the first aspect of the invention.
- the conjugate of the peptide is one which comprises a one which comprises a material which increases its half-life.
- the conjugate of the peptide or the construct is one wherein the material which increases its half-life is a polymeric material; preferably a water soluble polymer.
- the conjugate of the peptide or the construct is one wherein the material which increases their half-lives is selected from the group consisting of polyalkylene oxide such as for example polyethylene glycol (PEG), polypropylene glycol, polyoxyethylenated polyols; alkyl-terminated polyalkylene oxides (PAO's) such as for example monomethyl-terminated polyethylene glycols (mPEG's); and mPEG.
- PEG polyethylene glycol
- PAO's alkyl-terminated polyalkylene oxides
- mPEG's monomethyl-terminated polyethylene glycols
- the peptide is conjugated to a cell penetrating peptide.
- CPP cell penetrating peptide
- the “cargo” is associated to peptides via the C(t) or N(t)-end, either through chemical linkage via covalent bonds or through non-covalent interactions.
- the function of the CPPs are to deliver the cargo into cells, a process that commonly occurs through endocytosis with the cargo delivered to delivery vectors for use in research and medicine. Current use is limited by a lack of cell specificity in CPP-mediated cargo delivery and insufficient understanding of the modes of their uptake.
- CPPs typically have an amino acid composition that either contains a high relative abundance of positively charged amino acids such as lysine or arginine or has sequences that contain an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids. These two types of structures are referred to as polycationic or amphipathic, respectively.
- a third class of CPPs are the hydrophobic peptides, containing only apolar residues, with low net charge or have hydrophobic amino acid groups that are crucial for cellular uptake.
- the conjugation of the CPP to the peptide provided in the present invention can be performed following well-known routine protocols, such as solid phase synthesis or solution selective capping.
- the present invention also provides a pharmaceutical composition
- a pharmaceutical composition comprising the peptide as defined in the second aspect of the invention or the conjugate as defined in the third aspect of the invention.
- therapeutically effective amount refers to the amount of a compound that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disease which is addressed.
- pharmaceutically acceptable excipients or carriers refers to pharmaceutically acceptable materials, compositions or vehicles. Each component must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the pharmaceutical composition. It must also be suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity or other problems or complications commensurate with a reasonable benefit/risk ratio. Likewise, the term “veterinary acceptable” means suitable for use in contact with a non-human animal.
- Suitable pharmaceutically acceptable excipients are solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like. Except insofar as any conventional excipient medium is incompatible with a substance or its derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this invention.
- compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology.
- preparatory methods include the step of bringing the active ingredient into association with a excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
- Example 1 rigidity causes YAP translocation in a talin-dependent way a) Cells a.1 .
- Talin 1 -/- Mouse embryonic fibroblasts (MEFs) were described previously (Zhang, X. et al., "Talin depletion reveals independence of initial cell spreading from integrin activation and traction” Nat. Cell Biol. 10, 1062-1068 (2008)), and cultured in Dulbecco's Modified Eagle Medium (DMEM) 1 x (Life Technologies, 41965) supplemented with 15% fetal bovine serum (FBS).
- DMEM Dulbecco's Modified Eagle Medium
- FBS fetal bovine serum
- MEFs have a wild type phenotype due to expression of talin 2 (Zhang, X. et al., 2008) a.2.
- Talin 2 levels were knocked down using a Talin 2 shRNA which contained a puromycin resistance, as previously described in Zhang, X. et al., 2008, supra.
- the transfection was performed with a Neon transfection device, following manufacturer's instructions 5 days before experiments (hereinafter Talin 1 -/-MEFs).
- Talin 1 -/-MEFs Preparation and characterization of polyacrylannide gels. These gels were obtained by the combination of different concentrations of acrylamide and bis-acrylamide as shown in Table 1 :
- the Young ' s modulus was measured by recording 10 force-displacement curves with a peak-to-peak amplitude of 6 ⁇ and a frequency of 1 Hz. Three points near the gel center were selected in each gel, separated 5 ⁇ from each other. For each stiffness, >6 gels produced in two batches were measured. To compute the Young ' s modulus (E), the Hertz model equation for pyramidal tips was fitted to the force-displacement curves. The equation was fitted for an effective indentation of 1000 nm. c) Cell culture in polyacrylamide cells Talin 1 -/- MEFs with and without talin 2 shRNA transfection were plated on polyacrylamide gels of different rigidities.
- YAP activation was studied by immunostaining. Briefly, the cells were fixed with 4% paraformaldehyde, permeabilized with 0.1 % Triton X- 100, and labelled first with primary YAP monoclonal antibody (clone 63.7 produced in mouse, Santa Cruz, 1 h, room temperature), and then with Alexa- conjugated secondary antibody (Invitrogen) (1 h, room
- Phalloidin-Tetramethylrhodamine B isothiocyanate (Sigma), used to label actin, was added with the secondary antibody. Fluorescence images were then acquired with a 60x oil immersion objective (NA 1 .40) using a spinning disk confocal microscope (Andor). The degree of YAP nuclear localization was assessed by calculating the ratio between YAP fluorescence in the nuclear region and the cytoplasmic region immediately adjacent.
- Talin 1 -/- MEFs obtained as described in Example 1 , were cultured in DMEM supplemented with 10% FBS and transfected with the Neon transfection device according to the manufacturer's instructions, with the construct EGFP- VD1 (Addgene plasmid # 46270, described as pEGFPC1/GgVcl 1 -258; VD1 herein), previously described in Cohen, D.M. et al., "A conformational switch in vinculin drives formation and dynamics of a talin-vinculin complex at focal adhesions", J. Biol. Chem. 281 , 16006-16015 (2006).
- Example 2 The resulting cells were seeded in polyacrylamide gels as disclosed in Example 1 .
- YAP localization was studied as described above (Example 1 ). Blocking vinculin function through VD1 transfection in talin 1 -/- MEFs had the same effect than talin 2 depletion, that is, YAP remained cytosolic at all rigidities (FIG. 2). Therefore, VD1 inhibits the interaction talin/vinculin.
- Talin 1 -/- MEFs obtained as described in Example 1 , were cultured in DMEM supplemented with 10% FBS, and the peptide of sequence
- SEQ ID NO: 8 was added at a concentration of 60 ⁇ for 1 hour.
- Example 3 identification of talin's VBS domain involved in YAP translocation
- EGFP-talin1 was a gift of Prof. Critchley's lab and described previously 47
- EGFP-talin1 IVVI was prepared in house from EGFP-talin1 by introducing four point mutations (T809I/T833V/T867V/T901 1).
- Talin 1 -/- MEFs obtained as described in a.2. were cultured in DMEM with 15% FBS.
- these cells were depleted of talin 2 with talin 2 shRNA and co-transfected or not, using the Neon transfection device according to manufacturer's
- T809I/T833V/T867V/T901 1 which belong to the R3 domain of Talin and have been shown to increase the force required for talin unfolding(EGFP- Talinl IWI, home made; Yao, M. et al. Mechanical activation of vinculin binding to talin locks talin in an unfolded conformation. Scientific reports 4, 4610 (2014)). This should increase the threshold rigidity for unfolding, displacing the effect of talin to higher rigidities.
- Peptide SEQ ID NO: 8 was synthesized by standard 9- fluorenylmethoxycarbonyl/tert-butyl (Fmoc/tBu) solid-phase peptide synthesis. Syntheses were performed on a 100- ⁇ scale/each using the Rink-amide Chemmatrix resin. Peptide elongation and other solid-phase manipulations were done manually in polypropylene syringes, each fitted with a polyethylene porous disk.
- the cleaved peptide was precipitated from the cleavage cocktail through addition of cold tert-butyl methyl ether. The suspension was then centrifuged at 4000 rpm and 4°C for 10 min. The ether fraction was discarded and the process was repeated up to 3 times in order to remove all scavengers and by-products from the cleavage of side-chain protecting groups. The peptide residue thus obtained was dried by means of a N2 flow stream.
- Peptide was cycled in mixture of water and acetonitrile (1 :1 ) at 0.1 mM concentration and pH 7.4 in the presence of 5% dimethyl sulfoxide (DMSO) for 48 h. This reaction was monitored by HPLC. Once completed, the crude of the reaction was lyophilized and dissolved again in acetonitrile and water (1 :1 ).
- DMSO dimethyl sulfoxide
- the peptide was purified by semi-preparative HPLC [Waters 2700 Sample Manager equipped with a Waters 2487 dual ⁇ absorbance detector, a Waters 600 controller, a Waters fraction collection II, a Symmetry C18 column (100 mm x 30 mm, 5 ⁇ , 100 A, Waters) and Millenium chromatography manager software].
- Example 5 in vitro data of antitumoral activity based on MTT assay
- Pane 1 human pancreatic epithelioid carcinoma (ATCC), HT29 Human colorectal adenocarcinoma (ATCC), and HT1 16 human colorectal carcinoma (ATCC) cell lines were cultured in DMEM F-12 (21331 , Life Technologies) medium supplemented with 10% FBS and 1/
- Bxpc3 human pancreatic adenocarcinoma (ATCC) cell line were cultured in RPMI 1640 medium (Lonza) supplemented with 10% FBS and 1 % Penicillin/streptomycin.
- NPKLM prostate cancer cell lines were described previously (A. Aytes et al., ETV4 promotes metastasis in response to activation of PI3-kinase and Ras signaling in a mouse model of advanced prostate cancer. PNAS 1 10, E3506-3515, 2013) and cultured in RPMI 1640 medium (Bio Whitaker) supplemented with 10% FBS and 1 %
- MTT assay For MTT assays, two controls, DMSO (peptide carrier) and MTT reagent (Cat. No: 1 1465007001 , Roche) were used. The test protocol was the following:
- Tumor cells were washed with PBS before trypsinization. After counting cell density (Neubauer counting chamber, Brand), cells were resuspended in the corresponding media for each cell line (described above), at a density corresponding to 4000 cells in 100 ⁇ . 4000 cells per well were seeded on 96 well-plates, avoiding outer wells because of evaporation. These outer wells were filled with 100 ⁇ of PBS. Then, cells were incubated for 24h. After that, the medium was aspirated, 100 ⁇ of the peptide SEQ ID NO: 8 were added (diluted from the 10mM stock to 60 ⁇ in medium), and the resulting
- MTT labelling reagent 10 ⁇ of MTT labelling reagent were added per well and incubated for 4 hours until crystals were formed. Subsequently, 100 ⁇ of solubilization solution was added to each well and incubated overnight until crystals were solubilized. Finally, the resulting colored solution was measured with a microplate reader (Infinite M200 PRO, Tecan) using 570nm wavelength for measurement and 690nm wavelength for reference.
