WO2017139498A1 - Timps encapsulating japanese cedar pollen epitopes - Google Patents

Timps encapsulating japanese cedar pollen epitopes Download PDF

Info

Publication number
WO2017139498A1
WO2017139498A1 PCT/US2017/017248 US2017017248W WO2017139498A1 WO 2017139498 A1 WO2017139498 A1 WO 2017139498A1 US 2017017248 W US2017017248 W US 2017017248W WO 2017139498 A1 WO2017139498 A1 WO 2017139498A1
Authority
WO
WIPO (PCT)
Prior art keywords
composition
particles
particle
antigen
cathepsin
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/017248
Other languages
English (en)
French (fr)
Inventor
Daniel R. Getts
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Cour Pharmaceuticals Development Co Inc
Original Assignee
Cour Pharmaceuticals Development Co Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Cour Pharmaceuticals Development Co Inc filed Critical Cour Pharmaceuticals Development Co Inc
Priority to JP2018560744A priority Critical patent/JP2019504895A/ja
Priority to KR1020187025977A priority patent/KR20180105243A/ko
Publication of WO2017139498A1 publication Critical patent/WO2017139498A1/en
Anticipated expiration legal-status Critical
Priority to JP2022059997A priority patent/JP2022101576A/ja
Priority to JP2025001876A priority patent/JP2025069142A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/385Haptens or antigens, bound to carriers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/35Allergens
    • A61K39/36Allergens from pollen
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/30Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
    • A61K47/34Macromolecular compounds obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyesters, polyamino acids, polysiloxanes, polyphosphazines, copolymers of polyalkylene glycol or poloxamers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5107Excipients; Inactive ingredients
    • A61K9/513Organic macromolecular compounds; Dendrimers
    • A61K9/5146Organic macromolecular compounds; Dendrimers obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, polyamines, polyanhydrides
    • A61K9/5153Polyesters, e.g. poly(lactide-co-glycolide)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/577Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6093Synthetic polymers, e.g. polyethyleneglycol [PEG], Polymers or copolymers of (D) glutamate and (D) lysine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/62Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier

Definitions

  • Japanese cedar pollinosis is a common allergic disease in Japan caused by inhalation of the pollen of the Japanese cedar (Cryptomeria japonica).
  • the prevalence of Japanese cedar pollinosis in Japan may be as high as 30% in individual, nonrandomized populations in schools, factories, and local communities, and it is estimated that up to 20 million people may suffer from the disease.
  • the disease is a major public health problem in Japan in part due to the severity of symptoms, high prevalence, poor spontaneous recover ⁇ ' rate, and high healthcare expenses associated with controlling the disease.
  • Japanese cedar pollinosis is a serious type I allergic disease.
  • Type I allergic diseases are mediated by aberrant Th2-polarized immune responses to otherwise innocuous environmental antigens ⁇ e.g., Japanese cedar pollen) characterized by elevated systemic levels of allergen-specific immunoglobulin E (IgE), mast cell degranulation, and the release of histamine and other chemical mediators of allergy.
  • IgE immunoglobulin E
  • the primary clinical approaches to the treatment of allergic diseases consist generally of antigen (Ag) avoidance (e.g. , allergen avoidance) and symptom control by targeting acute effector molecules with drugs such as antihistamines, leukotriene inhibitors, or broad-acting glucocorticoids.
  • Nanoparticles encapsulating allergenic peptides have been previously demonstrated to reduce allergen-induced Th2 responses in in vivo models (See U.S. Publication No. 2015-0209293, incorporated herein by reference in its entirety). It is therefore possible to encapsulate pollens derived from a variety of environmental sources into nanoparticles for use in the treatment of allergic diseases, such as Japanese cedar pollinosis.
  • Japanese cedar pollen antigen CRYJl has a high degree of similarity to the Jun a 1 antigen of mountain cedar, the Cha o 1 antigen of Japanese cypress, and the Cup a 1 antigen of Cupressus arizonica, suggesting that particular antigens from Japanese cedar pollen may mediate allergic antibody responses that are cross-reactive across multiple conifer pollens.
  • the present invention provides compositions
  • the carrier particle e.g., PLG particle
  • the carrier particle is a poly(lactide-co-glycolide) (PLG) particle with a negative zeta potential.
  • Certain embodiments of the present invention are directed to a composition comprising a biodegradable particle comprising one or more encapsulated antigenic epitopes from Japanese cedar pollen, wherein the biodegradable particle has a negative zeta potential.
  • the biodegradable particle comprises poly(lactide-co-glycolide) (PLG).
  • the biodegradable particle comprises PLG with a copolymer ratio of about 50:50 of polylactic acid:polygly colic acid.
  • the surface of the biodegradable particle is carboxylated. In some embodiments, the carboxylation is achieved by using poly(ethylene-maleic anhydride) (PEMA), or poly(acrylic acid) (PAA).
  • the biodegradable particle has a zeta potential of about -100 mV to about 0 mV. In certain embodiments, the biodegradable particle has a zeta potential of about -50 mV to about -40 mV. In some embodiments, the biodegradable particle has a zeta potential of about -75 mV to about -50 mV. In certain embodiments the biodegradable particle has a zeta potential of about -50 mV.
  • the biodegradable particle has a diameter of between about 0.1 ⁇ to about 10 ⁇ . In some embodiments, the biodegradable particle has a diameter of between about 0.3 ⁇ to about 5 ⁇ . In certain embodiments, the biodegradable particle has a diameter of between about 0.5 ⁇ to about 3 ⁇ . In particular embodiments, the biodegradable particle has a diameter of between about 0.5 ⁇ to about 1 ⁇ . In some embodiments, the biodegradable particle has a diameter of about 0.2 ⁇ to about 0.7 ⁇ . In particular embodiments, the biodegradable particle has a diameter of about 0.5 ⁇ .
  • Certain embodiments of the present invention are directed to a composition comprising a biodegradable particle with a negative zeta potential that comprises one or more encapsulated antigenic epitopes from Japanese cedar pollen.
  • the one or more encapsulated antigenic epitopes from Japanese cedar pollen comprises Cry j 1, Cry j 2, Cry j 3, Cry j 4, Cry j IFR, Cry j Chitinase, Cry j Asp, Cry j LTP, and/or Cry j CPA9.
  • the one or more encapsulated antigenic epitopes from Japanese cedar pollen comprises CRYJ1 or a fragment or variant thereof.
  • CRYJ1 has an amino acid sequence of MDNPIDSSWRGDSNWAQNRMKLADSAVGFGSSTMGGKGGDLYTVTNSDDDPVNP APGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPSVFI KRVSNVIIHGLHLYGSSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFS NSSDGLVDVTLSSTGVTISN LFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPN SGQRMPRARYGLVHVAN NYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRI GSKTS S S S SNWVWQSTQDVFYNGAYFVS S GKYEGGNIYTKKEAFN (SEQ ID NO: 1).
  • the fragment of CRYJl comprises at least 10, at least 20, at least 30, at least 40, or at least 50 consecutive amino acids with at least a 90% sequence identity to SEQ ID NO: 1.
  • the variant of CRYJl has an amino acid sequence with at least a 70%, at least a 75%, at least an 80%, at least an 85%, at least a 90%, at least a 95%, at least a 98%, or at least a 99% sequence identity to SEQ ID NO:
  • the fragment of CRYJl is selected from the group consisting of pi 6-30, p81-95, pl06-120, pi 11-125, p211-225, and p301-315.
  • the one or more encapsulated antigenic epitopes from Japanese cedar pollen comprises CRYJ2 or a fragment or variant thereof.
  • CRYJ2 has an amino acid sequence of VENGNATPQLTKNAGVLTSSLSKRCRKVEHSRHDAINIFNVEKYGAVGDGKHDSTE AFSTAWQAASKXPSAMLLVPGNKKFVVNNLFFNGPSQPHFTFKVDGIIAAYQNPAS WI ⁇ NRIWLQFAKITGFTLMGKGVIDGQGKQWWAGQSKXVVNGREISNDRDRPTAIK FDFSTGLIIQGLI ⁇ MNSPEFHLVFGNSEGVKIIGISITAPRDSPNTDGIDIFASKNFHLQK NTIGTGDDSVAIGTGSSNIVIEDLISGPGHGISIGSLGRENSRAEVSYVHVNGAKFIDTQ NGLRIKTWQGGSGMASHIIYENVEMINSENPILINQFYSTSASASQ
  • the fragment of CRYJ2 comprises at least 10, at least 20, at least 30, at least 40, or at least 50 consecutive amino acids with at least a 90% sequence identity to SEQ ID NO: 2.
  • the variant of CRYJ2 has an amino acid sequence with at least a 70%, at least a 75%, at least an 80%, at least an 85%, at least a 90%, at least a 95%, at least a 98%, or at least a 99% sequence identity to SEQ ID NO:
  • the fragment of CRYJ2 is selected from the group consisting of p66-80, p81-95, pl41-155, pl86-200, p236-250, p346-360, p351-365, and p336-350.
  • biodegradable particles described herein comprise two or more encapsulated antigenic epitopes from Japanese cedar pollen proteins.
  • the two or more encapsulated epitopes are contained in a fusion protein, wherein the two or more encapsulated epitopes in the fusion protein are separated by a cleavable linker.
  • the amino acid sequence of the cleavable linker is cleavable by a protease located in the phagolysosome of a cell and/or a protease located in the cytosol of the cell.
  • the amino acid sequence of the cleavable linker is cleavable by a protease located in the phagolysosome of a cell and a protease located in the cytosol of the cell.
  • the cleavable linker a furin sensitive linker or cathepsin sensitive linker.
  • the cleavable linker is a furin sensitive linker.
  • the cleavable linker is a cathepsin sensitive linker.
  • the cathepsin sensitive linker is sensitive to cleavage by one or more of cathepsin A, cathepsin B, cathepsin C, cathepsin D, cathepsin E, cathepsin F, cathepsin G, cathepsin H, cathepsin K, cathepsin L, cathepsin O, cathepsin W, and/or cathepsin Z.
  • the amino acid sequence of the linker is Gly-Ala-Val-Val-Arg-Gly-Ala (SEQ ID NO: 3).
  • the one or more encapsulated antigenic epitopes from Japanese cedar pollen is covalently coupled to the biodegradable particle.
  • the one or more encapsulated antigenic epitopes from Japanese cedar pollen is covalently coupled to the biodegradable particle by a conjugate molecule.
  • the conjugate molecule comprises a carbodiimide compound.
  • the carbodiimide compound comprises l-Ethyl-3-(3- dimethylaminopropyl)carbodiimide (EDC).
  • compositions comprising a biodegradable particle described herein.
  • the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
  • the pharmaceutical composition further comprises pharmaceutically acceptable excipients.
  • Certain embodiments are directed to a lyophilized composition comprising a biodegradable particles described herein.
  • Certain embodiments are directed to a method of inducing antigen- specific tolerance to Japanese cedar pollen in a subject comprising administering to the subject an effective amount of a pharmaceutical composition described herein. Particular embodiments are directed to a method for the treatment of a Japanese cedar pollen allergy in a subject in need thereof comprising administering a pharmaceutical composition described herein. Some embodiments are directed to a method for the prevention of a Japanese cedar pollen allergy in a subject in need thereof comprising administering the pharmaceutical composition described herein.
  • Particular embodiments are directed to a method of inducing antigen- specific tolerance to Japanese cedar pollen in a subject comprising reconstituting the lyophilized particles described herein to obtain a reconstituted pharmaceutical composition and administering the reconstituted pharmaceutical composition to the subject. Certain embodiments are directed to a method for the treatment of a Japanese cedar pollen allergy in a subject in need thereof comprising reconstituting lyophilized particles described herein to obtain a reconstituted pharmaceutical composition and administering the reconstituted pharmaceutical composition to the subject.
  • Some embodiments are directed to a method for the prevention of a Japanese cedar pollen allergy in a subject in need thereof comprising reconstituting the lyophilized particles described herein to obtain a reconstituted pharmaceutical composition and administering the reconstituted pharmaceutical composition to the subject.
  • FIG. 1 shows a model of how administration of biodegradable particles with negative zeta potential encapsulating antigenic epitopes from Japanese cedar pollen provides an effective treatment of Japanese cedar pollen allergy.
  • FIG. 2 shows the viscosity of JCP extract (FIG. 2A), an exemplary illustration of a biodegradable particle with negative zeta potential that encapsulates antigenic epitopes of Japanese cedar pollen (TIMP-JCP) (FIG. 2B), and a schematic of the double- emulsion process (FIG. 2 C).
  • FIG. 3 shows SDS-PAGE analysis of JCP extract and recombinant JCP proteins.
  • FIG. 4 shows particle characteristics for TIMPs encapsulation JCP extract.
  • FIG. 5 shows a schematic of the acute inflammatory mouse model
  • FIG. 5 A antibody responses on Day 21 after sensitization
  • FIG. 5B-5D antibody responses on Day 21 after sensitization
  • FIG. 6 shows body temperature changes after JCP sensitization, TIMP treatment, and JCP challenge.
  • FIG. 7 shows scratching, sneezing, and coughing scores after JCP sensitization, TIMP treatment, and JCP challenge.
  • FIG. 8 shows cytokine production from splenocytes from JCP sensitized and challenged mice treated with TIMP-JCP or TIMP-OVA.
  • FIG. 9 shows antibody responses on Day 30 after sensitization with
  • FIG. 10 shows serum levels of histamine (FIG. 10A) and MCPT-1
  • FIG. 1 1 illustrates the effect of administration route on the resultant immune response.
  • nanoparticles that embed an antigen can induce tolerance to autoimmune disease and decrease the immune response. These particles, therefore, may be useful in the treatment of any disease or condition characterized by an excessive inflammatory immune response, such as allergy to Japanese cedar pollen.
  • Particle refers to any non-tissue derived composition of matter, it may be a sphere or sphere-like entity, bead, or liposome.
  • the term “particle”, the term “immune modifying particle”, the term “carrier particle”, and the term “bead” may be used interchangeably depending on the context. Additionally, the term “particle” may be used to encompass beads and spheres.
  • Negatively charged particle refers to particles which have been modified to possess a net surface charge that is less than zero.
  • Carboxylated particles or “carboxylated beads” or “carboxylated spheres” includes any particle that has been modified to contain a carboxyl group on its surface.
  • the addition of the carboxyl group enhances phagocyte/monocyte uptake of the particles from circulation, for instance through the interaction with scavenger receptors such as MARCO.
  • Carboxylation of the particles can be achieved using any compound which adds or incorporates carboxyl groups, including, but not limited to, poly(ethylene-alt-maleic anhydride) (PEMA).
  • PEMA poly(ethylene-alt-maleic anhydride)
  • Antigenic moiety refers to any moiety, for example a peptide that is recognized by the host's immune system.
  • antigenic moieties include, but are not limited to, autoantigens, enzymes, and/or bacterial or viral proteins, peptides, drugs or components.
  • carboxylated beads themselves may be recognized by the immune system, the carboxylated beads with nothing more attached thereto are not considered an "antigenic moiety" for the purposes of the invention.
  • naked beads or “naked particles” or “naked spheres” as used herein refers to beads, particles or spheres that have not been carboxylated.
  • Pro-inflammatory mediators or "pro-inflammatory polypeptides” as used herein refers to polypeptides or fragments thereof which induce, maintain, or prolong inflammation in a subject.
  • pro-inflammatory mediators include, but are not limited to, cytokines and chemokines.
  • Inflammatory monocyte refers to any myeloid cell expressing any combination of CD14/CD26 and CCR2.
  • inhibitory neutrophil refers to neutrophils, and/or monocyte derived suppressor cells.
  • Th cell or "helper T cell” refers to CD4 + cells.
  • CD4 + T cells assist other white blood cells with immunologic processes, including maturation of B cells into plasma cells and memory B cells, and activation of cytotoxic T cells and macrophages. T cells become activated when they are presented with peptide antigens by MHC class II molecules, which are expressed on the surface of antigen- presenting cells (APCs).
  • APCs antigen- presenting cells
  • Thl cell refers to a subset of Th cells which produce pro-inflammatory mediators. Thl cells secrete cytokines to facilitate immune response and play a role in host defense against pathogens in part by mediating the recruitment of neutrophils and macrophages to infected tissues. Thl cells secrete cytokines including IFN- ⁇ , IL-2, IL-10, and TNF ⁇ / ⁇ to coordinate defense against intracellular pathogens such as viruses and some bacteria.
  • Th2 cell refers to a subset of Th cells that mediate the activation and maintenance of the antibody-mediated immune response against extracellular parasites, bacteria, allergens, and toxins. Th2 cells mediate these functions by producing various cytokines such as IL-4, IL-5, IL-6, IL-9, IL-13, and IL-17E (IL-25) that are responsible for antibody production, eosinophil activation, and inhibition of several macrophage functions, thus providing phagocyte-independent protective responses.
  • cytokines such as IL-4, IL-5, IL-6, IL-9, IL-13, and IL-17E (IL-25) that are responsible for antibody production, eosinophil activation, and inhibition of several macrophage functions, thus providing phagocyte-independent protective responses.
  • Thl7 cell refers to a subset of Th cells.
  • Thl 7 cells secrete cytokines to facilitate immune response and play a role in host defense against pathogens by mediating the recruitment of neutrophils and macrophages to infected tissues.
  • TH17 cells secrete cytokines such as IL-17, IL-21, IL-22, IL-24, IL-26 and TNFa to coordinate defense against extracellular pathogens including fungi and bacteria.
  • Coupled refers to an antigen fixed to the outside of a particle or encapsulated within a particle.
  • an antigen coupled to a particle includes both surface coupling as well as encapsulation within the particle.
  • IMP immune-modifying particles which are not coupled to an antigen.
  • TIMP refers to tolerizing immune modifying particles which are coupled to an antigen.
  • the antigen is attached to the surface of the TIMP. In other embodiments, the antigen is encapsulated within the TIMP.
  • the particle may have any particle shape or conformation. However, in some embodiments it is preferred to use particles that are less likely to clump in vivo. Examples of particles within these embodiments are those that have a spherical shape.
  • compositions which comprises an immune modified particle having a negative zeta potential and free from antigenic moieties.
  • the invention provides compositions comprising an immune modified particle with a negative zeta potential coupled to an antigen.
  • the antigen is coupled to the outside of the particle.
  • the antigen is encapsulated within the particle.
  • Yet another aspect of the invention relates to a process for the preparation an immune modified particle with a negative zeta potential and free from antigenic moieties.
  • the process involves contacting an immune modified particle precursor with a buffer solution under conditions effective to form the immune modified particle with a negative zeta potential.
  • the immune modified particle precursor is formed via co-polymerization.
  • the particle microstructure may depend on the method of co-polymerization.
  • an antigenic peptide molecule is coupled to the carrier particle (e.g. immune modified particle) by a conjugate molecule and/or linker group.
  • coupling of the antigenic peptide and/or apoptotic signaling molecule to the carrier comprises one or more covalent and/or non-covalent interactions.
  • the antigenic peptide is attached to the surface of the carrier particle with a negative zeta potential.
  • the antigenic peptide is encapsulated within the carrier particle with a negative zeta potential.
  • the buffer solution contacting the immune modified particle may have a basic pH.
  • Suitable basic pH for the basic solution include 7.1, 7.5, 8.0, 8.5, 9.5, 10.0 10.5, 11.0, 11.5, 12.0, 12.5, 13.0, and 13.5.
  • the buffer solution may also be made of any suitable base and its conjugate.
  • the buffer solution may include, without limitation, sodium bicarbonate, potassium bicarbonate, lithium bicarbonate, potassium dihydrogen phosphate, sodium dihydrogen phosphate, or lithium dihydrogen phosphate and conjugates thereof.
  • the immune modified particles contain co-polymers. These co-polymers may have varying molar ratio.
  • Suitable co-polymer ratio of present immune modified particles may be 25:75, 30:70, 35:65, 40:60, 45:55, 50:50, 55:45, 60:40, 65:35, 70:30, 75:25, 80:20, 81 : 19, 82: 18, 83: 17, 84: 16, 85: 15, 86: 14, 87: 13, 88: 12, 89: 11, 90: 10, 91 ;:9, 92:8, 93:7, 94:6, 95:5, 96:4, 97:3, 98:2, 99: 1, or 100:0.
  • the co-polymer may be periodical, statistical, linear, branched (including star, brush, or comb co-polymers) co-polymers.
  • the co-polymers ratio may be, but not limited to, polystyrene:poly(vinyl carboxylate)/80:20, polystyrene: poly(vinyl carboxylate)/90: 10, poly(vinyl carboxylate):polystyrene/80:20, poly(vinyl carboxylate):polystyrene/90: 10, polylactic acid: polygly colic acid/50:50, polylactic acid: poly gly colic acid/80:20, or polylactic acid: polygly colic acid/90: 10.
  • the particles of the invention are made by adding a composition comprising the polymer (e.g. PLGA) to a solution of poly(ethylene-maleic anhydride) (PEMA).
  • concentration of PEMA in the solution can be between about 0.1% and about 10%. In one embodiment, the concentration of PEMA in the solution is between about 0.2% and about 5%. In another embodiment, the concentration of PEMA in the solution is between about 0.1% and 4%. In another embodiment, the concentration of PEMA in the solution is between about 0.1% and 2%. In another embodiment, the concentration of PEMA in the solution is between about 0.5% and 1%.
  • the percentage of PEMA in solution is 0.1%, 0.2%, 0.3%, 0.4%, 0.5%, 0.6% 0.7%, 0.8%, 0.9%, 1%, 1.5%, 2%, 2.5%, 3%, 3.5%, 4%, 4.5%, 5%, 6%, 6.5%, 7%, 7.5%, 8%, 8.5%, 9%, 9.5% or 10%. In one embodiment, the percentage of PEMA in the solution is about 0.5%. In another embodiment, the percentage of PEMA in the solution is about 1.0%.
  • Other compounds that may be used include, but are not limited to, poly(ethylene-a//-maleic anhydride), poly(isobutylene-co- maleic acid), poly(methyl vinyl ether-a//-maleic acid), poly(methyl vinyl ether-a//-maleic acid monoethyl ester), poly(methyl vinyl ether-a//-maleic anhydride), poly(methyl vinyl ether-a//-maleic anhydride) cross-linked with 1,9-decadiene powder, poly(styrene-a//-maleic acid) sodium salt, poly (vinyl alcohol), poly (acrylic acid), and/or sodium deoxycholate.
  • the particle is a liposome.
  • the particle is a liposome composed of the following lipids at the following molar ratios - 30:30:40 phosphatidylcholine:phosphatidylglycerol:cholesterol.
  • the particle is encapsulated within a liposome.
  • each particle it is not necessary that each particle be uniform in size, although the particles must generally be of a size sufficient to be sequestered in the spleen or liver and trigger phagocytosis or uptake through receptor or non-receptor mediated mechanism by an antigen presenting cell, including endothelial cell or other MPS cell.
  • the particles are microscopic or nanoscopic in size, in order to enhance solubility, avoid possible complications caused by aggregation in vivo and to facilitate pinocytosis.
  • Particle size can be a factor for uptake from the interstitial space into areas of lymphocyte maturation.
  • a particle having a diameter of from about 0.1 ⁇ to about 10 ⁇ is capable of triggering phagocytosis.
  • the particle has a diameter within these limits.
  • the particle has an average diameter of about 0.3 ⁇ to about 5 ⁇ .
  • the particle has an average diameter of about 0.5 ⁇ to about 3 ⁇ .
  • the particle has an average diameter of about 0.2 ⁇ to about 2 ⁇ .
  • the particle has an average size of about 0.1 ⁇ , or about 0.2 ⁇ or about 0.3 ⁇ or about 0.4 ⁇ or about 0.5 ⁇ or about 1.0 ⁇ or about 1.5 ⁇ or about 2.0 ⁇ or about 2.5 ⁇ or about 3.0 ⁇ or about 3.5 ⁇ or about 4.0 ⁇ or about 4.5 ⁇ or about 5.0 ⁇ .
  • the particle has an average size of about 0.5 ⁇ . In some embodiments, the particle has an average diameter between about 0.5 ⁇ and about 0.95 ⁇ . For example, in such embodiments, the particle has an average diameter of about 0.5 ⁇ , 0.55 ⁇ , 0.6 ⁇ , 0.65 ⁇ , 0.7 ⁇ , 0.75 ⁇ , 0.8 ⁇ , 0.85 ⁇ , 0.9 ⁇ , or about 0.95 ⁇ . In particular embodiments, the particle has an average diameter of about 0.7 ⁇ . In some embodiments, the overall weight of the particles is at least about 1000 kDa.
  • the overall weight of the particles is about 1000 kDa, 1100 kDa, 1200 kDa, 1300 kDa, 1400 kDa, 1500 kDa, 1600 kDa, 1700 kDa, 1800 kDa, 1900 kDa, 2000 kDa , 2500 kDa, 3000 kDa , 3500 kDa , 4000 kDa, 4500 kDa, 5000 kDa, or more.