- Bakolitsa C. et al. "Structural basis for vinculin at sites of cell adhesion", Nature, 2004, 430, 583-586; and Hirata H. et al., "Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions", Am J Cell Physiol, 2014, C607-C620;
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Life Sciences & Earth Sciences (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Inhibitors of talin-vinculin binding for the treatment of cancer The present invention provides a compound inhibiting the interaction between talin and vinculin for use in the treatment of a solid tumor.
Description
Inhibitors of talin-vinculin binding for the treatment of cancer
The present invention relates to the fields of medicine and cancer. BACKGROUND ART
Cancer is a group of diseases involving abnormal cell growth with the potential to invade or spread to other parts of the body. Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors may be benign (not cancerous), or malignant (cancerous). Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas.
The biology of cancer is a complex interplay of many underlying processes, taking place at different scales both in space and time. A variety of theoretical models have been developed, which enable one to study certain components of the cancerous growth process. However, most previous approaches only focus on specific aspects of tumor development, largely ignoring the influence of the evolving tumor environment.
Treatment decision-making for cancer takes into account the stage and biology of the tumor, the risks vs. benefits of planned therapy, the wishes of the characteristics patient regarding treatment, and the economic costs associated with therapy. The best approach to treat cancer provides a balance between therapeutic effectiveness and minimization of treatment- associated side effects. Successful pharmacotherapy of solid tumors remains an unfulfilled medical goal. Despite the increased understanding of the molecular biology of tumor cells, the identification of novel cellular targets, and the availability of increased numbers of potential therapeutic agents, chemotherapy often fails because adequate cytotoxic concentrations are not achieved. In this regard, it is well-stablished that for the effective treatment of solid tumors, anticancer drugs must gain access to all viable cells within the tumor in sufficient concentrations to cause lethality. However, many solid tumors have a poorly
formed blood vascular system with variable rates of blood flow and much larger intercapillary distances than those found in normal tissues.
There are well-known peptides in the state of the art which have been reported as having the ability of binding to vinculin. For example,
WO95/20601 discloses a peptide, pVIN12.1 , which competes with talin for the binding to vinculin.
Therefore, in spite of the efforts made, there is still the need of further compounds useful in the treatment of solid tumors.
SUMMARY OF THE INVENTION
The present inventors have analyzed the behaviour of talin and vinculin, in a cell model which, under specific force conditions applied thereon, simulates the cell found in a rigid tissue such as a solid tumor.
From this model, the present inventors have found that when the interaction between talin and vinculin is disrupted, no YAP translocation occurs, being found in the cytosol. In addition, the present inventors have also found that tissue rigidity triggers talin unfolding.
YAP (Yes-associated protein), also known as YAP-1 or YAP65, is a potent oncogene, which is amplified in various human cancers, and it is one of the two main effectors of the Hippo tumor suppressor pathway. Its proliferative and oncogenic activity is driven by its association with the TEAD family of transcription factors, which up-regulate genes that promote cell growth and inhibit apoptosis. When the pathway is activated, YAP and TAZ are phosphorylated on a serine residue and sequestered in the cytoplasm by 14- 3-3 proteins. When the Hippo pathway is not activated, YAP1/TAZ enter the nucleus and regulate gene expression. The translocation of YAP into the nucleus has been widely disclosed in the prior art as contributing in derregulating the cell proliferation, death, and migration, which turns the cell a tumoral/cancerigen cell.
Therefore, from the experimental data provided below, it can be concluded that inhibiting the interaction between talin and vinculin, YAP protein can be
sequestered in cell cytoplasm, avoiding its translocation to the cell nuclei, and consequently, avoiding/minimizing the risk of deregulation in cell proliferation, death and migration. In view of the above, an inhibitor of the interaction talin-vinculin can be useful in the treatment of a solid cancer. In this way, if a subject is diagnosed of cancer, it can be treated with an inhibitor of talin-vinculin interaction in such a way that said inhibitor "sequesters" the YAP protein already present in the cytosol and avoids its translocation to the nuclei.
Therefore, in one aspect the present invention provides a compound inhibiting the interaction between talin and vinculin for use in the treatment of a solid cancer. This aspect can be alternatively formulated as the use of a compound inhibiting the interaction between talin and vinculin for the manufacture of a medicament for the treatment of a solid cancer. This aspect can also be formulated as a method for treating a solid cancer, the method comprising the step of administering a therapeutically effective amount of a compound inhibiting the interaction between talin and vinculin, to a subject in need thereof.
In the last 20 years, the interaction between talin and vinculin has attracted the attention of scientists in order to determine how they interact and affect cell adhesion. In these previous reports a deep analysis of both talin and vinculin sequence was performed, being identified and characterized the vinculin binding sites contained in talin protein (see for example Gilmore A. P. et al., "The cytoskeletal protein talin contains at least two distinct vinculin binding domains", J Cell Biol., 1993, 122(2): 337-347; "Bass M. D. et al., "Further characterization of the interaction between the cytoskeletal proteins talin and vinculin", Biochem. J., 2002, 362, 761 -768) and, also, being characterized and identified the talin binding site contained in vinculin protein
(see for example Adey N. B. et al., "Isolation of peptides from phage- displayed random peptide libraries that interact with the talin-binding domain of vinculin", Biochem J., 1997, 324, 523-528; Bakolitsa C. et al., "Structural basis for vinculin at sites of cell adhesion", Nature, 2004, 430, 583-586; and Hirata H. et al., "Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions", Am J Cell Physiol, 2014, C607-C620). In this prior art, compounds with the ability of
binding to talin or vinculin were designed and assayed in order to confirm their binding to the target protein, and the inhibition of the interaction talin- vinculin. Therefore, inhibitors of the interaction talin-vinculin were already well-known in the state of the art before the present invention was made.
As it is shown below, the present inventors used one of these well-known compounds inhibiting the interaction between talin and vinculin, VD1 . VD1 has already been disclosed as dominant over endogenous vinculin for talin binding (Hirata, H. et al., "Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions" Am. J. Physiol. Cell Physiol. 306, C607-620 (2014)) but prevents normal vinculin function (Cohen, D.M. et al., "A conformational switch in vinculin drives formation and dynamics of a talin-vinculin complex at focal adhesions", J. Biol. Chem. 281 , 16006-16015 (2006)) due to the lack of remaining functional domains.
Using two populations of Talin 1 -/- MEFs (one with wild-type phenotype due to expression of the endogenous talin-2, and the other with talin-2 knocked down), the present inventors have found that: adhesion growth and YAP translocation occur when tissue rigidity is above a threshold value; and that
YAP translocation is blocked when VD1 , a well-known inhibitor of talin- vinculin interaction, is administered to these MEFs.
The experimental data provided below also supports that tissue rigidity, something characteristic of solid tumors, triggers talin unfolding.
As it is well-known in the state of the art, talin is a cytoskeletal protein having vinculin binding site. Under health physiological conditions, talin is folded and this vinculin binding site is of difficult access for vinculin. However, as it is shown below, when the cell is submitted to high values of force, said values being of an intensity of the same order as those suffered by in vivo cells forming part of rigid tissues, such as solid tumors, talin unfolds and exposes the vinculin binding site. Consequently, there is a stronger interaction between talin and vinculin, and as a consequence of the interaction, YAP protein translocates to the nucleus and contributes to cell proliferation, death and migration deregulation. Under the same experimental conditions as above that make talin unfold, it has been found that no YAP translocation
occurs when a peptide, VD1 , which competes with the endogen vinculin, binds to talin's vinculin binding site. Therefore, the inhibition of the interaction reduces the risk of uncontrolably activating mechanisms related to cancer such as cell death and progression, among others.
As it is further illustrated below, the present inventors have also identified the specific talin-1 domain involved in the interaction with vinculin. Particularly, it has been found that the talin-1 domain involved in the interaction with vinculin is the "R3" domain (positions 787-91 1 of the talin-1 mouse full-length sequence protein available in Uniprot database with the accession number P26039, July 27, 201 1 , version number 2). Mouse talin-1 protein sequence is 100% homologous to human talin-1 protein sequence. Therefore, the results provided below support also the identification of the domain specifically involved in the interaction with vinculin in the human talin-1 protein sequence.
It is the first time that it is reported that there can be a positive effect in cancer progression by avoiding the interaction between talin and vinculin.
As it is shown below, the present inventors have developed a new peptide with the ability of binding to the R3 region of talin and which shows anticancer activity in several types of solid tumors, such as pancreas, prostate or colon cancer. The tests provided below show that even when the peptide is conjugated to a voluminous group in comparison to the peptide, such as rhodamine, it shows a remarkable anticancer activity, which is indicative of the therapeutic potency of the peptide of the invention .
Thus, in a second aspect the present invention provides a peptide or a pharmaceutically acceptable salt of formula (I) X Xz-Xa Q (I) wherein
Ri is selected from the group consisting of -H, -C(O)-(CrCi0)alkyl, and a detactable label;
R2 is selected from -H, (CrC5)alkyl, (C2-C5)heteroalkyl, and a known ring system having from 5 to 6 carbon atoms, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; and the ring system being optionally substituted by one or more radicals
independently selected from the group consisting of -OH, halogen, (CrC5)alkyl, (C C5)haloalkyl, -O-(d-C5)alkyl, and -C(O)R3;
R3 is a ring system having from 5 to 6 carbon atoms, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; the ring system being optionally substituted by one or more radicals independently selected from the group consisting of -OH, halogen, (CrC5)alkyl, (C C5)haloalkyl, and -O-(C C5)alkyl; and
the wavy line represents the site through which X-, binds to X2;
X2 is a basic amino acid;
X3 is a compound of formu
R4 is a known ring system having from 5 to 6 members, the members being selected from C, CH, CH2, N, NH, O, and S, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; and the ring system being optionally substituted by one or more radicals independently selected from the group consisting of -OH, halogen,
(CrC5)alkyl, (C C5)haloalkyl, and -O-(C C5)alkyl; and
the wavy line represents the site through which X3 binds to Xi and X2; and
(IV)
wherein
R5 is selected from the group consisting of -NHR6, and -OH;
R6 is selected from -H and (C -C10)alkyl;
n is an integer value which is 1 or 2; and
the wavy line represents the site through which )Q binds to X3.