  • the overall weights of the particles are less than about 10,000 kDa, less than about 5,000 kDa, or less than about 1,000 kDa, 500 kDa, 400 kDa, 300 kDa, 200 kDa, 100 kDa, 50 kDa, 20 kDa, 10 kDa.
  • the particles in a composition need not be of uniform diameter.
  • a pharmaceutical formulation may contain a plurality of particles, some of which have a diameter of about 0.5 ⁇ , while others have a diameter of about 1.0 ⁇ .
  • a pharmaceutical formulation may contain a plurality of particles, some of which have a diameter of about 0.7 ⁇ , while others have a diameter of about 0.5 ⁇ to about 0.95 ⁇ . Any mixture of particle sizes within these given ranges will be useful.
  • the particles of the current invention can possess a particular zeta potential.
  • the zeta potential is negative.
  • the zeta potential is less than (e.g. , more negative than) about -100 mV.
  • the zeta potential is less than (e.g., more negative than) about -50 mV.
  • the particles possess a zeta potential between -100 mV and 0 mV.
  • the particles possess a zeta potential between -75 mV and 0 mV.
  • the particles possess a zeta potential between -60 mV and 0 mV.
  • the particles possess a zeta potential between -50 mV and 0 mV. In still a further embodiment, the particles possess a zeta potential between -40 mV and 0 mV. In a further embodiment, the particles possess a zeta potential between -30 mV and 0 mV. In a further embodiment, the particles possess a zeta potential between -20 mV and +0 mV. In a further embodiment, the particles possess a zeta potential between -10 mV and -0 mV. In a further embodiment, the particles possess a zeta potential between -lOOmV and -50mV.
  • the particles possess a zeta potential between -75 mV and -50mV. In a particular embodiment, the particles possess a zeta potential between -50 mV and -40mV. In another particular embodiment, the particles possess a zeta potential of less than (e.g. , more negative than) about -40mV. In another particular embodiment, the particles possess a zeta potential of at least about -30mV. In another particular embodiment, the particles possess a zeta potential of less than (e.g., more negative than) about -30mV.
  • the particles of the present invention can possess a ratio of antigen to polymer (e.g. , ⁇ g of antigen/mg of polymer).
  • the ratio of antigen to polymer is between about 1 ⁇ g/mg to at least about 5 ⁇ g/mg.
  • the ratio of antigen to polymer is about 1 ⁇ g/mg, 1.5 ⁇ g/mg, 2 ⁇ g/mg, 2.5 ⁇ g/l mg, 3.0 ⁇ g/mg, 3.5 ⁇ g/mg, 4 ⁇ g/mg, 4.5 ⁇ g/mg, or about 5 ⁇ g/mg.
  • the ratio of antigen to polymer is at least about 5 ⁇ g/mg.
  • the ratio of antigen to polymer is at least about 5 ⁇ g/mg, 5.5 ⁇ g/mg, 6 ⁇ g/mg, 6.5 ⁇ g/mg, 7 ⁇ g/mg, 7.5 ⁇ g/mg, 8 ⁇ g/mg, 8.5 ⁇ g/mg, 9.0 ⁇ g/mg, 9.5 ⁇ g/mg, 10 ⁇ g/mg, 10.5 ⁇ g/mg, 11 ⁇ g/mg, 11.5 ⁇ g/mg, 12 ⁇ g/mg, 12.5 ⁇ g/mg, 13 ⁇ g/mg, 13.5 ⁇ g/mg, 14 ⁇ g/mg, 14.5 ⁇ g/mg, or about 15 ⁇ g/mg.
  • the charge of a carrier is selected to impart application-specific benefits (e.g., physiological compatibility, beneficial surface-peptide interactions, etc.).
  • a carrier has a net neutral or negative charge (e.g. , to reduce non-specific binding to cell surfaces which, in general, bear a net negative charge).
  • carriers are capable of being conjugated, either directly or indirectly, to an antigen to which tolerance is desired (also referred to herein as an antigen-specific peptide, antigenic peptide, autoantigen, inducing antigen or tolerizing antigen).
  • a carrier has multiple binding sites (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10...
  • a carrier displays a single type of antigenic peptide. In some embodiments, a carrier displays multiple different antigenic peptides on the surface. In some embodiments, a carrier surface displays functional groups for the covalent attachment of selected moieties (e.g. , antigenic peptides). In some embodiments, carrier surface functional groups provide sites for non-covalent interaction with selected moieties (e.g., antigenic peptides). In some embodiments, a carrier has a surface to which conjugating moieties may be adsorbed without chemical bond formation.
  • particles of the current invention are effective at inducing tolerance when they are between about 100 nanometers and about 1500 nanometers and have a charge of 0 to about -70 mV and are most effective at inducing tolerance when they are 400-800 nanometers and have a charge of between about -25mV and -70mV.
  • the average particle size and charge of the particles can be slightly altered in the lyophilization process.
  • post-synthesis size and “post synthesis charge” refer to the size and charge of the particle prior to lyophilization.
  • post lyophilization size and post lyophilization charge refer to the size and charge of the particle after lyophilization.
  • the particle is non-metallic.
  • the particle may be formed from a polymer.
  • the particle is biodegradable in an individual.
  • the particles can be provided in an individual across multiple doses without there being an accumulation of particles in the individual.
  • suitable particles include polystyrene particles, PLGA particles, PLURIONICS stabilized polypropylene sulfide particles, and diamond particles.
  • the particle surface is composed of a material that minimizes non-specific or unwanted biological interactions. Interactions between the particle surface and the interstitium may be a factor that plays a role in lymphatic uptake.
  • the particle surface may be coated with a material to prevent or decrease non-specific interactions.
  • Steric stabilization by coating particles with hydrophilic layers such as poly(ethylene glycol) (PEG) and its copolymers such as PLURONICS® (including copolymers of poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol)) may reduce the non-specific interactions with proteins of the interstitium as demonstrated by improved lymphatic uptake following subcutaneous injections. All of these facts point to the significance of the physical properties of the particles in terms of lymphatic uptake.
  • Biodegradable polymers may be used to make all or some of the polymers and/or particles and/or layers. Biodegradable polymers may undergo degradation, for example, by a result of functional groups reacting with the water in the solution.
  • degradation refers to becoming soluble, either by reduction of molecular weight or by conversion of hydrophobic groups to hydrophilic groups.
  • Polymers with ester groups are generally subject to spontaneous hydrolysis, e.g., polylactides and polyglycolides.
  • Particles of the present invention may also contain additional components.
  • carriers may have imaging agents incorporated or conjugated to the carrier.
  • An example of a carrier nanosphere having an imaging agent that is currently commercially available is the Kodak X-sight nanospheres.
  • Inorganic quantum-confined luminescent nanocrystals, known as quantum dots (QDs) have emerged as ideal donors in FRET applications: their high quantum yield and tunable size-dependent Stokes Shifts permit different sizes to emit from blue to infrared when excited at a single ultraviolet wavelength.
  • QDs quantum dots
  • Quantum dots such as hybrid organic/inorganic quantum dots based on a class of polymers known as dendrimers, may be used in biological labelling, imaging, and optical biosensing systems.
  • Quantum dots such as hybrid organic/inorganic quantum dots based on a class of polymers known as dendrimers.
  • dendrimers may be used in biological labelling, imaging, and optical biosensing systems.
  • the synthesis of these hybrid quantum dot nanoparticles does not require high temperatures or highly toxic, unstable reagents. (Etienne, et al, Appl. Phys. Lett. 87, 181913, 2005).
  • Particles can be formed from a wide range of materials.
  • the particle is preferably composed of a material suitable for biological use.
  • particles may be composed of glass, silica, polyesters of hydroxy carboxylic acids, polyanhydrides of dicarboxylic acids, or copolymers of hydroxy carboxylic acids and dicarboxylic acids.
  • the carrier particles may be composed of polyesters of straight chain or branched, substituted or unsubstituted, saturated or unsaturated, linear or cross-linked, alkanyl, haloalkyl, thioalkyl, aminoalkyl, aryl, aralkyl, alkenyl, aralkenyl, heteroaryl, or alkoxy hydroxy acids, or polyanhydrides of straight chain or branched, substituted or unsubstituted, saturated or unsaturated, linear or cross-linked, alkanyl, haloalkyl, thioalkyl, aminoalkyl, aryl, aralkyl, alkenyl, aralkenyl, heteroaryl, or alkoxy dicarboxylic acids.
  • carrier particles can be quantum dots, or composed of quantum dots, such as quantum dot polystyrene particles (Joumaa et al. (2006); Langmuir 22: 1810-6).
  • Carrier particles including mixtures of ester and anhydride bonds e.g. , copolymers of gly colic and sebacic acid may also be employed.
  • carrier particles may comprise materials including polyglycolic acid polymers (PGA), polylactic acid polymers (PLA), polysebacic acid polymers (PSA), poly(lactic-co-glycolic) acid copolymers (PLGA or PLG; the terms are interchangeable), [rho]oly(lactic-co-sebacic) acid copolymers (PLSA), poly (gly colic-co- sebacic) acid copolymers (PGSA), polypropylene sulfide polymers, poly(caprolactone), chitosan, etc.
  • PGA polyglycolic acid polymers
  • PLA polylactic acid polymers
  • PSA polysebacic acid polymers
  • PLA or PLG poly(lactic-co-glycolic) acid copolymers
  • [rho]oly(lactic-co-sebacic) acid copolymers (PLSA) poly (gly colic-co- sebacic) acid copolymers (PGSA), polypropylene sulf
  • biocompatible, biodegradable polymers useful in the present invention include polymers or copolymers of caprolactones, carbonates, amides, amino acids, orthoesters, acetals, cyanoacrylates and degradable urethanes, as well as copolymers of these with straight chain or branched, substituted or unsubstituted, alkanyl, haloalkyl, thioalkyl, aminoalkyl, alkenyl, or aromatic hydroxy- or di-carboxylic acids.
  • the biologically important amino acids with reactive side chain groups such as lysine, arginine, aspartic acid, glutamic acid, serine, threonine, tyrosine and cysteine, or their enantiomers, may be included in copolymers with any of the aforementioned materials to provide reactive groups for conjugating to antigen peptides and proteins or conjugating moieties.
  • Biodegradable materials suitable for the present invention include diamond, PLA, PGA, polypropylene sulfide, and PLGA polymers. Biocompatible but non-biodegradable materials may also be used in the carrier particles of the invention.
  • non-biodegradable polymers of acrylates, ethylene-vinyl acetates, acyl substituted cellulose acetates, non-degradable urethanes, styrenes, vinyl chlorides, vinyl fluorides, vinyl imidazoles, chlorosulphonated olefins, ethylene oxide, vinyl alcohols, TEFLON ® (DuPont, Wilmington, Del), and nylons may be employed.
  • the particles of the instant invention can be manufactured by any means commonly known in the art.
  • Exemplary methods of manufacturing particles include, but are not limited to, microemulsion polymerization, interfacial polymerization, precipitation polymerization, emulsion evaporation, emulsion diffusion, solvent displacement, and salting out (Astete and Sabliov, J. Biomater. Sci. Polymer Edn., 17:247-289(2006)).
  • Manipulation of the manufacturing process for PLGA particles can control particle properties (e.g. size, size distribution, zeta potential, morphology, hydrophobicity/hydrophilicity, polypeptide entrapment, etc.).
  • the size of the particle is influenced by a number of factors including, but not limited to, the concentration of PLGA, the solvent used in the manufacture of the particle, the nature of the organic phase, the surfactants used in manufacturing, the viscosity of the continuous and discontinuous phase, the nature of the solvent used, the temperature of the water used, sonication, evaporation rate, additives, shear stress, sterilization, and the nature of any encapsulated antigen or polypeptide.
  • Particle size is affected by the polymer concentration; higher particles are formed from higher polymer concentrations.
  • an increase in PLGA concentration from 1% to 4% (w/v) can increase mean particle size from about 205 nm to about 290 nm when the solvent propylene carbonate is used.
  • an increase in PLGA concentration from 1% to 5% (w/v) increases the mean particle size from 120 nm to 230 nm.
  • the viscosity of the continuous and discontinuous phase is also an important parameter that affects the diffusion process, a key step in forming smaller particles.
  • the size of the particles increases with an increase in viscosity of the dispersed phase, whereas the size of the particles decreases with a more viscous continuous phase.
  • the lower the phase ratio of organic to aqueous solvent the smaller the particle size.