In a third aspect the present invention provides a conjugate comprising the peptide as defined in the first aspect of the invention.
And, finally, in a fourth aspect the present invention provides a peptide as defined in the second aspect of the invention or the conjugate as defined in the third aspect of the invention for use as a medicament.
BRIEF DESCRIPTION OF DRAWINGS FIG. 1 Quantification of nuclear/cytosolic YAP ratio (n > 20 cells) in Talin 1 -/- MEFs cells (a) and Talin 1 -/- MEFs cells transfected with Talin 2 shRNA (b) plated on fibronectin-coated polyacrylamide gels of increasing rigidity
(Young's modulus). Differences between control and talin-depleted cells were significant only above 5 kPa (p<0.05, 2-way ANOVA). YAP translocation to the nucleus is low (ratio close to 1 ) on soft substrates, but increases sharply above a threshold Young's modulus of 5 kPa in control cells. However, this increase in YAP nuclear translocation triggered by rigidity is abolished if talin is depleted. FIG. 2 Nuclear/cytosolic YAP ratio in (a) Talin 1 -/- MEFs cells transfected with a VD1 mutant (using plasmid EGFP-VD1 A50I), and (b) Talin 1 -/- MEFs cells transfected with EGFP-VD1 . n > 20 cells per condition, significant differences between VD1 and VD1 A50I transfection were found for all measurements above 5 kPa but not below (p<0.05, 2-way ANOVA). At the highest Young's modulus values (above 5kPa, mimicking the stiffening found in solid tumours) in the presence of mutant VD1 , which is unable to bind to talin, a high nuclear/cytoplasmic YAP intensity ratio is observed, which means that YAP
translocates to the nucleus. On the contrary, in the presence of non-mutated VD1 , which is already known to bind to talin, competing with endogen vinculin, a substantial and significant reduction in nuclear translocation is observed.
FIG. 3. Nuclear/cytosolic YAP ratios (b, n > 20 cells per condition) on fibronectin-coated gels of increasing rigidity by talin 2 shRNA cells (a) or talin 2 shRNA cells co-transfected with FL Talin 1 (b) or FL talin 1 IWI (c).
Significant differences between FL talin and FL talin IVVI were found at 1 1 kPa for all measurements (p<0.05, 2.way ANOVA). Talinl IVVI contains four point mutations in the R3 domain of the talin rod which increase the force required to unfold it (Yao, M. et al. Mechanical activation of vinculin binding to talin locks talin in an unfolded conformation. Scientific reports 4, 4610 (2014)). The fact that YAP nuclear translocation is shifted to higher rigidities in the IWI mutant demonstrates that its increased resistance to force alters YAP translocation. Therefore, this specific domain in talin is responsible for YAP activation.
FIG. 4 is a bar graph showing the nuclear/cytoplasmic YAP ratio in talin 1 -/- MEFs seeded on 30 kPa substrates treated with 60 μΜ Drug (SEQ ID NO: 8). n=20 cells (ns, no significant differences, *, p<0.05).
FIG. 5 Top row: Absorbance measured from MTT assay in NPKLM, Bxpc3, and Panel cells. Bottom row: Absorbance measured from MTT assay in HT29, and HT1 16 cells. Conditions are control (Ctrl), control + vehicle (Ctrl+DMSO) and drug (SEQ ID NO: 8). n= 5 wells per condition, (ns, no significant differences, *, p<0.05).
DETAILED DESCRIPTION OF THE INVENTION
The present invention provides a compound inhibiting the interaction between talin and vinculin for the treatment of a solid cancer.
In the present invention, the expression "a therapeutically effective amount" refers to the amount of a compound that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disease which is addressed. The particular dose of
compound administered according to this invention will of course be determined by the particular circumstances surrounding the case, including the compound administered, the route of administration, the particular condition being treated, and similar considerations.
In the present invention, the term "treatment" when referred to solid tumors, includes partial or total inhibition of the cancer growth, partial or total destruction of the cancer cells, prevention of the onset of clinically evident cancer, prevention of the onset of a preclinical^ evident stage of cancer in individuals at risk, prevention of initiation for malignant cells and the reversion of the progression of premalignant cells to malignant cells, among others.
Talin is a high-molecular-weight cytoskeletal protein concentrated at regions of cell-substratum contact and, in lymphocytes, at cell-cell contacts. It is capable of linking integrins to the actin cytoskeleton either directly or indirectly by interacting with vinculin and alpha-actinin. Talin consists of a large C-terminal rod domain that contains bundles of alpha helices and an N- terminal FERM (band 4.1 , ezrin, radixin, and moesin) domain with three subdomains: F1 , F2, and F3. The F3 subdomain of the FERM domain contains the highest affinity integrin-binding site for integrin β tails and is sufficient to activate integrins. Talin also has a middle domain, which has a structure consisting of five alpha helices that fold into a bundle. According to recent publications, this protein comprises several vinculin binding sites (Bass M. D. et al., "Further characterization of the interaction between the cytoskeletal proteins talin and vinculin", Biochem. J., 362, 761 -768, 2002;
Goult T. B. et al., "RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover", The Journal of Biological Chemistry, 288(12), 8238-8249). The state of the art has disclosed two isoforms for human talin protein: talin 1
(with the Uniprot database accesion number Q9Y490, November 8, 2005, version number 3); and talin 2 (with the Uniprot database accesion number Q9Y4G6, May 5, 2009, version number 4). The size of talin-2 protein is similar to talin-1 , and is relatively similar (74% identity, 86% similarity); the size of the talin-2 gene (200 kb) is however much larger than that of talin-1 (30 kb), due to differences in intron size.
Unless otherwise stated herein, the term "talin protein" refers to either "talin-1
protein" and "talin-2 protein".
Human talin-1 protein shows a high homology with the talin-1 protein isolated from other organisms, such as mouse (Uniprot database accession number P26039, July 27, 201 1 , version no. 2) and chicken (Uniprot database accession number P54939, November 8, 2005 version no. 2), among others; and, analogously, human talin-2 protein shows high homology with talin-2 protein isolated from other organisms, such as mouse (Uniprot database accession number Q71 LX4, July 27, 201 1 , version no. 3).
Vinculin is a membrane-cytoskeletal protein in focal adhesion plaques that is involved in linkage of integrin adhesion molecules to the actin cytoskeleton. Vinculin is a cytoskeletal protein associated with cell-cell and cell-matrix junctions, where it is thought to function as one of several interacting proteins involved in anchoring F-actin to the membrane. The Uniprot accession number of human protein is P18206, January 23, 2007, version number 4. Vinculin peptides have also been disclosed in other animals such as mouse (Uniprot database accession number Q64727, January 23, 2007, version number 4) and chicken (Uniprot database accession number P12003, January 23, 2007, version number 4), among others, all of them showing a substantial matching with human vinculin.
In one embodiment, the compound inhibiting the binding talin-vinculin is a peptide, a small molecule, or an antibody.
As it has been stated above, the present inventors have found that when the cell suffers forces of the same magnitude as those suffered in a rigid tissue such as a solid tumor, talin protein unfolds and the vinculin binding sites are available for vinculin protein.
In one embodiment, the compound binds to talin protein.
In another embodiment, the compound binds to either talin-1 or talin-2 sequence portion comprised from 400 to 2541 , the positions being in respect to the protein sequence available in Uniprot database provided above.
In another embodiment, the compound binds to a vinculin binding site of talin protein. In another embodiment, the compound binds to the vinculin binding
domain "R3" of mouse talin-1 protein sequence (corresponding to positions 787-91 1 , SEQ ID NO: 1 ):
AHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDL VNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQ QQRLREAAEGLRMATNAAAQNAIKK
In this preferred embodiment, advantageously, the compound is highly selective and specific for cancer cells because this region is non-accessible when the cell is in a normal state (i.e., the talin is folded) and accessible when it becomes tumoral (i.e., the talin is unfolded). And, consequently, the compound has the ability of inhibiting the talin-vinculin interaction, and consequently the therapeutic effect, when the binding domain is accessible. In another embodiment, the compound binds to a talin fragment selected from the group consisting of: talin fragment of positions 787-91 1 , talin fragment of positions 1328-2268, talin fragment of positions 1929-2029, talin fragment of positions 1653-1898, talin fragment of positions 1948-1963, talin fragment of positions 482-889, and a variant of any of said fragments, the variant having an identity of at least 85% with said talin fragments,
wherein the numbering position of each one of the fragments is provided with respect to either the chicken talin protein with the Uniprot accession number P54939, the mouse talin protein with the Uniprot accession number P26039 or the human talin protein isoforms with Uniprot database accession numbers Q9Y490 and Q9Y4G6.
In another embodiment, the compound is a peptide. Peptides can be designed using well-known bioinformatics tools. Peptide synthesis can be performed following routine protocols, such as the solid-phase protocol.
In another embodiment, the peptide binding to talin comprises a sequence SEQ ID NO; 2, SEQ ID NO: 3 (also so-called VD1 ) or a variant of SEQ ID NO: 3 having an identity of at least 85%. In another embodiment the peptide binding to talin is SEQ ID NO: 2, SEQ ID NO: 3 or a variant of SEQ ID NO: 3 having an identity of at least a 85%; SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8:
SEQ ID NO: 2
Val Glu Asp Leu Thr Thr Leu;
SEQ ID NO: 3 (VD1 )
Met Pro Val Phe His Thr Arg Thr lie Glu Ser lie Leu Glu Pro Val
Ala Gin Gin lie Ser His Leu Val lie Met His Glu Glu Gly Glu Val
Asp Gly Lys Ala lie Pro Asp Leu Thr Ala Pro Val Ser Ala Val Gin
Ala Ala Val Ser Asn Leu Val Arg Val Gly Lys Glu Thr Val Gin Thr Thr Glu Asp Gin lie Leu Lys Arg Asp Met Pro Pro Ala Phe lie Lys
Val Glu Asn Ala Cys Thr Lys Leu Val Arg Ala Ala Gin Met Leu Gin Ala Asp Pro Tyr Ser Val Pro Ala Arg Asp Tyr Leu lie Asp Gly Ser Arg Gly lie Leu Ser Gly Thr Ser Asp Leu Leu Leu Thr Phe Asp Glu Ala Glu Val Arg Lys lie lie Arg Val Cys Lys Gly lie Leu Glu Tyr
Leu Thr Val Ala Glu Val Val Glu Thr Met Glu Asp Leu Val Thr Tyr Thr Lys Asn Leu Gly Pro Gly Met Thr Lys Met Ala Lys Met lie Asp Glu Arg Gin Gin Glu Leu Thr His Gin Glu His Arg Val Met Leu Val Asn Ser Met Asn Thr Val Lys Glu Leu Leu Pro Val Leu lie Ser Ala Met Lys lie Phe Val Thr Thr Lys Asn Thr Lys Ser Gin Gly lie Glu
Glu Ala Leu Lys Asn Arg Asn Phe Thr Val Glu Lys Met Ser Ala Glu lie Asn Glu lie lie Arg Val Leu Gin Leu Thr Ser Trp Asp Glu Asp
Ala Trp
SEQ ID NO: 6
4Bpa-Arg-3pA-Dap-NH2, wherein Bpa= p-benzoyl-L-phenyl-Ala, 3pA=3- pyridyl-Ala, Dap= 2,3-diaminopropionic acid; and the carboxy group corresponding to the C(t) of the peptide, is in the form of -C(O)NH2;
SEQ ID NO: 7
4Bpa-Arg-3pA-Dap-NH2, wherein the amino group, which corresponds to the N-terminal of the peptide, is in the form of -NHR6, R6 being selected from -C(O)-(CrC5)alkyl, -C(O)-(CrCi0)alkyl, and a label; and the carboxy group corresponding to the C(t) of the peptide, is in the form of -C(O)NH2; and
SEQ ID NO: 8
4Bpa-Arg-3pA-Dap-NH2, wherein the amino group, which corresponds to the N-terminal of the peptide, is in the form of -NHR6, R6 is rhodamine; and the carboxy group corresponding to the C(t) of the peptide, is in the form of -C(O)NH2.
In the present invention the term "identity" refers to the percentage of residues or bases that are identical in the two sequences when the
sequences are optimally aligned. If, in the optimal alignment, a position in a first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, the sequences exhibit identity with respect to that position. The level of identity between two sequences (or "percent sequence identity") is measured as a ratio of the number of identical positions shared by the sequences with respect to the size of the sequences (i.e., percent sequence identity = (number of identical positions/total number of positions) x 100).
A number of mathematical algorithms for rapidly obtaining the optimal alignment and calculating identity between two or more sequences are known and incorporated into a number of available software programs. Examples of such programs include the MATCH-BOX, MULTAIN, GCG, FASTA, and ROBUST programs for amino acid sequence analysis, among others.
Preferred software analysis programs include the ALIGN, CLUSTAL W, and BLAST programs (e.g., BLAST 2.1 , BL2SEQ, and later versions thereof). For amino acid sequence analysis, a weight matrix, such as the BLOSUM matrixes (e.g., the BLOSUM45, BLOSUM50, BLOSUM62, and BLOSUM80 matrixes), Gonnet matrixes, or PAM matrixes (e.g., the PAM30, PAM70, PAM120, PAM160, PAM250, and PAM350 matrixes), are used in determining identity. The BLAST programs provide analysis of at least two amino acid sequences, either by aligning a selected sequence against multiple sequences in a database (e.g., GenSeq), or, with BL2SEQ, between two selected sequences. BLAST programs are preferably modified by low complexity filtering programs such as the DUST or SEG programs, which are preferably integrated into the BLAST program operations. If gap existence costs (or gap scores) are used, the gap existence cost preferably is set between about -5 and -15. Similar gap parameters can be used with other programs as appropriate. The BLAST programs and principles underlying them are further described in, e.g., Altschul et al., "Basic local alignment search tool", 1990, J. Mol. Biol, v. 215, pages 403-410.
For multiple sequence analysis, the CLUSTAL W program can be used. The
CLUSTAL W program desirably is run using "dynamic" (versus "fast") settings. Amino acid sequences are evaluated using a variable set of
BLOSUM matrixes depending on the level of identity between the sequences. The CLUSTAL W program and underlying principles of operation are further described in, e.g., Higgins et al., "CLUSTAL V: improved software for multiple sequence alignment", 1992, CABIOS, 8(2), pages 189-191 .
In another embodiment, the compound binding talin is an antibody against talin. There are well-known antibodies against talin which can be useful in the present invention to inhibit talin's interaction with vinculin. Illustrative non- limitative examples are: Ab 05-1 144 clone TD77 (Merck Millipore); MAB1676- C, clone TA205 (Merck Millipore); MAB1676 NT, a.a. 139-433, clone TA205 (Merck Millipore); N-Term, Ascites Free, (Merck Millipore); Ab57758 (Abeam); Ab71333 (Abeam); and the following antibodies of Santa Cruz Biotechnology: A-1 1 ; C-20; C-9; H-18; H-300; T-20; TA205; 2Q1089; TA205; 8D4, and YQ- 16.
In another embodiment, the compound binds to vinculin protein. Peptides that bind to vinculin have been widely disclosed in the state of the art (see, for example Bass M. D. et al., 2002, supra).
In another embodiment, the compound binds to a talin binding site. In another embodiment, the compound binds to a vinculin fragment corresponding to positions 1 to 200 or a variant thereof having an identity of at least 85%, the numbering position being in respect of chicken vinculin protein sequence with the Uniprot database accession number P12003, human vinculin protein sequence with the Uniprot database accession number P18206 or mouse vinculin protein sequence with the Uniprot database accession number Q64727.
In another embodiment, the compound binds to a vinculin fragment
corresponding to positions 1 to 131 , the amino acid positions being provided with respect to chicken, mouse or human vinculin sequence with the Uniprot references pointed out above.
In another embodiment, the compound binding to vinculin is a peptide. In another embodiment, the compound binding to vinculin is a peptide
comprising a sequence selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5, or a variant having an identity, with respect to any of sequence SEQ ID NO: 4 or SEQ ID NO: 5 of at least 85%. In another embodiment, the compound binding to vinculin is a peptide selected from the group consisting of: SEQ ID NO: 4, SEQ ID NO: 5, or a variant thereof having an identity, with respect to any of sequence SEQ ID NO: 4 or SEQ ID NO: 5 of at least 85%.
SEQ ID NO: 4
STG G F D DVYD W ARG VSSALTTTLVATR,
SEQ ID NO: 5
YTKKELIESARKVSEKVSHVLAALQA
In another embodiment, the compound binding to vinculin is an antibody. As above for talin, there are well-known antibodies against vinculin. Illustrative non-limitative examples are: ab18058 (Abeam), ab73412 (Abeam), Mab1676 (Merck Millipore), among others.
Although both, peptides and antibodies binding either to talin or vinculin are currently available, the skilled person, starting from the well-known
sequences of talin and vinculin, their characterized binding sites, etc., can develop further peptides using routine technology. For that, the skilled person can use the protocols already disclosed in the state of the art (Adey N. B et al., supra, and Bass M. D. et al., supra) or, alternatively, can make use of alternative means.
In a screening assay to identify an agent which blocks the interaction between talin and vinculin, the detection and measurement of this binding interaction will be dependent on the type of screening assay performed and the labels used. Such screening assays to detect binding between two proteins in the presence of a test agent are well-known in the art.
In one embodiment, the inhibitors of the invention are administered in combination with one or more anti-cancer agents. An anti-cancer agent may be, for instance, methotrexate, vincristine, adriamycin, cisplatin, non-sugar containing chloroethylnitrosoureas, 5-fluorouracil, mitomycin C, bleomycin, doxorubicin, dacarbazine, taxol, fragyline, Meglamine GLA, valrubicin,
carmustaine and poliferposan, MMI270, BAY 12-9566, RAS farnesyl transferase inhibitor, farnesyl transferase inhibitor, MMP, MTA/LY231514, LY264618/Lometexol, Glamolec, CI-994, TNP-470, Hycamtin/Topotecan, PKC412, Valspodar/PSC833, Novantrone/Mitroxantrone, Metaret/Suramin, Batimastat, E7070, BCH-4556, CS-682, 9-AC, AG3340, AG3433, Incel/VX- 710, VX-853, ZD0101 , ISI641 , ODN 698, TA 2516/Marmistat,
BB2516/Marmistat, CDP 845, D2163, PD183805, DX895 if, Lemonal DP 2202, FK 317, Picibanil/OK-432, AD 32/Valrubicin, Metastron/strontium derivative, Temodal/Temozolonnide, Evacet/liposomal doxorubicin,
Yewtaxan/Paclitaxel, Taxol/Paclitaxel, Xeload/Capecitabine,
Furtulon/Doxifluridine, Cyclopax/oral paclitaxel, Oral Taxoid, SPU- 077/Cisplatin, HMR 1275/Flavopiridol, CP-358 (774)/EGFR, CP-609
(754)/RAS oncogene inhibitor, BMS-182751 /oral platinum, UFT
(Tegafur/Uracil), Ergamisol/Levamisole, Eniluracil/776C85/5FU enhancer, Campto/Levamisole, Camptosar/lrinotecan, Tumodex/Ralitrexed,
Leustatin/Cladribine, Paxex/Paclitaxel, Doxil/liposomal doxorubicin,
Caelyx/liposomal doxorubicin, Fludara/Fludarabine,
Pharmarubicin/Epirubicin, DepoCyt, ZD1839, LU 79553/Bis-Naphtalimide, LU 103793/Dolastain, Caetyx/liposomal doxorubicin, Gemzar/Gemcitabine, ZD 0473/Anormed, YM 1 16, iodine seeds, CDK4 and CDK2 inhibitors, PARP inhibitors, D4809/Dexifosamide, Ifes/Mesnex/lfosamide, Vumon/Teniposide, Paraplatin/Carboplatin, Plantinol/cisplatin, Vepeside/Etoposide, ZD 9331 , Taxotere/Docetaxel, prodrug of guanine arabinoside, Taxane Analog, nitrosoureas, alkylating agents such as melphelan and cyclophosphamide, Aminoglutethimide, Asparaginase, Busulfan, Carboplatin, Chlorombucil,
Cytarabine HCI, Dactinomycin, Daunorubicin HCI, Estramustine phosphate sodium, Etoposide (VP16-213), Floxuridine, Fluorouracil (5-FU), Flutamide, Hydroxyurea (hydroxycarbamide), Ifosfamide, Interferon Alfa-2a, Alfa-2b, Leuprolide acetate (LHRH-releasing factor analogue), Lomustine (CCNU), Mechlorethamine HCI (nitrogen mustard), Mercaptopurine, Mesna, Mitotane
(o.p-DDD), Mitoxantrone HCI, Octreotide, Plicamycin, Procarbazine HCI, Streptozocin, Tamoxifen citrate, Thioguanine, Thiotepa, Vinblastine sulfate, Amsacrine (m-AMSA), Azacitidine, Erthropoietin, Hexamethylmelamine (HMM), Interleukin 2, Mitoguazone (methyl-GAG; methyl glyoxal bis- guanylhydrazone; MGBG), Pentostatin (2'-deoxycoformycin), Semustine
(methyl-CCNU), Teniposide (VM-26) or Vindesine sulfate, signal transduction inhibitors (such as MEK, BRAF, AKT, her2, mTOR, and PI3K inhibitors), but it
is not so limited.