  • Homogenizer speed and agitation also affect particle size; in general, higher speeds and agitation cause a decrease in particle size, although there is a point where further increases in speed and agitation no longer decrease particle size.
  • An important size reduction of the particles can be achieved by varying the temperature of the water added to improve the diffusion of the solvent.
  • the mean particle size decreases with an increase in water temperature.
  • the nature of the polypeptide encapsulated in the particle also affects particle size.
  • encapsulation of hydrophobic polypeptides leads to the formation of smaller particles compared with the encapsulation of more hydrophilic polypeptides.
  • the entrapment of more hydrophilic polypeptides is improved by using high molecular mass PLGA and a high molecular mass of the first surfactant which causes a higher inner phase viscosity.
  • the interaction between the solvent, polymer, and polypeptide affects the efficiency of incorporating the polypeptide into the particle.
  • the PLGA molecular mass impacts the final mean particle size.
  • the higher the molecular mass the higher the mean particle size.
  • the mean particle size varies (about 102 nm -154 nm; about 132 nm to 152 nm respectively).
  • the solvent used can also affect particle size; solvents that reduce the surface tension of the solution also reduce particle size.
  • the organic solvent is removed by evaporation in a vacuum to avoid polymer and polypeptide damage and to promote final particle size reduction. Evaporation of the organic solvent under vacuum is more efficient in forming smaller particles. For example, evaporation in vacuum produces a mean particle size around 30% smaller than the mean particle size produced under a normal rate of evaporation.
  • the amplitude of the sonication wavelength also affects the particle characteristics.
  • the amplitude of the wavelength should be over 20% with 600 to 800 s of sonication to form sable miniemulsions with no more droplet size changes.
  • the main draw-back of sonication is the lack of monodispersity of the emulsion formed.
  • Organic phases that may be used in the production of the particles of the invention include, but are not limited to, ethyl acetate, methyl ethyl ketone, propylene carbonate, and benzyl alcohol.
  • the continuous phases that may be used include but are not limited to the surfactant poloxamer 188.
  • a variety of surfactants can be used in the manufacturing of the particles of the invention.
  • the surfactant can be anionic, cationic, or nonionic.
  • Surfactants in the poloxamer and poloaxamines family are commonly used in particle synthesis.
  • Surfactants that may be used include, but are not limited to PEG, Tween-80, gelatin, dextran, pluronic L- 63, PVA, methylcellulose, lecithin and DMAB.
  • biodegradable and biocompatible surfactants including, but not limited to, vitamin E TPGS (D-a-tocopheryl polyethylene glycol 1000 succinate).
  • two surfactants are needed (e.g. in the double emulsion evaporation method).
  • Solvents that may be used in the production of the particles of the invention include, but are not limited to, acetone, Tetrahydrofuran (THF), chloroform, and members of the chlorinate family, methyl chloride.
  • THF Tetrahydrofuran
  • the choice of organic solvents require two selection criteria: the polymer must be soluble in this solvent, and the solvent must be completely immiscible with the aqueous phase.
  • Salts that may be used in the production of the particles of the invention include, but are not limited to magnesium chloride hexahydrate, magnesium acetate tetrahydrate.
  • Common salting-out agents include, but are not limited to, electrolytes
  • non-electrolytes e.g. sucrose
  • the stability and size of the particles of the invention may be improved by the addition of compounds including, but not limited to, fatty acids or short chains of carbons.
  • the addition of the longer carbon chain of lauric acid is associated with the improvement of particle characteristics.
  • the addition of hydrophobic additives can improve the particle size, incorporation of the polypeptide into the particle, and release profile. Preparations of particles can be stabilized by lyophilization.
  • the addition of a cryoprotectant such as trehalose can decrease aggregation of the particles upon lyophilization.
  • Suitable beads which are currently available commercially include polystyrene beads such as FluoSpheres (Molecular Probes, Eugene, Oreg.).
  • the present invention provides systems comprising: (a) a delivery scaffold configured for the delivery of chemical and/or biological agents to a subject; and (b) antigen-coupled poly(lactide-co-glycolide) particles for induction of antigen-specific tolerance.
  • at least a portion of said delivery scaffold is microporous.
  • the antigen-coupled poly(lactide-co- glycolide) particles are encapsulated within said scaffold.
  • the chemical and/or biological agents are selected from the group consisting of: protein, peptide, small molecules, nucleic acids, cells, and particles.
  • chemical and/or biological agents comprise cell, and said cells comprise pancreatic islet cells.
  • Physical properties are also related to a nanoparticle's usefulness after uptake and retention in areas having immature lymphocytes. These include mechanical properties such as rigidity or rubberiness.
  • Some embodiments are based on a rubbery core, e.g. , a poly(propylene sulfide) (PPS) core with an overlay er, e.g. , a hydrophilic overlay er, as in PEG, as in the PPS-PEG system recently developed and characterized for systemic (but not targeted or immune) delivery.
  • PPS poly(propylene sulfide)
  • an overlay er e.g. , a hydrophilic overlay er, as in PEG, as in the PPS-PEG system recently developed and characterized for systemic (but not targeted or immune) delivery.
  • the rubbery core is in contrast to a substantially rigid core as in a polystyrene or metal nanoparticle system.
  • rubbery refers to certain resilient materials besides natural or synthetic rubbers, with rubbery being a term familiar to those in the polymer arts.
  • cross-linked PPS can be used to form a hydrophobic rubbery core.
  • PPS is a polymer that degrades under oxidative conditions to polysulphoxide and finally polysulphone, transitioning from a hydrophobic rubber to a hydrophilic, water-soluble polymer.
  • Other sulphide polymers may be adapted for use, with the term sulphide polymer referring to a polymer with a sulphur in the backbone of the mer.
  • Other rubbery polymers that may be used are polyesters with glass transition temperature under hydrated conditions that is less than about 37° C.
  • a hydrophobic core can be advantageously used with a hydrophilic overlayer since the core and overlayer will tend not to mingle, so that the overlayer tends to sterically expand away from the core.
  • a core refers to a particle that has a layer on it.
  • a layer refers to a material covering at least a portion of the core.
  • a layer may be adsorbed or covalently bound.
  • a particle or core may be solid or hollow. Rubbery hydrophobic cores are advantageous over rigid hydrophobic cores, such as crystalline or glassy (as in the case of polystyrene) cores, in that higher loadings of hydrophobic drugs can be carried by the particles with the rubbery hydrophobic cores.
  • a hydrophilic material may have a solubility in water of at least 1 gram per liter when it is uncrosslinked. Steric stabilization of particles with hydrophilic polymers can improve uptake from the interstitium by reducing non-specific interactions; however, the particles' increased stealth nature can also reduce internalization by phagocytic cells in areas having immature lymphocytes. The challenge of balancing these competing features has been met, however, and this application documents the creation of nanoparticles for effective lymphatic delivery to DCs and other APCs in lymph nodes.
  • Some embodiments include a hydrophilic component, e.g., a layer of hydrophilic material.
  • hydrophilic materials are one or more of polyalkylene oxides, polyethylene oxides, polysaccharides, polyacrylic acids, and polyethers.
  • the molecular weight of polymers in a layer can be adjusted to provide a useful degree of steric hindrance in vivo, e.g. , from about 1,000 to about 100,000 or even more; artisans will immediately appreciate that all the ranges and values within the explicitly stated ranges are contemplated, e.g. , between 10,000 and 50,000.
  • the nanoparticles may incorporate functional groups for further reaction.
  • Functional groups for further reaction include electrophiles or nucleophiles; these are convenient for reacting with other molecules.
  • nucleophiles are primary amines, thiols, and hydroxyls.
  • electrophiles are succinimidyl esters, aldehydes, isocyanates, and maleimides.
  • a great variety of means may be used to conjugate antigenic peptides and proteins to carriers. These methods include any standard chemistries which do not destroy or severely limit the biological activity of the antigen peptides and proteins, and which allow for a sufficient number of antigen peptides and proteins to be conjugated to the carrier in an orientation which allows for interaction of the antigen peptide or protein with a cognate T cell receptor. Generally, methods are preferred which conjugate the C-terminal regions of an antigen peptide or protein, or the C-terminal regions of an antigen peptide or protein fusion protein, to the earner. The exact chemistries will, of course, depend upon the nature of the earner material, the presence or absence of C- terminal fusions to the antigen peptide or protein, and/or the presence or absence of conjugating moieties.
  • Functional groups can be located on the particle as needed for availability.
  • One location can be as side groups or termini on the core polymer or polymers that are layers on a core or polymers otherwise tethered to the particle.
  • examples are included herein that describe PEG stabilizing the nanoparticles that can be readily functionalized for specific cell targeting or protein and peptide drug delivery.
  • ECDI ethylene carbodiimide
  • hexamethylene diisocyanate propyleneglycol di-glycidylether which contain 2 epoxy residues
  • epichlorohydrin may be used for fixation of peptides or proteins to the carrier surface.
  • ECDI is suspected of carrying out two major functions for induction of tolerance: (a) it chemically couples the protein/peptides to the cell surface via catalysis of peptide bond formation between free amino and free carboxyl groups; and (b) it induces the carrier to mimic apoptotic cell death such that they are picked up by host antigen presenting cells (which may include endothelial cells) in the spleen and induce tolerance. It is this presentation to host T-cells in a non-immunogenic fashion that leads to direct induction of anergy in autoreactive cells.
  • ECDI serves as a potent stimulus for the induction of specific regulatory T cells.
  • the antigen peptides and proteins are bound to the carrier via a covalent chemical bond.
  • a reactive group or moiety near the C-terminus of the antigen e.g., the C-terminal carboxyl group, or a hydroxyl, thiol, or amine group from an amino acid side chain
  • a reactive group or moiety on the surface of the carrier e.g. , a hydroxyl or carboxyl group of a PL A or PGA polymer, a terminal amine or carboxyl group of a dendrimer, or a hydroxyl, carboxyl or phosphate group of a phospholipid
  • Reactive carboxyl groups on the surface of a carrier may be joined to free amines (e.g., from Lys residues) on the antigen peptide or protein, by reacting them with, for example, 1 -ethyl-3-[3,9-dimethyl aminopropyl] carbodiimide hydrochloride (EDC) or N- hydroxysuccinimide ester (NHS).
  • EDC 1 -ethyl-3-[3,9-dimethyl aminopropyl] carbodiimide hydrochloride
  • NHS N- hydroxysuccinimide ester
  • the same chemistry may be used to conjugate free amines on the surface of a carrier with free carboxyls (e.g. , from the C-terminus, or from Asp or Glu residues) on the antigen peptide or protein.
  • free amine groups on the surface of a carrier may be covalently bound to antigen peptides and proteins, or antigen peptide or protein fusion proteins, using sulfo-SIAB chemistry, essentially as described by Arano et al. (1991) Chem. 2:71-6.
  • a non-covalent bond between a ligand bound to the antigen peptide or protein and an anti-ligand attached to the carrier may conjugate the antigen to the carrier.
  • a biotin ligase recognition sequence tag may be joined to the C-terminus of an antigen peptide or protein, and this tag may be biotinylated by biotin ligase. The biotin may then serve as a ligand to non-covalently conjugate the antigen peptide or protein to avidin or streptavidin which is adsorbed or otherwise bound to the surface of the carrier as an anti-ligand.
  • the Fc domain may act as a ligand
  • protein A either covalently or non-covalently bound to the surface of the carrier, may serve as the anti-ligand to non-covalently conjugate the antigen peptide or protein to the carrier.
  • Other means are well known in the art which may be employed to non- covalently conjugate antigen peptides and proteins to carriers, including metal ion chelation techniques (e.g. , using a poly -His tag at the C-terminus of the antigen peptide or protein or antigen peptide or protein fusion proteins, and a Ni + -coated carrier), and these methods may be substituted for those described here.
  • Conjugation of a nucleic acid moiety to a platform molecule can be effected in any number of ways, typically involving one or more crosslinking agents and functional groups on the nucleic acid moiety and platform molecule.
  • Linking groups are added to platforms using standard synthetic chemistry techniques. Linking groups can be added to nucleic acid moieties using standard synthetic techniques.
  • the practitioner has a number of choices for antigens used in the combinations of this invention. The inducing antigen present in the combination contributes to the specificity of the tolerogenic response that is induced. It may or may not be the same as the target antigen, which is the antigen present or to be placed in the subject being treated which is a target for the unwanted immunological response, and for which tolerance is desired.