In another embodiment of the first aspect of the invention, the solid tumor is selected from colon, colorectal, prostate, and pancreas cancer.
In a second aspect the present invention provides a peptide of formula (I) or a pharmaceutically acceptable salt thereof.
As used herein, the term "pharmaceutically acceptable salt" refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, trifluoroacetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate,
camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p- toluenesulfonate, undecanoate, valerate salts, and the like. Salts derived from appropriate bases include alkali metal, alkaline earth metal, and ammonium. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
The term (CrC5)alkyl refers to a saturated straight or branched alkyl chain having from 1 to 5 carbon atoms. The term (C-i-C-io)alkyl refers to a saturated straight or branched alkyl chain having from 1 to 10 carbon atoms. Illustrative non-limitative examples are: methyl, ethyl, propyl, isopropyl, butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, neo-pentyl and n-hexyl.
When used for diagnostic purposes, the can be labeled with a detectable label and, accordingly, the peptide of the invention can serve as intermediate in the preparation of labeled peptides.
The term "label" can be molecules or compounds, which when covalently attached to the peptide permit detection of the peptide in vivo, for example, in a patient to whom the peptide has been administered, or in vitro, e.g., in a sample or cells. Suitable detectable labels are well known in the art and include, by way of example, radioisotopes, fluorescent labels (e.g., such as rhodamine, fluorescein), and the like. The particular detectable label employed is not critical and is selected to be detectable at non-toxic levels. Selection of the such labels is well within the skill of the art.
Covalent attachment of a detectable label to the peptide is accomplished by conventional methods well known in the art. Labeling usually involves covalent attachment of one or more labels, directly or through a spacer (e.g., an amide group), to non-interfering position(s) on the peptide that are predicted by quantitative structure-activity data and/or molecular modeling. Such non-interfering positions generally are positions that do not form direct contacts with the macromolecule(s) to which the peptidomimetic binds to produce the therapeutic effect. Derivatization (e.g., labeling) of
peptidomimetics should not substantially interfere with the desired biological or pharmacological activity of the peptidomimetic.
The term (C2-C5)heteroalkyl represents a known non-polymeric C-heteroalkyl radical consisting of from 2 to 5 members where at least one of the members is O, S, or NH, and the remaining members are selected from CH, C(=O), and CH2.
The term "halogen" refers to the group in the periodic table consisting of five chemically related elements: fluorine (F), chlorine (CI), bromine (Br), iodine
(I), and astatine (At).
The term (CrC5)haloalkyl refers to a saturated straight or branched alkyl chain having from 1 to 5 carbon atoms wherein at least one of the hydrogen atoms is replaced by an halogen atom selected from F, CI, I, and Br.
In one embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, is -H, -C(O)-(CrCio)alkyl or rhodamine.
In one embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, R2 is a known ring system, as defined above, which is optionally substituted by -C(O)R3. In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, R2 is a known ring system substituted by -C(O)R3. In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, R2 is a phenyl radical. In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, R3 is a phenyl radical. In another embodiment, R2 is a benzophenone radical.
In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, X-, is p- benzoyl-L-phenyl alanine. In another embodiment of the second aspect of the invention, the amino group of p-benzoyl-L-phenyl alanine is acetylated. In another embodiment of the second aspect of the invention, the amino group of p-benzoyl-L-phenyl alanine is conjugated to a detectable label. In another embodiment of the second aspect of the invention, the amino group of p- benzoyl-L-phenyl alanine is conjugated to rhodamine.
In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, X2 is a L- or D- basic amino acid. In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, the basic amino acid is Arg, either in D- or L-configuration.
In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, R4 is a pyridyl radical and X3 is 3-pyridyl alanine. In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, R5 is -NHR6. In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, R5 is -NHR6, being R6 -H. In another embodiment of the second aspect of the invention, optionally in combination with any of the
embodiments provided above or below, n is 1 and R5 is -NHR6. In another embodiment of the second aspect of the invention, optionally in combination with any of the embodiments provided above or below, n is 1 and R5 is - NHR6, being R6 -H.
In another embodiment of the second aspect of the invention, the peptide of formula (I) is one comprising the sequence SEQ ID NO: 6, SEQ ID NO: 7 or SEQ ID NO: 8. The peptides of the invention can be obtained following routine protocols, such as the protocol "deprotection-wash-coupling-wash".
The amino acid coupling by condensation of the carboxylic group of one amino acid with the amino group of another amino acid residue can be performed in solid phase (i.e., on a resin).
The general principle of solid phase peptide synthesis is one of repeated cycles of deprotection-wash-coupling-wash. The free N-terminal amine of a solid-phase attached peptide is coupled to a single N-protected amino acid unit. This unit is then deprotected, revealing a new N-terminal amine to which a further amino acid may be attached. Amino acids have reactive moieties at the N- and C-termini, which facilitates amino acid coupling during synthesis. Many amino acids also have reactive side chain functional groups, which can interact with free termini or other side chain groups during synthesis and peptide elongation and negatively influence yield and purity. To facilitate proper amino acid synthesis with minimal side chain reactivity, chemical groups have been developed to bind to specific amino acid functional groups
and block, or protect, the functional group from nonspecific reactions. These protecting groups, while vast in nature, can be separated into three groups, as follows: N-terminal protecting groups, C-terminal protecting groups (mostly used in liquid-phase synthesis), and side chain protecting groups.
"Protecting group" (PG) refers to a grouping of atoms that when attached to a reactive group in a molecule masks, reduces or prevents that reactivity.
Suitable amino-protecting groups include methyl carbamate, ethyl
carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9- (10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD- Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), 1 -(1 -adamantyl)-1 -methylethyl carbamate (Adpoc), 1 ,1 - dimethyl-2-haloethyl carbamate, 1 ,1 -dimethyl-2,2-dibromoethyl carbamate (DB-t-BOC), 1 ,1 -dimethyl-2,2,2-trichloroethyl carbamate (TCBOC), 1 -methyl- 1 -(4-biphenylyl)ethyl carbamate (Bpoc), 1 -(3,5-di-t-butylphenyl)-1 -methylethyl carbamate (t-Bumeoc), 2-(2'- and 4'-pyridyl)ethyl carbamate (Pyoc), 2-(N,N- dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate (BOC), 1 - adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1 -isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4- nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz), p-nitobenzyl carbamate, p-bromobenzyl carbamate, p- chlorobenzyl carbamate, 2,4-dichlorobenzyl carbamate, 4- methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate,
diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2- methylsulfonylethyl carbamate, 2-(p-toluenesulfonyl)ethyl carbamate, [2-(1 ,3- dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl carbamate (Mtpc),
2,4-dimethylthiophenyl carbamate (Bmpc), 2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl carbamate (Ppoc), 1 ,1 -dimethyl-2- cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, p- (dihydroxyboryl)benzyl carbamate, 5-benzisoxazolylmethyl carbamate, 2- (trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-nitrobenzyl carbamate, 3,4- dimethoxy-6-nitrobenzyl carbamate, phenyl(o-nitrophenyl)methyl carbamate,
phenothiazinyl-(10)-carbonyl derivative, N'-p-toluenesulfonylaminocarbonyl derivative, N'-phenylaminothiocarbonyl derivative, t-amyl carbamate, S-benzyl thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl carbamate, p- decyloxybenzyl carbamate, 2,2-dimethoxycarbonylvinyl carbamate, o-(N,N- dimethylcarboxamido)benzyl carbamate, 1 ,1 -dimethyl-3-(N,N- dimethylcarboxamido)propyl carbamate, 1 ,1 -dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate, 2-furanyl methyl carbamate, 2-iodoethyl carbamate, isobornyl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p'-methoxyphenylazo)benzyl carbamate, 1 -methylcyclobutyl carbamate, 1 - methylcyclohexyl carbamate, 1 -methyl-1 -cyclopropylmethyl carbamate, 1 - methyl-1 -(3,5-dimethoxyphenyl)ethyl carbamate, 1 -methyl-1 -(p- phenylazophenyl)ethyl carbamate, 1 -methyl-1 -phenylethyl carbamate, 1 - methyl-1 -(4-pyridyl)ethyl carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate, 2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, 2,4,6-trimethylbenzyl carbamate, formamide, acetamide, chloroacetamide, trichloroacetamide, trifluoroacetamide, phenylacetamide, 3- phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N- benzoylphenylalanyl derivative, benzamide, p-phenylbenzamide, o- nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (Ν'- dithiobenzyloxycarbonylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2- methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl- 3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine derivative, o- nitrobenzamide, o-(benzoyloxymethyl)benzamide, 4,5-diphenyl-3-oxazolin-2- one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N- 2,5-dimethylpyrrole, N-1 ,1 ,4,4-tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1 ,3-dimethyl-1 ,3,5-triazacyclohexan-2-one, 5- substituted 1 ,3-dibenzyl-1 ,3,5-triazacyclohexan-2-one, 1 -substituted 3,5- dinitro-4-pyridone, N-methylamine, N-allylamine, N-[2- trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N-(1 - isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N- benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, Ntriphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr), N-9-phenylfluorenylamine (PhF), N-2,7-dichloro-9- fluorenylmethyleneamine, N-ferrocenylmethylamino (Fern), N-2-picolylamino N'-oxide, N-1 ,1 -dimethylthiomethyleneamine, N-benzylideneamine, N-p-
methoxybenzylideneamine, N-diphenylmethyleneamine, N-[(2- pyridyl)nnesityl]nnethyleneannine, N-(N',N'-dimethylaminomethylene)annine, Ν,Ν'-isopropylidenediannine, N-p-nitrobenzylideneamine, N- salicylideneamine, N-5-chlorosalicylideneamine, N-(5-chloro-2- hydroxyphenyl)phenylmethyleneannine, N-cyclohexylideneamine, N-(5,5- dimethyl-3-oxo-1 -cyclohexenyl)annine, N-borane derivative, N-diphenylborinic acid derivative, N-[phenyl(pentacarbonylchromium- or
tungsten)carbonyl]amine, N-copper chelate, N-zinc chelate, N-nitroamine, N- nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp),
dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate, benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4- dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4- methoxybenzenesulfenamide, triphenylmethylsulfenamide, 3- nitropyridinesulfenamide (Npys), p-toluenesulfonamide (Ts),
benzenesulfonamide, 2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4- methoxybenzenesulfonamide (Pme), 2,3,5,6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6-trimethylbenzenesulfonamide (Mts), 2,6-dimethoxy-4- methylbenzenesulfonamide (iMds), 2,2,5,7,8-pentamethylchroman-6- sulfonamide (Pmc), methanesulfonamide (Ms), β- trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4',8'- dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS), benzylsulfonamide trifluoromethylsulfonamide, and phenacylsulfonamide.
Examples of suitably protected carboxylic acids further include, but are not limited to, silyl-, alkyl-, alkenyl-, aryl-, and arylalkyl-protected carboxylic acids Examples of suitable silyl groups include trimethylsilyl, triethylsilyl, t- butyldimethylsilyl, t-butyldiphenylsilyl, triisopropylsilyl, and the like. Examples of suitable alkyl groups include methyl, benzyl, p-methoxybenzyl, 3,4- dimethoxybenzyl, trityl, t-butyl, tetrahydropyran-2-yl. Examples of suitable alkenyl groups include allyl. Examples of suitable aryl groups include optionally substituted phenyl, biphenyl, or naphthyl. Examples of suitable arylalkyl groups include optionally substituted benzyl (e.g., p-methoxybenzyl (MPM), 3,4-dimethoxybenzyl, O-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6- dichlorobenzyl, p-cyanobenzyl), and 2- and 4-picolyl.
The amidation of the C(t) end and the alkylation of the N(t) end can be performed using well-known protocols. In a third aspect the present invention provides a conjugate comprising the peptide as defined in the first aspect of the invention.
In a particular embodiment, optionally in combination with one or more features of the various embodiments described above or below, the conjugate of the peptide is one which comprises a one which comprises a material which increases its half-life. In an embodiment, optionally in combination with one or more features of the various embodiments described above or below, the conjugate of the peptide or the construct is one wherein the material which increases its half-life is a polymeric material; preferably a water soluble polymer. In an embodiment, optionally in combination with one or more features of the various embodiments described above or below, the conjugate of the peptide or the construct is one wherein the material which increases their half-lives is selected from the group consisting of polyalkylene oxide such as for example polyethylene glycol (PEG), polypropylene glycol, polyoxyethylenated polyols; alkyl-terminated polyalkylene oxides (PAO's) such as for example monomethyl-terminated polyethylene glycols (mPEG's); and mPEG.
In another embodiment of the third aspect of the invention, the peptide is conjugated to a cell penetrating peptide.
In the present invention the term "cell penetrating peptide" ("CPP") refers to short peptides that facilitate cellular uptake of various molecular cargo (from nanosize particles to small chemical molecules and large fragments of DNA). The "cargo" is associated to peptides via the C(t) or N(t)-end, either through chemical linkage via covalent bonds or through non-covalent interactions. The function of the CPPs are to deliver the cargo into cells, a process that commonly occurs through endocytosis with the cargo delivered to delivery vectors for use in research and medicine. Current use is limited by a lack of cell specificity in CPP-mediated cargo delivery and insufficient understanding of the modes of their uptake. CPPs typically have an amino acid composition that either contains a high relative abundance of positively charged amino
acids such as lysine or arginine or has sequences that contain an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids. These two types of structures are referred to as polycationic or amphipathic, respectively. A third class of CPPs are the hydrophobic peptides, containing only apolar residues, with low net charge or have hydrophobic amino acid groups that are crucial for cellular uptake. The conjugation of the CPP to the peptide provided in the present invention can be performed following well-known routine protocols, such as solid phase synthesis or solution selective capping.
The present invention also provides a pharmaceutical composition comprising the peptide as defined in the second aspect of the invention or the conjugate as defined in the third aspect of the invention. The expression "therapeutically effective amount" as used herein, refers to the amount of a compound that, when administered, is sufficient to prevent development of, or alleviate to some extent, one or more of the symptoms of the disease which is addressed. The particular dose of compound
administered according to this invention will of course be determined by the particular circumstances surrounding the case, including the compound administered, the route of administration, the particular condition being treated, and the similar considerations.
The expression "pharmaceutically acceptable excipients or carriers" refers to pharmaceutically acceptable materials, compositions or vehicles. Each component must be pharmaceutically acceptable in the sense of being compatible with the other ingredients of the pharmaceutical composition. It must also be suitable for use in contact with the tissue or organ of humans and animals without excessive toxicity, irritation, allergic response, immunogenicity or other problems or complications commensurate with a reasonable benefit/risk ratio. Likewise, the term "veterinary acceptable" means suitable for use in contact with a non-human animal. Examples of suitable pharmaceutically acceptable excipients are solvents, dispersion media, diluents, or other liquid vehicles, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like. Except insofar as any conventional excipient medium is incompatible with a substance or its
derivatives, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this invention.
The formulations of the pharmaceutical compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of bringing the active ingredient into association with a excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, shaping and/or packaging the product into a desired single- or multi-dose unit.
Throughout the description and claims the word "comprise" and variations of the word, are not intended to exclude other technical features, additives, components, or steps. Furthermore, the word "comprise" encompasses the case of "consisting of. Additional objects, advantages and features of the invention will become apparent to those skilled in the art upon examination of the description or may be learned by practice of the invention. The following examples are provided by way of illustration, and they are not intended to be limiting of the present invention. Furthermore, the present invention covers all possible combinations of particular and preferred embodiments described herein. EXAMPLES
Example 1 : rigidity causes YAP translocation in a talin-dependent way a) Cells a.1 . Talin 1 -/- Mouse embryonic fibroblasts (MEFs) were described previously (Zhang, X. et al., "Talin depletion reveals independence of initial cell spreading from integrin activation and traction" Nat. Cell Biol. 10, 1062-1068 (2008)), and cultured in Dulbecco's Modified Eagle Medium (DMEM) 1 x (Life Technologies, 41965) supplemented with 15% fetal bovine serum (FBS).
These MEFs have a wild type phenotype due to expression of talin 2 (Zhang, X. et al., 2008)
a.2. Talin 2 levels were knocked down using a Talin 2 shRNA which contained a puromycin resistance, as previously described in Zhang, X. et al., 2008, supra. The transfection was performed with a Neon transfection device, following manufacturer's instructions 5 days before experiments (hereinafter Talin 1 -/-MEFs). b) Preparation and characterization of polyacrylannide gels. These gels were obtained by the combination of different concentrations of acrylamide and bis-acrylamide as shown in Table 1 :
tetramethylethylenediamine (Sigma), 0.4% fluorescent red carboxylated nanobeads (Invitrogen), and 4.8 mg/ml NH-acrylate. After polymerization in glass-bottom dishes gels were coated by incubation with fibronectin (Sigma) overnight at 4 °C. The stiffness (Young's modulus) of polyacrylannide gels was measured by atomic force microscopy (AFM) as previously described
(Alcaraz, J. et al., Microrheology of Human Lung Epithelial Cells Measured by Atomic Force Microscopy. Biophys. J. 84, 2071 -2079 (2003)). Briefly, measurements were made with a custom-built AFM attached to an inverted optical microscope (Nikon TE200). Silicon nitride pyramidal tips with an effective half angle Θ of 20° and a nominal spring constant of k=0.01 -0.03 N/m were used (MLCT, Bruker). The actual spring constant was calibrated by thermal tuning using the simple harmonic oscillator model (Hutter, J.L. & Bechhoefer, J. Calibration of Atomic-Force Microscope Tips. Review of Scientific Instruments 64, 1868-1873 (1993). The Young's modulus was measured by recording 10 force-displacement curves with a peak-to-peak
amplitude of 6 μιτι and a frequency of 1 Hz. Three points near the gel center were selected in each gel, separated 5 μιτι from each other. For each stiffness, >6 gels produced in two batches were measured. To compute the Young's modulus (E), the Hertz model equation for pyramidal tips was fitted to the force-displacement curves. The equation was fitted for an effective indentation of 1000 nm. c) Cell culture in polyacrylamide cells Talin 1 -/- MEFs with and without talin 2 shRNA transfection were plated on polyacrylamide gels of different rigidities.
Following the same protocol as the one disclosed above under section (b), it was found that on the softer substrates talin depletion with shRNA had no effect.
However, above a threshold rigidity of 5 kPa talin 1 -/- cells activated
(translocated to the nucleus) the mechanosensitive transcriptional regulator YAP (Dupont, S. et al. Role of YAP/TAZ in mechanotransduction. Nature 474, 179-183 (201 1 )). YAP activation was studied by immunostaining. Briefly, the cells were fixed with 4% paraformaldehyde, permeabilized with 0.1 % Triton X- 100, and labelled first with primary YAP monoclonal antibody (clone 63.7 produced in mouse, Santa Cruz, 1 h, room temperature), and then with Alexa- conjugated secondary antibody (Invitrogen) (1 h, room
temperature). Phalloidin-Tetramethylrhodamine B isothiocyanate (Sigma), used to label actin, was added with the secondary antibody. Fluorescence images were then acquired with a 60x oil immersion objective (NA 1 .40) using a spinning disk confocal microscope (Andor). The degree of YAP nuclear localization was assessed by calculating the ratio between YAP fluorescence in the nuclear region and the cytoplasmic region immediately adjacent.
Nuclear and cytoplasmic regions were previously determined by co-staining the nucleus with Hoechst 33342 (Invitrogen). In contrast to the observed in talin 1 -/- MEFS, Talin 1 -/-MEFs transfected with talin 2 shRNA did not localize YAP to the nucleus at any rigidity (FIG. 1 ).
These results show that force transduction is triggered above a rigidity threshold in a talin-dependent manner, leading to YAP activation.