  • An inducing antigen of this invention may be a polypeptide, polynucleotide, carbohydrate, glycolipid, or other molecule isolated from a biological source, or it may be a chemically synthesized small molecule, polymer, or derivative of a biological material, providing it has the ability to induce tolerance according to this description when combined with the mucosal binding component.
  • the present invention provides a carrier (e.g. , immune modifying particle) coupled to one or more peptides, polypeptides, and/or proteins.
  • a carrier e.g. , PLG carrier
  • a carrier e.g. , PLG carrier
  • the compositions and methods of the present invention can cause T cells to undertake early events associated with T-cell activation, but do not allow T-cells to acquire effector function.
  • compositions of the present invention can result in T-cells having a quasi-activated phenotype, such as CD69 and/or CD44 upregulation, but do not display effector function, such as indicated by a lack of IFN- ⁇ or IL-17 synthesis.
  • administration of compositions of the present invention results in T-cells having a quasi-activated phenotype without having conversion of naive antigen-specific T-cells to a regulatory phenotype, such as those having CD25 +/ Foxp3 + phenotypes.
  • the surface of a carrier (e.g., particle) comprises chemical moieties and/or functional groups that allow attachment (e.g. , covalently, non- covalently) of antigenic peptides and/or other functional elements to the carrier.
  • the number, orientation, spacing, etc. of chemical moieties and/or functional groups on the carrier vary according to carrier chemistry, desired application, etc.
  • a carrier comprises one or more biological or chemical agents adhered to, adsorbed on, encapsulated within, and/or contained throughout the carrier.
  • a chemical or biological agent is encapsulated in and/or contained throughout the particles.
  • the present invention is not limited by the nature of the chemical or biological agents.
  • Such agents include, but are not limited to, proteins, nucleic acid molecules, small molecule drugs, lipids, carbohydrates, cells, cell components, and the like.
  • two or more (e.g. , 3, 4, 5, etc.) different chemical or biological agents are included on or within the carrier.
  • agents are configured for specific release rates. In some embodiments, multiple different agents are configured for different release rates.
  • a first agent may release over a period of hours while a second agent releases over a longer period of time (e.g. , days, weeks, months, etc.).
  • the carrier or a portion thereof is configured for slow-release of biological or chemical agents.
  • the slow release provides release of biologically active amounts of the agent over a period of at least 30 days (e.g. , 40 days, 50 days, 60 days, 70 days, 80 days, 90 days, 100 days, 180 days, etc.).
  • the carrier or a portion thereof is configured to be sufficiently porous to permit ingrowth of cells into the pores. The size of the pores may be selected for particular cell types of interest and/or for the amount of ingrowth desired.
  • the particles comprise the antigen of interest without other non-peptide active agents, such as drugs or immunomodulators.
  • the particles of the invention do not contain immunostimulatory or immunosuppressive peptides in addition to the antigen of interest.
  • the particles do not contain other proteins or peptides (e.g. costimulatory molecules, MHC molecules, immunostimulatory peptides or immunosuppressive peptides) either on the surface or encapsulated within the particle.
  • Encapsulation of the antigen, biological, and/or chemical agents in the particle of the invention has been surprisingly found to induce immunological tolerance and has several advantages.
  • First, the encapsulated particles have a slower cytokine response.
  • Third, encapsulation allows more antigens, biological, and/or chemical agents to be incorporated with the particle.
  • encapsulation allows for easier use of complex protein antigens or organ homogenates (e.g. pancreas homogenate for type 1 diabetes or peanut extract in peanut allergy).
  • encapsulation of antigens, biological, and/or chemical agents within the particle maintains the net negative charge on the surface of the particle.
  • the encapsulation of the antigen, biological, and/or chemical agents in the particles of the invention may be performed by any method known in the art.
  • polypeptide antigens are encapsulated in the particles by a double-emulsion process.
  • the polypeptide antigens are water soluble.
  • the polypeptide antigens are encapsulated in the particles by a single-emulsion process.
  • the polypeptide antigens are more hydrophobic.
  • the double emulsion process leads to the formation of large particles which may result in the leakage of the hydrophilic active component and low entrapment efficiencies.
  • the coalescence and Ostwald ripening are two mechanisms that may destabilize the double-emulsion droplet, and the diffusion through the organic phase of the hydrophilic active component is the main mechanism responsible of low levels of entrapped active component.
  • One strategy to accomplish this is to apply a second strong shear rate.
  • the leakage effect can be reduced by using a high polymer concentration and a high polymer molecular mass, accompanied by an increase in the viscosity of the inner water phase and in increase in the surfactant molecular mass.
  • the present invention provides carriers having therein (or thereon) cells or other biological or chemical agents. Where cells are employed, the carriers are not limited to a particular type of cells. In some embodiments, the carriers have thereon pancreatic islet cells. In some embodiments, the microporous carriers additionally have thereon ECM proteins and/or exendin-4. The carriers are not limited to a particular type. In some embodiments, a carrier has regions of varying porosity (e.g. , varying pore size, pore depth, and/or pore density). In some embodiments, carriers have thereon (or therein) pharmaceutical agents, DNA, RNA, extracellular matrix proteins, exendin-4, etc.
  • the present invention provides methods for transplanting pancreatic islet cells with such carriers.
  • the inducing antigen is a single isolated or recombinantly produced molecule.
  • the target antigen is disseminated to various locations in the host, it is generally necessary that the inducing antigen be identical to or immunologically related to the target antigen.
  • antigens are most polynucleotide antigens, and some carbohydrate antigens (such as blood group antigens).
  • the inducing antigen contributes to the specificity of the tolerogenic response that is induced.
  • the inducing antigen may or may not be the same as the target antigen, which is the antigen present or to be placed in the subject being treated which is a target for the unwanted immunological response, and for which tolerance is desired.
  • the inducing antigen is not in the same form as found in pollen, e.g. , a polypeptide from Japanese cedar pollen, but is a fragment or derivative thereof
  • Inducing antigens of this invention include peptides based on a molecule of the appropriate specificity but adapted by fragmentation, residue substitution, labeling, conjugation, and/or fusion with peptides having other functional properties.
  • the adaptation may be performed for any desirable purposes, including but not limited to the elimination of any undesirable property, such as toxicity or immunogenicity; or to enhance any desirable property, such as mucosal binding, mucosal penetration, or stimulation of the tolerogenic arm of the immune response.
  • CRYJ1 or CRYJ2 refer not only to the intact subunit, but also to allotypic and synthetic variants, fragments, fusion peptides, conjugates, and other derivatives that contain a region that is homologous (preferably 70% identical, more preferably 80% identical and even more preferably 90% identical at the amino acid level) to at least 10 and preferably 20 consecutive amino acids of the respective molecule for which it is an analog, wherein the homologous region of the derivative shares with the respective parent molecule an ability to induce tolerance to the target antigen.
  • homologous preferably 70% identical, more preferably 80% identical and even more preferably 90% identical at the amino acid level
  • tolerogenic regions of an inducing antigen are often different from immunodominant epitopes for the stimulation of an antibody response.
  • Tolerogenic regions are generally regions that can be presented in particular cellular interactions involving T cells. Tolerogenic regions may be present and capable of inducing tolerance upon presentation of the intact antigen.
  • Some antigens contain cryptic tolerogenic regions, in that the processing and presentation of the native antigen does not normally trigger tolerance.
  • An elaboration of cryptic antigens and their identification is found in International Patent Publication WO 94/27634.
  • two, three, or a higher plurality of inducing antigens is used. It may be desirable to implement these embodiments when there are a plurality of target antigens, or to provide a plurality of bystanders for the target. It may also be desirable to provide a cocktail of antigens to cover several possible alternative targets. For example, a cocktail of CRYJ1 and CRYJ2 fragments, as well as other epitopes derived from Japanese cedar pollen, could be used to tolerize a subject. In another example, a mixture of allergens may serve as inducing antigen for the treatment of atopy.
  • Inducing antigens can be prepared by a number of techniques known in the art, depending on the nature of the molecule. Polynucleotide, polypeptide, and carbohydrate antigens can be isolated from cells of the species to be treated in which they are enriched. Short peptides are conveniently prepared by amino acid synthesis. Longer proteins of known sequence can be prepared by synthesizing an encoding sequence or PCR- amplifying an encoding sequence from a natural source or vector, and then expressing the encoding sequence in a suitable bacterial or eukaryotic host cell.
  • the combination comprises a complex mixture of antigens obtained from a pollen grain, one or more of which plays the role of inducing antigen.
  • the antigens may be in the form of whole cells, either intact or treated with a fixative such as formaldehyde, glutaraldehyde, or alcohol.
  • the antigens may be in the form of a lysate, created by detergent solubilization or mechanical rupture of cells or tissue, followed by clarification.
  • the antigens may also be obtained by subcellular fractionation, particularly an enrichment of plasma membrane by techniques such as differential centrifugation, optionally followed by detergent solubilization and dialysis. Other separation techniques are also suitable, such as affinity or ion exchange chromatography of solubilized membrane proteins.
  • Allergens are other antigens for which tolerance of the immune response thereto is also desirable.
  • the antigen is a polypeptide associated with Japanese cedar pollen.
  • the antigen is CRYJ1. In certain embodiments, the antigen is CRYJ2.
  • the particles of the invention are coupled to antigens comprising one or more epitopes associated with allergies, autoimmune diseases and/or inflammatory diseases or disorders.
  • the antigens may comprise one or more copies of an epitope.
  • the antigens comprise a single epitope associated with one disease or disorder.
  • the antigens comprise more than one epitope associated with the same disease or disorder.
  • the antigens comprise more than one epitope associated with different diseases or disorders.
  • the antigens comprise one or more epitopes associated with one or more allergies.
  • any suitable antigens associated with an allergy may find use within the scope of the present invention.
  • particles described herein are encapsulated with one or more antigens or epitopes associated with an allergy.
  • the antigens or epitopes are associated with dust, pet allergens, tree pollen, grass pollen, mold, vegetable allergens, fruit allergens, nut allergens, seed allergens, spice allergens, grain allergens, seafood allergens, meat allergens, nematode allergens, latex allergens, and/or venom allergens.
  • the antigenic epitope from Japanese cedar pollen comprises Cry j 1, Cry j 2, Cry j 3, Cry j 4, Cry j IFR, Cry j Chitinase, Cry j Asp, Cry j LTP, and/or Cry j CPA9, or fragments or variants thereof.
  • the antigenic epitope from Japanese cedar pollen comprises a CRYJ1 polypeptide or a fragment or a variant thereof.
  • the CRYJ1 polypeptide comprises an amino acid sequence of SEQ ID NO: 1.
  • the antigenic epitope from Japanese cedar pollen is a fragment of CRYJ1.
  • the fragment of CRYJ1 comprises ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, at least twenty, at least twenty-five, at least thirty, at least thirty-five, at least forty, at least forty-five, or at least fifty consecutive amino acids with at least 90%, at least 95%, at least 99%, or 100% sequence identity to SEQ ID NO: 1.
  • the antigenic epitope is a variant of CRYJ1.
  • the variant comprises an amino acid sequence with at least about 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater than 99% sequence identity to SEQ ID NO: 1.
  • the antigenic epitope from Japanese cedar pollen is a fragment of CRYJ1 selected from the group consisting of pl6-30, p81-95, pl06- 120, pi 11-125, p211-225, and p301-315, which are described in Sone et al, J. Immunol, vol. 161(1) 448-457 (1998); incorporated herein by reference in its entirety.
  • the antigenic epitope from Japanese cedar pollen comprises a CRYJ2 polypeptide or a fragment or a variant thereof.
  • the CRYJ2 polypeptide comprises an amino acid sequence of SEQ ID NO: 2.
  • the antigenic epitope from Japanese cedar pollen is a fragment of CRYJ2.
  • the fragment of CRYJ2 comprises ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, at least twenty, at least twenty-five, at least thirty, at least thirty -five, at least forty, at least forty-five, or at least fifty consecutive amino acids with at least 90%, at least 95%, at least 99%, or 100% sequence identity to SEQ ID NO: 2.
  • the antigenic epitope is a variant of CRYJ2.
  • the variant comprises an amino acid sequence with at least about 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater than 99% sequence identity to SEQ ID NO: 2
  • the antigenic epitope from Japanese cedar pollen is a fragment of CRYJ2 selected from the group consisting of p66-80, p81-95, pl41- 155, pi 86-200, p236-250, p346-360, p351-365, and p336-350, which are described in Sone et al (1998).
  • the particles described herein encapsulate two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, fifteen or more, or twenty or more antigenic epitopes from Japanese cedar pollen.
  • the antigenic epitopes contained in the fusion protein are connected by a cleavable linker.
  • a cleavable linker refers to an amino acid sequence that contains a specific cleavage site.
  • the cleavable linker is five, six, seven, eight, nine, ten, greater than ten, greater than fifteen, greater than twenty, greater than twenty-five amino acids in length.
  • the cleavable linker is cleaved by a protease at a specific site.
  • the cleavable linker contains more than one specific site that is cleaved by a protease.
  • the cleavable linker contains more than one specific site, wherein the specific sites are cleaved by different proteases.
  • the cleavable linker contains more than one specific site, wherein the specific sites are cleaved by the same protease.
  • the cleavable linker is a Furin sensitive linker and/or a cathepsin sensitive linker.
  • the cleavable linker is cleaved at a specific site on the linker by one or more of furin, cathepsin A, cathepsin B, cathepsin C, cathepsin D, cathepsin E, cathepsin F, cathepsin G, cathepsin H, cathepsin K, cathepsin L, cathepsin O, cathepsin W, and/or cathepsin Z.
  • the cleavable liner comprises the amino acid sequence of SEQ ID NO: 3.
  • the fusion protein contains two or more epitopes from the same protein. In particular embodiments, the fusion protein contains two or more epitopes from different proteins. In certain embodiments, the fusion protein comprises two or more epitopes from CRYJ1. In particular embodiments, the fusion protein comprises two or more epitopes from CRYJ2. In some embodiments, the fusion protein comprises epitopes from CRYJ1 and CRYJ2.
  • Combinations of antigens and/or epitopes can be tested for their ability to promote tolerance by conducting experiments with isolated cells or in animal models.
  • the tolerance inducing compositions of the present invention contain an apoptosis signaling molecule (e.g. , in addition to an antigenic peptide or other antigenic molecule).
  • the apoptosis signaling molecule is coupled and/or associated with the surface of the carrier.
  • an apoptotic signaling molecules allows a carrier to be perceived as an apoptotic body by antigen presenting cells of the host, such as cells of the host reticuloendothelial system; this allows presentation of the associated peptide epitopes in a tolerance-inducing manner.
  • apoptosis signaling molecules may also serve as phagocytic markers.
  • apoptosis signaling molecules suitable for the present invention have been described in US Pat App No. 20050113297, which is hereby incorporated by reference in its entirety.
  • Molecules suitable for the present invention include molecules that target phagocytes, which include macrophages, dendritic cells, monocytes, granulocytes and neutrophils.
  • molecules suitable as apoptotic signaling molecules act to enhance tolerance of the associated peptides.
  • a carrier bound to an apoptotic signaling molecule can be bound by Clq in apoptotic cell recognition (Paidassi et al, (2008) J. Immunol. 180:2329-2338; herein incorporated by reference in its entirety).
  • molecules that may be useful as apoptotic signaling molecules include phosphatidyl serine, annexin-1, annexin-5, milk fat globule-EGF-factor 8 (MFG-E8), or the family of thrombospondins (e.g. , thrombospondin-1 (TSP-1)).
  • the apoptotic signaling molecule may be conjugated to the antigen-specific peptide.
  • the apoptotic signaling molecule and antigen-specific peptide are conjugated by the creation of a fusion protein.
  • a fusion protein may comprise at least one antigen-specific peptide (or a fragment or a variant thereof) coupled to at least one molecule of an apoptotic signaling molecule (or a fragment or a variant thereof).
  • fusion protein For the creation of fusion proteins, the terms “fusion protein,” “fusion peptide,” “fusion polypeptide,” and “chimeric peptide” are used interchangeably. Suitable fragments of the antigen-specific peptide include any fragment of the full-length peptide that retains the function of generating the desired antigen-specific tolerance function of the present invention.
  • the fusion protein may be created by various means understood in the art (e.g. , genetic fusion, chemical conjugation, etc.). The two proteins may be fused either directly or via an amino acid linker.
  • the polypeptides forming the fusion protein are typically linked C-terminus to N-terminus, although they can also be linked C-terminus to C-terminus, N-terminus to N-terminus, or N-terminus to C-terminus.
  • the polypeptides of the fusion protein can be in any order.
  • a peptide linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
  • Amino acid sequences which may be usefully employed as linkers include those disclosed in Maratea et al, Gene 40:39-46 (1985); Murphy et al, Proc. Natl. Acad. Sci. USA 83: 8258-8262 (1986); U.
  • linker sequence may generally be from 1 to about 50 amino acids in length. In some embodiments, linker sequences are not required and/or utilized, for example, when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
  • a proxy for tolerogenic activity is the ability of an intact antigen or fragment to stimulate the production of an appropriate cytokine at the target site.
  • the immunoregulatory cytokine released by T suppressor cells at the target site is thought to be TGF- ⁇ (Miller et al, Proc. Natl. Acad. Sci. USA 89:421 , 1992).
  • Other factors that may be produced during tolerance are the cytokines IL4 and IL-10, and the mediator PGE.
  • lymphocytes in tissues undergoing active immune destruction secrete cytokines such as IL-I, IL-2, IL-6, and IFN- ⁇ .
  • the efficacy of a candidate inducing antigen can be evaluated by measuring its ability to stimulate the appropriate type of cytokines.
  • a rapid screening test for tolerogenic epitopes of the inducing antigen, effective mucosal binding components, effective combinations, or effective modes and schedules of mucosal administration can be conducted using syngeneic animals as donors for in vitro cell assays. Animals are treated at a mucosal surface with the test composition, and at some time are challenged with parenteral administration of the target antigen in complete Freund's adjuvant. Spleen cells are isolated, and cultured in vitro in the presence of the target antigen at a concentration of about 50 ⁇ g/mL. Target antigen can be substituted with candidate proteins or sub-fragments to map the location of tolerogenic epitopes. Cytokine secretion into the medium can be quantitated by standard immunoassay.
  • the ability of the cells to suppress the activity of other cells can be determined using cells isolated from an animal immunized with the target antigen, or by creating a cell line responsive to the target antigen (Ben-Nun et al, Eur. J. Immunol. 11 : 195, 1981, herein incorporated by reference in its entirety).
  • the suppressor cell population is mildly irradiated (about 1000 to 1250 rads) to prevent proliferation, the suppressors are co-cultured with the responder cells, and then tritiated thymidine incorporation (or MTT) is used to quantitate the proliferative activity of the responders.
  • the suppressor cell population and the responder cell population are cultured in the upper and lower levels of a dual chamber transwell culture system (Costar, Cambridge Mass.), which permits the populations to coincubate within 1 mm of each other, separated by a polycarbonate membrane (WO 93/16724).
  • a dual chamber transwell culture system Costar, Cambridge Mass.
  • WO 93/16724 a polycarbonate membrane
  • the target antigen is already present in the individual, there is no need to isolate the antigen or precombine it with the mucosal binding component.
  • the antigen may be expressed in the individual in a certain fashion as a result of a pathological condition (such as inflammatory bowel disease or Celiac disease) or through digestion of a food allergen. Testing is performed by giving the mucosal binding component in one or more doses or formulations, and determining its ability to promote tolerization against the antigen in situ.
  • compositions and modes of administration for treatment of specific disease can also be elaborated in a corresponding animal disease model.
  • the ability of the treatment to diminish or delay the symptomatology of the disease is monitored at the level of circulating biochemical and immunological hallmarks of the disease, immunohistology of the affected tissue, and gross clinical features as appropriate for the model being employed.
  • animal models that can be used for testing are included in the following section.
  • the invention contemplates modulation of tolerance by modulating THl response, TH2 response, THl 7 response, or a combination of these responses.
  • Modulating THl response encompasses changing expression of, e.g. , interferon-gamma.
  • Modulating TH2 response encompasses changing expression of, e.g. , any combination of IL-4, IL-5, IL-10, and IL-13.
  • an increase (decrease) in TH2 response will comprise an increase (decrease) in expression of at least one of IL-4, IL-5, IL- 10, or IL-13; more typically an increase (decrease) in TH2 response will comprise an increase in expression of at least two of IL-4, IL-5, IL-10, or EL-13, most typically an increase (decrease) in TH2 response will comprise an increase in at least three of IL-4, IL-5, IL-10, or IL-13, while ideally an increase (decrease) in TH2 response will comprise an increase (decrease) in expression of all of IL-4, IL-5, IL-10, and IL-13.
  • Modulating TH 17 encompasses changing expression of, e.g., TGF-beta, IL-6, IL-21 and IL23, and effects levels of IL-17, IL-21 and IL-22.
  • the present invention contemplates modulation of tolerance by promoting one type of immune response over another (e.g. , immune-switching or immune-deviation). In such embodiments, an established immune response of one phenotype is suppressed or reduced and an immune response of a different phenotype is increased or enhanced.
  • immune-switching from a Th2 to a Thl response in the context of an allergic immune reaction promotes the generation of an IgG2a antibody response and production of IFNy and/or IL-12, leading to a decrease in allergen- specific IgE response and a decrease in T cell polarization to Th2 cells.
  • Other suitable methods for assessing the effectiveness of compositions and methods of the present invention are understood in the art, as are discussed, for example, in U.S. Patent Publication No. 2012/0076831 (herein incorporated by reference in its entirety).
  • Certain embodiments of this invention relate to priming of immune tolerance in an individual not previously tolerized by therapeutic intervention. These embodiments generally involve a plurality of administrations of a combination of antigen and mucosal binding component. Typically, at least three administrations, frequently at least four administrations, and sometimes at least six administrations are performed during priming in order to achieve a long-lasting result, although the subject may show manifestations of tolerance early in the course of treatment. Most often, each dose is given as a bolus administration, but sustained formulations capable of mucosal release are also suitable. Where multiple administrations are performed, the time between administrations is generally between 1 day and 3 weeks, and typically between about 3 days and 2 weeks.
  • the same antigen and mucosal binding component are present at the same concentration, and the administration is given to the same mucosal surface, but variations of any of these variables during a course of treatment may be accommodated.
  • Other embodiments of this invention relate to boosting or extending the persistence of a previously established immune tolerance. These embodiments generally involve one administration or a short course of treatment at a time when the established tolerance is declining or at risk of declining. Boosting is generally performed 1 month to 1 year, and typically 2 to 6 months after priming or a previous boost. This invention also includes embodiments that involve regular maintenance of tolerance on a schedule of administrations that occur semiweekly, weekly, biweekly, or on any other regular schedule.
  • the particles of the current invention can be given in any dose effective to dampen the inflammatory immune response in a subject in need thereof or to treat a bacterial or viral infection in a subject in need thereof.
  • about 10 2 to about 10 20 particles are provided to the individual.
  • between about 10 3 to about 10 15 particles are provided.
  • between about 10 6 to about 10 12 particles are provided.
  • between about 10 8 to about 10 10 particles are provided.
  • the preferred dose is 0.1% solids/ml.
  • a preferred dose is approximately 4 x 10 9 beads, for 0.05 ⁇ beads, a preferred dose is approximately 4 x 10 12 beads, for 3 ⁇ beads, a preferred dose is 2 x 10 7 beads.
  • any dose that is effective in treating the particular condition to be treated is encompassed by the current invention.
  • the invention is useful for treatment of immune related disorders such as autoimmune disease, transplant rejection, enzyme deficiencies and allergic reactions.
  • Substitution of a synthetic, biocompatible particle system to induce immune tolerance could lead to ease of manufacturing, broad availability of therapeutic agents, increase uniformity between samples, increase the number of potential treatment sites and dramatically reduce the potential for allergic responses to a carrier cell.
  • immune response includes T cell mediated and/or B cell mediated immune responses.
  • exemplary immune responses include T cell responses, e.g. , cytokine production and cellular cytotoxicity.
  • immune response includes immune responses that are indirectly effected by T cell activation, e.g. , antibody production (humoral responses) and activation of cytokine responsive cells, e.g. , macrophages.
  • Immune cells involved in the immune response include lymphocytes, such as B cells and T cells (CD4 + , CD8 + , Thl and Th2 cells); antigen presenting cells (e.g.
  • professional antigen presenting cells such as dendritic cells, macrophages, B lymphocytes, Langerhans cells, and nonprofessional antigen presenting cells such as keratinocytes, endothelial cells, astrocytes, fibroblasts, oligodendrocytes); natural killer cells; myeloid cells, such as macrophages, eosinophils, mast cells, basophils, and granulocytes.
  • the modified particles of the present invention are effective to reduce inflammatory cell trafficking to the site of inflammation.
  • the term "anergy,” “tolerance,” or “antigen-specific tolerance” refers to insensitivity of T cells to T cell receptor-mediated stimulation. Such insensitivity is generally antigen- specific and persists after exposure to the antigenic peptide has ceased.