Example 2: blocking of talin-vinculin binding and biological
consequences Talin 1 -/- MEFs, obtained as described in Example 1 , were cultured in DMEM supplemented with 10% FBS and transfected with the Neon transfection device according to the manufacturer's instructions, with the construct EGFP- VD1 (Addgene plasmid # 46270, described as pEGFPC1/GgVcl 1 -258; VD1 herein), previously described in Cohen, D.M. et al., "A conformational switch in vinculin drives formation and dynamics of a talin-vinculin complex at focal adhesions", J. Biol. Chem. 281 , 16006-16015 (2006).
The resulting cells were seeded in polyacrylamide gels as disclosed in Example 1 . YAP localization was studied as described above (Example 1 ). Blocking vinculin function through VD1 transfection in talin 1 -/- MEFs had the same effect than talin 2 depletion, that is, YAP remained cytosolic at all rigidities (FIG. 2). Therefore, VD1 inhibits the interaction talin/vinculin.
These experimental data also support that avoiding the interaction between vinculin and talin (for example by transfecting cells with VD1 ) no YAP translocation occurs and, consequently, this oncogene remains inactive. This means that by inhibiting the interaction talin-vinculin a positive effect in cancer treatment can be achieved.
Analogously, Talin 1 -/- MEFs, obtained as described in Example 1 , were cultured in DMEM supplemented with 10% FBS, and the peptide of sequence
SEQ ID NO: 8 was added at a concentration of 60 μΜ for 1 hour.
Testing the peptide of sequence SEQ ID NO: 8, which specifically binds to R3 region, it was also found that YAP remains in cytosol, which is indicative that the peptide inhibits talin/vinculin interaction (FIG. 4).
Example 3: identification of talin's VBS domain involved in YAP translocation EGFP-talin1 was a gift of Prof. Critchley's lab and described previously47, EGFP-talin1 IVVI was prepared in house from EGFP-talin1 by introducing four point mutations (T809I/T833V/T867V/T901 1).
Talin 1 -/- MEFs obtained as described in a.2. were cultured in DMEM with 15% FBS. In order to identify the VBS domain involved in YAP translocation, these cells were depleted of talin 2 with talin 2 shRNA and co-transfected or not, using the Neon transfection device according to manufacturer's
intructions, with a wild-type talin 1 containing plasmid (EGFP-Talin1 ; Bate, N. et al. Talin contains a C-terminal calpain2 cleavage site important in focal adhesion dynamics. PLoS One 7, e34461 (2012))or with a Talin mutant containing 4 point mutations in the 809, 833, 867 and 901 residues
(T809I/T833V/T867V/T901 1), which belong to the R3 domain of Talin and have been shown to increase the force required for talin unfolding(EGFP- Talinl IWI, home made; Yao, M. et al. Mechanical activation of vinculin binding to talin locks talin in an unfolded conformation. Scientific reports 4, 4610 (2014)). This should increase the threshold rigidity for unfolding, displacing the effect of talin to higher rigidities.
To validate the engagement of the R3 domain in the control of YAP nuclear translocation all transfected cells were seeded in polyacrylamide gels as disclosed in example 1 , and YAP translocation was assessed as described in example 1 . As expected, talin 2- depleted cells rescued with EGFP-talin 1 recovered the behaviour of talin 1 -/- cells, showing that both isoforms had the same effect (Fig. 3). However, cells transfected with EGFP-Talin1 IWI diverged from talin depleted cells in terms of YAP translocation at higher rigidities than cells transfected with EGFP-Talin1 (Fig. 3). A significant difference in the rigidity threshold needed to induce YAP translocation in the Talinl IWI mutant transfected cells (15 instead of 1 1 kPa for EGFP Talinl transfected cells) was observed. This result demonstrates that YAP activation in response to rigidity is triggered by talin unfolding in the R3 domain, and VBS exposition.
Example 4: synthesis of peptide SEQ ID NO: 8
Peptide SEQ ID NO: 8 was synthesized by standard 9- fluorenylmethoxycarbonyl/tert-butyl (Fmoc/tBu) solid-phase peptide synthesis. Syntheses were performed on a 100-μηηοΙ scale/each using the Rink-amide Chemmatrix resin.
Peptide elongation and other solid-phase manipulations were done manually in polypropylene syringes, each fitted with a polyethylene porous disk.
Solvents and soluble reagents were removed by suction. Previous to starting the synthesis, the resin was conditioned by swelling in dichloromethane (30 min) and washing with dimethylformamide (5 x 30 s), followed by washing with a 20% piperidine solution in dimethylformamide (1 x 1 min and 2 x 10 min). Finally, the resin was washed with dimethylformamide (5 x 30 s). During synthesis and resin conditioning, the Fmoc group was removed by treating the resin with 20% piperidine in dimethylformamide (4 mL/g resin, 1 x 1 min and 2 x 10 min). To remove the Fmoc group from Fmoc- Pro-OH, an additional treatment with 1 ,8-diazabicycloundec-7-ene, toluene, piperidine and dimethylformamide (5: 5: 20: 70) (1 x 5 min) was performed. For peptide elongation, Na-Fmoc-protected amino acids (3 eq., Iris Biotech), Oxyma pure (3 eq.), and Ν,Ν-diisopropylcarbodiimide (DIC, 6 eq.) were used for the couplings. Rhodamine B (Rhd) was coupled at the N-terminal part of the peptides when required using the same coupling steps. Couplings were performed in dimethylformamide (3 ml_) with intermittent manual stirring for 1 h.
Final amide peptides were cleaved from the resin by treatment with a mixture of trifluoroacetic acid, water, 1 ,2-ethandithiol and triisopropylsilane
(94:2.5:2.5:1 ) for 1 h. The cleaved peptide was precipitated from the cleavage cocktail through addition of cold tert-butyl methyl ether. The suspension was then centrifuged at 4000 rpm and 4°C for 10 min. The ether fraction was discarded and the process was repeated up to 3 times in order to remove all scavengers and by-products from the cleavage of side-chain protecting groups. The peptide residue thus obtained was dried by means of a N2 flow stream.
Peptide was cycled in mixture of water and acetonitrile (1 :1 ) at 0.1 mM concentration and pH 7.4 in the presence of 5% dimethyl sulfoxide (DMSO) for 48 h. This reaction was monitored by HPLC. Once completed, the crude of the reaction was lyophilized and dissolved again in acetonitrile and water (1 :1 ).
The peptide was analyzed at λ = 220 nm by analytical HPLC [Waters Alliance
2695 separation module equipped with a 2998 photodiode array detector, Sunfire C18 column (100 mm x 4.6 mm x 3.5 Dm, 100 A, Waters), and
Empower software; flow rate = 1 mL/min; gradient = 0-100% B in 8 min (A = 0.045% trifluoroacetic acid in water, and B = 0.036% trifluoroacetic acid in acetonitrile).
Then, the peptide was purified by semi-preparative HPLC [Waters 2700 Sample Manager equipped with a Waters 2487 dual λ absorbance detector, a Waters 600 controller, a Waters fraction collection II, a Symmetry C18 column (100 mm x 30 mm, 5 μητι, 100 A, Waters) and Millenium chromatography manager software]. Flow rate = 15 mL/min; solvents: A = 0.1 % trifluoroacetic acid in water, and B = 0.05% trifluoroacetic acid in acetonitrile.
Finally, the peptide was characterized by MALDI-TOF mass spectrometry [Voyager-DE RP MALDI-TOF, PE Biosystems with a N2 laser of 337 nm], and by HPLC-MS [Waters Alliance 2695 equipped with 2998 photodiode array detector, ESI-MS micromass ZQ, Sunfire C18 column (2.1 x 100mm, 3.5 μητι, 100 A, Waters) and Masslynx software; flow rate = 0.3 mL/min; gradient = 0- 100% B in 8 min (A = 0.1 % formic acid in water, and B = 0.07% formic acid in acetonitrile)]. [M+H]+ 1084.94 Da.
Example 5: in vitro data of antitumoral activity based on MTT assay
Cell and reagents: Pane 1 human pancreatic epithelioid carcinoma (ATCC), HT29 Human colorectal adenocarcinoma (ATCC), and HT1 16 human colorectal carcinoma (ATCC) cell lines were cultured in DMEM F-12 (21331 , Life Technologies) medium supplemented with 10% FBS and 1/
Penicillin/streptomycin. Bxpc3 human pancreatic adenocarcinoma (ATCC) cell line were cultured in RPMI 1640 medium (Lonza) supplemented with 10% FBS and 1 % Penicillin/streptomycin. NPKLM prostate cancer cell lines were described previously (A. Aytes et al., ETV4 promotes metastasis in response to activation of PI3-kinase and Ras signaling in a mouse model of advanced prostate cancer. PNAS 1 10, E3506-3515, 2013) and cultured in RPMI 1640 medium (Bio Whitaker) supplemented with 10% FBS and 1 %
Penicillin/streptomycin.
MTT assay:
For MTT assays, two controls, DMSO (peptide carrier) and MTT reagent (Cat. No: 1 1465007001 , Roche) were used. The test protocol was the following:
Tumor cells were washed with PBS before trypsinization. After counting cell density (Neubauer counting chamber, Brand), cells were resuspended in the corresponding media for each cell line (described above), at a density corresponding to 4000 cells in 100μΙ. 4000 cells per well were seeded on 96 well-plates, avoiding outer wells because of evaporation. These outer wells were filled with 100μΙ of PBS. Then, cells were incubated for 24h. After that, the medium was aspirated, 100μΙ of the peptide SEQ ID NO: 8 were added (diluted from the 10mM stock to 60μΜ in medium), and the resulting
suspension was left incubating for 1 hour.
Next, 10μΙ of MTT labelling reagent were added per well and incubated for 4 hours until crystals were formed. Subsequently, 100μΙ of solubilization solution was added to each well and incubated overnight until crystals were solubilized. Finally, the resulting colored solution was measured with a microplate reader (Infinite M200 PRO, Tecan) using 570nm wavelength for measurement and 690nm wavelength for reference.
The values obtained were the subtractions of measurement (570nm) minus reference (690nm). Background reference values from wells without cells were finally subtracted to obtain true values. All conditions were normalized by the mean of the control condition.
Data shown: mean ± SD.