  • anergy in T cells is characterized by lack of cytokine production, e.g. , IL-2.
  • T-cell anergy occurs when T cells are exposed to antigen and receive a first signal (a T cell receptor or CD-3 mediated signal) in the absence of a second signal (a costimulatory signal).
  • cytokines e.g., IL-2
  • T cell anergy can also be observed by the lack of IL-2 production by T lymphocytes as measured by ELISA or by a proliferation assay using an indicator cell line.
  • a reporter gene construct can be used.
  • anergic T cells fail to initiate DL-2 gene transcription induced by a heterologous promoter under the control of the 5' IL-2 gene enhancer or by a multimer of the API sequence that can be found within the enhancer (Kang et al. 1992 Science. 257: 1134).
  • immunological tolerance refers to methods performed on a proportion of treated subjects in comparison with untreated subjects where: a) a decreased level of a specific immunological response (thought to be mediated at least in part by antigen-specific effector T lymphocytes, B lymphocytes, antibody, or their equivalents); b) a delay in the onset or progression of a specific immunological response; or c) a reduced risk of the onset or progression of a specific immunological response.
  • Specific immunological tolerance occurs when immunological tolerance is preferentially invoked against certain antigens in comparison with others.
  • Non-Specific immunological tolerance occurs when immunological tolerance is invoked indiscriminately against antigens which lead to an inflammatory immune response.
  • Quasi-Specific immunological tolerance occurs when immunological tolerance is invoked semi-discriminately against antigens which lead to a pathogenic immune response but not to others which lead to a protective immune response.
  • Tolerance to autoantigens and autoimmune disease is achieved by a variety of mechanisms including negative selection of self-reactive T cells in the thymus and mechanisms of peripheral tolerance for those autoreactive T cells that escape thymic deletion and are found in the periphery.
  • mechanisms that provide peripheral T cell tolerance include "ignorance" of self-antigens, anergy or unresponsiveness to autoantigen, cytokine immune deviation, and activation-induced cell death of self- reactive T cells.
  • regulatory T cells have been shown to be involved in mediating peripheral tolerance. See, for example, Walker et al. (2002) Nat. Rev. Immunol. 2: 11 -19; Shevach et al. (2001) Immunol. Rev.
  • the invention provides methods for increasing antigen presentation while suppressing or reducing TLR7/8, TLR9, and/or TLR 7/8/9 dependent cell stimulation.
  • administration of particular modified particles results in antigen presentation by DCs or APCs while suppressing the TLR 7/8, TLR9, and/or TLR7/8/9 dependent cell responses associated with immunostimulatory polynucleotides.
  • Such suppression may include decreased levels of one or more TLR- associated cytokines.
  • this invention provides novel compounds that have biological properties useful for the treatment of Mac-1 and LFA-1 mediated disorders.
  • compositions which comprise the immune modifying particles and optionally comprise a pharmaceutically acceptable carrier.
  • these compositions optionally further comprise one or more additional therapeutic agents.
  • the modified particles of the current invention may be administered to a patient in need thereof in combination with the administration of one or more other therapeutic agents.
  • additional therapeutic agents for conjoint administration or inclusion in a pharmaceutical composition with a compound of this invention may be an approved anti-inflammatory agent, or it may be any one of a number of agents undergoing approval in the Food and Drug Administration that ultimately obtain approval for the treatment of any disorder characterized by an uncontrolled inflammatory immune response or a bacterial or viral infection.
  • compositions of the present invention additionally comprise a pharmaceutically acceptable carrier, which, as used herein, includes any and all solvents, diluents, or other liquid vehicle, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
  • a pharmaceutically acceptable carrier includes any and all solvents, diluents, or other liquid vehicle, dispersion or suspension aids, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, solid binders, lubricants and the like, as suited to the particular dosage form desired.
  • Remington's Pharmaceutical Sciences, Sixteenth Edition, E. W. Martin (Mack Publishing Co., Easton, Pa., 1980) discloses various carriers used in formulating pharmaceutical compositions and known techniques for the preparation thereof.
  • any conventional carrier medium is incompatible with the compounds of the invention, such as by producing any undesirable biological effect or otherwise interacting in a deleterious manner with any other component(s) of the pharmaceutical composition, its use is contemplated to be within the scope of this invention.
  • materials which can serve as pharmaceutically acceptable carriers include, but are not limited to, sugars such as lactose, glucose and sucrose; starches such as com starch and potato starch; cellulose and its derivatives such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatine; talc; excipients such as cocoa butter and suppository waxes; oils such as peanut oil, cottonseed oil; safflower oil, sesame oil; olive oil; corn oil and soybean oil; glycols; such as propylene glycol; esters such as ethyl oleate and ethyl laurate; agar; buffering agents such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogenfree water; isotonic saline; Ringer's solution; ethyl alcohol, and phosphate buffer solutions, as well as other non-toxic compatible lubricants such as
  • Liquid dosage forms for oral administration include, but are not limited to, pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups and elixirs.
  • the liquid dosage forms may contain inert diluents commonly used in the art such as, for example, water or other solvents, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1 ,3-butylene glycol, dimethylformamide, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
  • the oral compositions can also
  • the particles of the invention may be administered orally, nasally, intravenously, intramuscularly, ocularly, transdermally, intraperitoneally, or subcutaneously. In one embodiment, the particles of the invention are administered intravenously.
  • the effective amounts and method of administration of the present invention for modulation of an immune response can vary based on the individual, what condition is to be treated and other factors evident to one skilled in the art. Factors to be considered include route of administration and the number of doses to be administered. Such factors are known in the art and it is well within the skill of those in the art to make such determinations without undue experimentation. A suitable dosage range is one that provides the desired regulation of immune.
  • Useful dosage ranges of the carrier may be, for example, from about any of the following: 0.5 to 10 mg/kg, 1 to 9 mg/kg, 2 to 8 mg/kg, 3 to 7 mg/kg, 4 to 6 mg/kg, 5 mg/kg, 1 to 10 mg/kg, 5 to 10 mg/kg.
  • the dosage can be administered based on the number of particles.
  • useful dosages of the carrier, given in amounts of carrier delivered may be, for example, about 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , or greater number of particles per dose.
  • the absolute amount given to each patient depends on pharmacological properties such as bioavailability, clearance rate and route of administration.
  • the effective amount and method of administration of the particular carrier formulation can vary based on the individual patient, desired result and/or type of disorder, the stage of the disease and other factors evident to one skilled in the art.
  • the route(s) of administration useful in a particular application are apparent to one of skill in the art. Routes of administration include but are not limited to topical, dermal, transdermal, transmucosal, epidermal, parenteral, gastrointestinal, and naso-pharyngeal and pulmonary, including transbronchial and transalveolar.
  • a suitable dosage range is one that provides sufficient IRP -containing composition to attain a tissue concentration of about 1-50 ⁇ as measured by blood levels.
  • the absolute amount given to each patient depends on pharmacological properties such as bioavailability, clearance rate and route of administration.
  • the present invention provides carrier formulations suitable for topical application including, but not limited to, physiologically acceptable implants, ointments, creams, rinses and gels.
  • Exemplary routes of dermal administration are those which are least invasive such as transdermal transmission, epidermal administration and subcutaneous injection.
  • Transdermal administration is accomplished by application of a cream, rinse, gel, etc. capable of allowing the carrier to penetrate the skin and enter the blood stream.
  • compositions suitable for transdermal administration include, but are not limited to, pharmaceutically acceptable suspensions, oils, creams and ointments applied directly to the skin or incorporated into a protective carrier such as a transdermal device (so-called "patch"). Examples of suitable creams, ointments etc. can be found, for instance, in the Physician's Desk Reference.
  • Transdermal transmission may also be accomplished by iontophoresis, for example using commercially available patches which deliver their product continuously through unbroken skin for periods of several days or more. Use of this method allows for controlled transmission of pharmaceutical compositions in relatively great concentrations, permits infusion of combination drugs and allows for contemporaneous use of an absorption promoter.
  • Parenteral routes of administration include but are not limited to electrical (iontophoresis) or direct injection such as direct injection into a central venous line, intravenous, intramuscular, intraperitoneal, intradermal, or subcutaneous injection.
  • Formulations of carrier suitable for parenteral administration are generally formulated in USP water or water for injection and may further comprise pH buffers, salts bulking agents, preservatives, and other pharmaceutically acceptable excipients.
  • Immunoregulatory polynucleotide for parenteral injection may be formulated in pharmaceutically acceptable sterile isotonic solutions such as saline and phosphate buffered saline for injection.
  • Gastrointestinal routes of administration include, but are not limited to, ingestion and rectal routes and can include the use of, for example, pharmaceutically acceptable powders, pills or liquids for ingestion and suppositories for rectal administration.
  • Naso-pharyngeal and pulmonary administration include are accomplished by inhalation, and include delivery routes such as intranasal, transbronchial and transalveolar routes.
  • the invention includes formulations of carrier suitable for administration by inhalation including, but not limited to, liquid suspensions for forming aerosols as well as powder forms for dry powder inhalation delivery systems.
  • Devices suitable for administration by inhalation of carrier formulations include, but are not limited to, atomizers, vaporizers, nebulizers, and dry powder inhalation delivery devices.
  • Injectable preparations for example, sterile injectable aqueous or oleaginous suspensions may be formulated according to the known art using suitable dispersing or wetting agents and suspending agents.
  • the sterile injectable preparation may also be a sterile injectable solution, suspension or emulsion in a nontoxic parenterally acceptable diluent or solvent, for example, as a solution in 1,3-butanediol.
  • the acceptable vehicles and solvents that may be employed are water, Ringer's solution, U.S. P. and isotonic sodium chloride solution.
  • sterile, fixed oils are conventionally employed as a solvent or suspending medium.
  • any bland fixed oil can be employed including synthetic mono-or diglycerides.
  • fatty acids such as oleic acid are used in the preparation of injectables.
  • the injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, or by incorporating sterilizing agents in the form of sterile solid compositions which can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.
  • the rate of drug release can be controlled.
  • biodegradable polymers include poly(orthoesters) and poly(anhydrides).
  • Depot injectable formulations are also prepared by entrapping the drug in liposomes or microemulsions which are compatible with body tissues.
  • the synthetic, biodegradable particles of the present invention provide ease of manufacturing, broad availability of therapeutic agents, and increased treatment sites.
  • surface-functionalized biodegradable poly(lactide-co-glycolide) particles with a high density of surface carboxylate groups, synthesized using the surfactant poly(ethylene-a//-maleic anhydride) provide a carrier that offers numerous advantages over other carrier particles and/or surfaces.
  • peptides e.g. , PLP139-151 peptide
  • Such peptide-coupled particles have shown that they are effective for the prevention of disease development and the induction of immunological tolerance (e.g.
  • Peptide coupled carriers of the present invention provide numerous advantages over other tolerance induction structures.
  • the particles are biodegradable, and therefore will not persist for long times in the body. The time for complete degradation can be controlled.
  • particles are functionalized to facilitate internalization without cell activation (e.g. , phosphatidylserine loaded into PLG microspheres).
  • particles incorporate targeting ligands for a specific cell population.
  • anti-inflammatory cytokines such as IL- 10 and TGF- ⁇
  • the composition of the particles has been found to affect the length of time the particles persist in the body and tolerance requires rapid particle uptake and clearance/degradation. Since ratios of over 50:50 lactide:glycolide slow the degradation rate, the particles of the invention have a lactide:glycolide ratio of about 50:50 or below. In one embodiment the particles of the invention have about a 50:50 D,L- lactide:glycolide ratio.
  • Solid dosage forms for oral administration include capsules, tablets, pills, powders, and granules.
  • the modified particles are mixed with at least one inert, pharmaceutically acceptable excipient or carrier such as sodium citrate or dicalcium phosphate and/or a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, and silicic acid, b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants such as glycerol, d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate, e) solution retarding agents such as paraffin, f) absorption accelerators such as quaternary ammonium compounds, g) wetting agents such as, for example, cetyl alcohol
  • the dosage form may also comprise buffering agents.
  • Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
  • the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings and other coatings well known in the pharmaceutical formulating art. They may optionally contain opacifying agents and can also be of a composition that they release the active ingredient(s) only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
  • embedding compositions examples include polymeric substances and waxes. Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugar as well as high molecular weight polyethylene glycols and the like.
  • the modified particles can also be in micro-encapsulated form with one or more excipients as noted above.
  • the solid dosage forms of tablets, dragees, capsules, pills, and granules can be prepared with coatings and shells such as enteric coatings, release controlling coatings and other coatings well known in the pharmaceutical formulating art.