The results are shown in FIG. 5. REFERENCES CITED IN THE APPLICATION
Gilmore A. P. et al., "The cytoskeletal protein talin contains at least two distinct vinculin binding domains", J Cell Biol., 1993, 122(2): 337-347;
Bass M. D. et al., "Further characterization of the interaction between the cytoskeletal proteins talin and vinculin", Biochem. J., 2002, 362, 761 -768;
Adey N. B. et al., "Isolation of peptides from phage-displayed random peptide libraries that interact with the talin-binding domain of vinculin", Biochem J., 1997, 324, 523-528;
Bakolitsa C. et al., "Structural basis for vinculin at sites of cell adhesion", Nature, 2004, 430, 583-586; and Hirata H. et al., "Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions", Am J Cell Physiol, 2014, C607-C620;
Hirata, H. et al., "Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions" Am. J. Physiol. Cell Physiol. 306, C607-620 (2014);
Yao, M. et al. Mechanical activation of vinculin binding to talin locks talin in an unfolded conformation. Scientific reports 4, 4610 (2014); Goult T. B. et al., "RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover", The Journal of Biological Chemistry, 288(12), 8238-8249;
Altschul et al., "Basic local alignment search tool", 1990, J. Mol. Biol, v. 215, pages 403-410;
Higgins et al., "CLUSTAL V: improved software for multiple sequence alignment", 1992, CABIOS, 8(2), pages 189-191 ; Zhang, X. et al., in "Talin depletion reveals independence of initial cell spreading from integrin activation and traction", Nat. Cell Biol, vol. 10, pages 1062-1068 (2008);
Alcaraz, J. et al., Microrheology of Human Lung Epithelial Cells Measured by Atomic Force Microscopy. Biophys. J. 84, 2071 -2079 (2003);
Serra-Picamal, X. et al., "Mechanical waves during tissue expansion", Nat. Phys. 8, 628-U666 (2012));
Dupont, S. et al. Role of YAP/TAZ in mechanotransduction. Nature 474, 179- 183 (201 1 );
Cohen, D.M. et al., "A conformational switch in vinculin drives formation and dynamics of a talin-vinculin complex at focal adhesions", J. Biol. Chem. 281 , 16006-16015 (2006);
Bate, N. et al. Talin contains a C-terminal calpain2 cleavage site important in focal adhesion dynamics. PLoS One 7, e34461 (2012); and
Yao, M. et al. Mechanical activation of vinculin binding to talin locks talin in an unfolded conformation. Scientific reports 4, 4610 (2014).
Claims
1 . A compound inhibiting the interaction between talin and vinculin for use in the treatment of a solid tumor, wherein the compound is selected from a peptide, a small molecule, or an antibody.
2. The compound for use according to claim 1 , which is a peptide.
3. The compound for use according to any of the claims 1 -2, which binds to talin protein.
4. The compound for use according to any of the claims 1 -3, wherein the compound binds to either talin-1 or talin-2 sequence portion comprised from 400 to 2541 , the positions being in respect to the protein sequence available in Uniprot respect of either chicken talin protein with the Uniprot accession number P54939, mouse talin protein with the Uniprot accession number P26039 or human talin protein isoforms with Uniprot database accession numbers Q9Y490 and Q9Y4G6.
5. The compound for use according to claim 4, which binds to a vinculin binding site of talin protein.
6. The compound for use according to claim 5, wherein the compound binds to a talin's fragment from position 787 to 91 1 of mouse talin protein with the Uniprot accession number P26039 (SEQ ID NO: 1 ).
7. The compound for use according to claim 6, the compound being a peptide comprising a sequence selected from the group consisting of: SEQ ID NO: 2; SEQ ID NO: 3, a variant having an identity of at least 85% with SEQ ID NO: 3; SEQ ID NO: 6, SEQ ID NO: 7; and SEQ ID NO: 8.
8. The compound for use according to claim 7, the compound being a peptide of sequence SEQ ID NO: 2; SEQ ID NO: 3, a variant having an identity of at least 85% with SEQ ID NO: 3; or SEQ ID NO: 8.
9. The compound for use according to claim 8, which is the peptide of sequence SEQ ID NO: 8.
10. The compound for use according to any of the claims 1 -2, which binds to vinculin protein.
1 1 . The compound for use according to claim 10, which binds to the talin binding site of vinculin protein.
12. The compound for use according to claim 1 1 , wherein the compound binds to a vinculin fragment corresponding to positions 1 to 200 or a variant thereof having an identity of at least 85%, the numbering position being in respect of chicken vinculin protein sequence with the Uniprot database accession number P12003, human vinculin protein sequence with the Uniprot database accession number P18206 or mouse vinculin protein sequence with the Uniprot database accession number Q64727.
13. The compound for use according to claim 12, wherein the compound binds to a vinculin fragment corresponding to positions 1 to 131 or a variant thereof having an identity of at least 85%.
14. The compound for use according to any of the previous claims 10 to 13, wherein the compound is a peptide comprising a sequence selected from: SEQ ID NO: 4, SEQ ID NO: 5, or a variant having at least 85% of identity with either SEQ ID NO: 4 or 5.
15. The compound for use according to any of the previous claims 10 to 14, wherein the compound is a peptide of sequence SEQ ID NO: 4, SEQ ID NO: 5, or a variant having at least 85% of identity with either SEQ ID NO: 4 or 5.
16. The compound for use according to any of the preceding claims, wherein said treatment comprises administering to a subject simultaneously, sequentially or separately a further anti-cancer drug, and the compound inhibiting the interaction between talin and vinculin.
17. A peptide or a pharmaceutically acceptable salt thereof comprising the sequence of formula (I)
XrXz-Xa Q (I)
wherein:
Xi represents a compound of formula (II)
Ri is selected from the group consisting of -H, -C(O)-(CrCi0)alkyl, and a detectable label;
R2 is selected from -H, (CrC5)alkyl, (C2-C5)heteroalkyl, and a known ring system having from 5 to 6 carbon atoms, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; and the ring system being optionally substituted by one or more radicals
independently selected from the group consisting of -OH, halogen, (CrC5)alkyl, (C C5)haloalkyl, -O-(d-C5)alkyl, and -C(O)R3;
R3 is a ring system having from 5 to 6 carbon atoms, the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; the ring system being optionally substituted by one or more radicals independently selected from the group consisting of -OH, halogen, (CrC5)alkyl, (C C5)haloalkyl, and -O-(C C5)alkyl; and
the wavy line represents the site through which X-, binds to X2;
X2 is a basic amino acid;
X3 is a compound of formul
R4 is a known ring system having from 5 to 6 members which are selected from C, CH, CH2, N, NH, O, S; the system consisting of 1 ring which is saturated, partially unsaturated, or aromatic; and the ring system being optionally substituted by one or more radicals
independently selected from the group consisting of -OH, halogen, (CrC5)alkyl, (C C5)haloalkyl, and -O-(C C5)alkyl; and
the wavy lines represent the site through which X3 binds to Xi and X2; and
(IV)
wherein
R5 is selected from the group consisting of -NHR6, and -OH;
R6 is selected from -H and (C -C10)alkyl;
n is an integer value which is 1 or 2; and
the wavy line represents the site through which X4 binds to X3.
18. The peptide according to claim 17, which comprises the sequence SEQ ID NO: 6, SEQ ID NO: 7 or SEQ ID NO: 8.
19. A conjugate comprising the peptide according to any of the claims 17-18.
20. A pharmaceutical or veterinary composition comprising a therapeutically effective amount of the peptide as defined in any of the claims 17-18 or the conjugate as defined in claim 19, and one or more appropriate
pharmaceutically or veterinary acceptable excipients or carriers.
21 . A peptide according to any of the claims 17-18 or the conjugate according to claim 19 or the pharmaceutical or veterinary composition according to claim 20, for use as a medicament.
22. The compound for use according to any of the claims 1 -16 or the peptide according to any of the claims 17-18 or the conjugate according to claim 19 or the pharmaceutical or veterinary composition according to claim 20 for use in the treatment of a solid tumor selected from pancreas, prostate, colorectal, and colon cancer.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP16382121.8 | 2016-03-18 | ||
EP16382121 | 2016-03-18 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2017158168A1 true WO2017158168A1 (en) | 2017-09-21 |
Family
ID=55701906
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2017/056410 WO2017158168A1 (en) | 2016-03-18 | 2017-03-17 | Inhibitors of talin-vinculin binding for the treatment of cancer |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2017158168A1 (en) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1995020601A1 (en) | 1994-01-31 | 1995-08-03 | The University Of North Carolina At Chapel Hill | Reagents binding vinculin, dynein, and glutathione s-transferase from peptide libraries |
WO2001081377A2 (en) * | 2000-04-21 | 2001-11-01 | Amgen, Inc. | Integrin/adhesion antagonists |
US20030224993A1 (en) * | 2000-10-12 | 2003-12-04 | Hartmut Land | Compositions that inhibit proliferation of cancer cells |
US20070082337A1 (en) * | 2004-01-27 | 2007-04-12 | Compugen Ltd. | Methods of identifying putative gene products by interspecies sequence comparison and biomolecular sequences uncovered thereby |
-
2017
- 2017-03-17 WO PCT/EP2017/056410 patent/WO2017158168A1/en active Application Filing
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO1995020601A1 (en) | 1994-01-31 | 1995-08-03 | The University Of North Carolina At Chapel Hill | Reagents binding vinculin, dynein, and glutathione s-transferase from peptide libraries |
WO2001081377A2 (en) * | 2000-04-21 | 2001-11-01 | Amgen, Inc. | Integrin/adhesion antagonists |
US20030224993A1 (en) * | 2000-10-12 | 2003-12-04 | Hartmut Land | Compositions that inhibit proliferation of cancer cells |
US20070082337A1 (en) * | 2004-01-27 | 2007-04-12 | Compugen Ltd. | Methods of identifying putative gene products by interspecies sequence comparison and biomolecular sequences uncovered thereby |
Non-Patent Citations (24)
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US8957026B2 (en) | Beta-catenin targeting peptides and uses thereof | |
US9487562B2 (en) | Stabilized polypeptides as regulators of RAB GTPase function | |
US11207379B2 (en) | Peptides with anti-cancer activity | |
KR20230057350A (en) | Stapled peptides and methods thereof | |
AU2018311130A1 (en) | Anticancer peptides | |
AU2018311129B2 (en) | Anticancer peptides | |
WO2017158168A1 (en) | Inhibitors of talin-vinculin binding for the treatment of cancer | |
AU2018305923B2 (en) | Anticancer peptides | |
US20230312649A1 (en) | Melanocyte-regulating peptides |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17711655 Country of ref document: EP Kind code of ref document: A1 |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 17711655 Country of ref document: EP Kind code of ref document: A1 |