  • the active compound may be admixed with at least one inert diluent such as sucrose, lactose and starch.
  • Such dosage forms may also comprise, as in normal practice, additional substances other than inert diluents, e.g. , tableting lubricants and other tableting aids such as magnesium stearate and microcrystalline cellulose.
  • the dosage forms may also comprise buffering agents. They may optionally contain opacifying agents and can also be of a composition that they release the modified particles only, or preferentially, in a certain part of the intestinal tract, optionally, in a delayed manner.
  • buffering agents include polymeric substances and waxes.
  • the present invention encompasses pharmaceutically acceptable topical formulations of the inventive modified particles.
  • pharmaceutically acceptable topical formulation means any formulation which is pharmaceutically acceptable for intradermal administration of modified microparticles of the invention by application of the formulation to the epidermis.
  • the topical formulation comprises a carrier system.
  • Pharmaceutically effective carriers include, but are not limited to, solvents ( e.g.
  • topical formulations of the invention may comprise excipients.
  • any pharmaceutically acceptable excipient known in the art may be used to prepare the inventive pharmaceutically acceptable topical formulations.
  • excipients that can be included in the topical formulations of the invention include, but are not limited to, preservatives, antioxidants, moisturizers, emollients, buffering agents, solubilizing agents, other penetration agents, skin protectants, surfactants, and propellants, and/or additional therapeutic agents used in combination to the modified particles.
  • Suitable preservatives include, but are not limited to, alcohols, quaternary amines, organic acids, parabens, and phenols.
  • Suitable antioxidants include, but are not limited to, ascorbic acid and its esters, sodium bisulfite, butylated hydroxy toluene, butylated hydroxyanisole, tocopherols, and chelating agents like EDTA and citric acid.
  • Suitable moisturizers include, but are not limited to, glycerine, sorbitol, polyethylene glycols, urea, and propylene glycol.
  • Suitable buffering agents for use with the invention include, but are not limited to, citric, hydrochloric, and lactic acid buffers.
  • Suitable solubilizing agents include, but are not limited to, quaternary ammonium chlorides, cyclodextrins, benzyl benzoate, lecithin, and polysorbates.
  • Suitable skin protectants that can be used in the topical formulations of the invention include, but are not limited to, vitamin E oil, allatoin, dimethicone, glycerin, petrolatum, and zinc oxide.
  • the pharmaceutically acceptable topical formulations of the invention comprise at least the modified particles of the invention and a penetration enhancing agent.
  • the choice of topical formulation will depend or several factors, including the condition to be treated, the physicochemical characteristics of the inventive compound and other excipients present, their stability in the formulation, available manufacturing equipment, and costs constraints.
  • the term "penetration enhancing agent” means an agent capable of transporting a pharmacologically active compound through the stratum corneum and into the epidermis or dermis, preferably, with little or no systemic absorption.
  • a wide variety of compounds have been evaluated as to their effectiveness in enhancing the rate of penetration of drugs through the skin. See, for example, Percutaneous Penetration Enhancers, Maibach H.
  • penetration agents for use with the invention include, but are not limited to, triglycerides (e.g. , soybean oil), aloe compositions (e.g.
  • aloe-vera gel ethyl alcohol, isopropyl alcohol, octolyphenylpolyethylene glycol, oleic acid, polyethylene glycol 400, propylene glycol, N-decylmethylsulfoxide, fatty acid esters (e.g. , isopropyl myristate, methyl laurate, glycerol monooleate, and propylene glycol monooleate) and N-methylpyrrolidone.
  • fatty acid esters e.g. , isopropyl myristate, methyl laurate, glycerol monooleate, and propylene glycol monooleate
  • N-methylpyrrolidone ethyl alcohol, isopropyl alcohol, isopropyl alcohol, octolyphenylpolyethylene glycol, oleic acid, polyethylene glycol 400, propylene glycol, N-decylmethylsulfoxide, fatty acid esters
  • the compositions may be in the form of ointments, pastes, creams, lotions, gels, powders, solutions, sprays, inhalants or patches.
  • formulations of the compositions according to the invention are creams, which may further contain saturated or unsaturated fatty acids such as stearic acid, palmitic acid, oleic acid, palmito-oleic acid, cetyl or oleyl alcohols, stearic acid being particularly preferred.
  • Creams of the invention may also contain a non-ionic surfactant, for example, polyoxy-40-stearate.
  • the active component is admixed under sterile conditions with a pharmaceutically acceptable carrier and any needed preservatives or buffers as may be required.
  • Ophthalmic formulation, eardrops, and eye drops are also contemplated as being within the scope of this invention.
  • the present invention contemplates the use of transdermal patches, which have the added advantage of providing controlled delivery of a compound to the body. Such dosage forms are made by dissolving or dispensing the compound in the proper medium.
  • penetration enhancing agents can also be used to increase the flux of the compound across the skin. The rate can be controlled by either providing a rate controlling membrane or by dispersing the compound in a polymer matrix or gel.
  • the modified particles can be administered by aerosol. This is accomplished by preparing an aqueous aerosol, liposomal preparation or solid particles containing the modified particles.
  • a nonaqueous (e.g. , fluorocarbon propellant) suspension could be used.
  • an aqueous aerosol is made by formulating an aqueous solution or suspension of the agent together with conventional pharmaceutically acceptable carriers and stabilizers.
  • the carriers and stabilizers vary with the requirements of the particular compound, but typically include nonionic surfactants (Tweens, Pluronics®, or polyethylene glycol), innocuous proteins like serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars or sugar alcohols.
  • Aerosols generally are prepared from isotonic solutions.
  • the modified particles and pharmaceutical compositions of the present invention can be formulated and employed in combination therapies, that is, the compounds and pharmaceutical compositions can be formulated with or administered concurrently with, prior to, or subsequent to, one or more other desired therapeutics or medical procedures.
  • the particular combination of therapies (therapeutics or procedures) to employ in a combination regimen will take into account compatibility of the desired therapeutics and/or procedures and the desired therapeutic effect to be achieved.
  • the therapies employed may achieve a desired effect for the same disorder (for example, an inventive compound may be administered concurrently with another anti-inflammatory agent), or they may achieve different effects (e.g., control of any adverse effects).
  • the pharmaceutical compositions containing the modified particles of the present invention further comprise one or more additional therapeutically active ingredients (e.g. , anti-inflammatory and/or palliative).
  • additional therapeutically active ingredients e.g. , anti-inflammatory and/or palliative.
  • palliative refers to treatment that is focused on the relief of symptoms of a disease and/or side effects of a therapeutic regimen, but is not curative.
  • palliative treatment encompasses painkillers, antinausea medications and anti- sickness drugs.
  • the invention provides methods of regulating an immune response in an individual, preferably a mammal, more preferably a human, comprising administering to the individual the modified particles described herein.
  • Methods of immunoregulation provided by the invention include those that suppress and/or inhibit an innate immune response or an adaptive immune response, including, but not limited to, an immune response stimulated by immunostimulatory polypeptides or viral or bacterial components.
  • the modified particles are administered in an amount sufficient to regulate an immune response.
  • regulation of an immune response may be humoral and/or cellular, and is measured using standard techniques in the art and as described herein.
  • compositions described herein are administered along with (e.g., concurrent with, prior to, or following) an implant (e.g. , device) and/or transplant (e.g., tissue, cells, organ) to mediate, negate, regulate and/or reduce the immune response associated therewith.
  • an implant e.g. , device
  • transplant e.g., tissue, cells, organ
  • the individual suffers from a disorder associated with unwanted immune activation, such as allergic disease or condition, allergy and asthma.
  • a disorder associated with unwanted immune activation such as allergic disease or condition, allergy and asthma.
  • An individual having an allergic disease or asthma is an individual with a recognizable symptom of an existing allergic disease or asthma.
  • Tolerance can be induced in such an individual, for example, by particles complexed inhaled substances (e.g. Japanese cedar pollen proteins) which elicit the allergic reaction.
  • the invention relates to uses of compositions of this invention prior to the onset of an allergy, e.g. an allergy to Japanese cedar pollen.
  • the invention relates to uses of the compositions of this invention to inhibit an ongoing or existing allergy.
  • the invention relates to ameliorating an allergy or an allergic response in a subject. By ameliorating it is meant to include treating, preventing, or suppressing the allergy or allergic response in the subject.
  • compositions of the present invention e.g. ,
  • PLG carrier coupled to antigenic molecule associated with Japanese cedar pollen allergy find use with one or more scaffolds, matrices, and/or delivery systems (See, e.g., U.S. Patent Publication No. 2009/0238879; U.S. Patent Nos. 7,846,466; 7,427,602; 7,029,697; 6,890,556; 6,797,738; and 6,281,256; herein incorporated by reference in their entireties).
  • particles e.g., antigen-coupled PLG particles
  • a scaffold, matrix, and/or delivery system (e.g., for delivery of chemical/biological material, cells, tissue, and/or an organ to a subject) comprises and/or is made from materials described herein (e.g. , PLG conjugated to one or more antigenic peptides).
  • microporous scaffolds e.g., for transplanting biological material (e.g. , cells, tissue, etc.) into a subject
  • microporous scaffolds are provided having thereon agents (e.g. , extracellular matrix proteins, exendin-4) and biological material (e.g. , pancreatic islet cells).
  • the scaffolds are used in the treatment of diseases (e.g., type 1 diabetes), and related methods (e.g., diagnostic methods, research methods, drug screening).
  • scaffolds are provided with the antigen-conjugated carriers described herein on and/or within the scaffold.
  • scaffolds are produced from antigen conjugated materials (e.g. , antigen conjugated PLG).
  • a scaffold and/or delivery system comprises one or more layers and/or has one or more chemical and/or biological entities/agents (e.g. , proteins, peptide-conjugated particles, small molecules, cells, tissue, etc.), see, e.g. , U.S. Patent Publication No. 2009/0238879; herein incorporated by reference in its entirety.
  • antigen-coupled particles are co-administered with a scaffold delivery system to elicit induction of immunological tolerance to the scaffold and the associated materials.
  • microporous scaffold is administered to a subject with particles described herein on or within the scaffold.
  • a scaffold delivery system comprises antigen-coupled particles.
  • Example 1 Encapsulation of recombinant Japanese cedar pollen proteins into TIMPs
  • JCP Japanese cedar pollen
  • TIMP particles encapsulating JCP TIMP particles encapsulating JCP (TIMP-JCP P ) using a double emulsion-solvent evaporation method (FIG. 2C). Briefly, 200 ⁇ . of 5 mg/mL JCP solution was added to 0.5 mL 20% w/v PLGA in DCM or 400 ⁇ .
  • Nanoparticle size and zeta-potential in water was measured using dynamic light scattering on a Zetasizer Nano ZSP (Malvern Instruments, Westborough, MA). Lot-release criteria require TIMP-JCP P diameter to be 700nm ⁇ 250nm, charge of at least -30 mV and contain at least 5 ⁇ g antigen/mg of PLGA. Conditions for particle fabrication and results of JCP encapsulation are shown in FIG. 4.
  • TIMP-JCP R particles were generated using low molecular weight
  • PLGA (0.17 dL/g), Sugi basic protein (CRYJ1, 55,180 Da), and polygalacturonase (CRYJ2, 59,070 Da). Purity of the recombinant proteins was assessed by SDS-PAGE (FIG. 3C) and compared to previously determined results (Y. Mitobe et al., Regulatory toxicology and pharmacology: RTP 2015 71). Conditions for TIMP-JCP R particle fabrication are shown in Table 2.
  • CRYJ1 or CRYJ2 was encapsulated using the double-emulsion protocol for particle formulation (schematic shown in FIG. 2C) and described above. Protein concentration and burst release for were determined by CBQCA for each sample. Results for these analyses are shown below in Table 3. Size and particle charge were determined by dynamic light scattering (DLS) using a Malvern Zetasizer Nano ZS or ZSP and results are shown below in Table 4.
  • DLS dynamic light scattering
  • the nature of the acute inflammatory model may be influenced by the choice of mouse strain, the allergen, and the sensitization and challenge protocol (FIG. 5A). Briefly, Japanese cedar pollen extract (Cedar pollen extract-Cj; LSL-LG5280; Lo# 153101, Cosmo Bio USA) was re-suspended in MilliQ water at 1 mg/mL. The JCP solution was diluted 1 : 1 in Imject Alum (Thermo Scientific, Cat. # 77161), such that the final concentration of alum was 20 mg/mL. On day 0, Balb/c mice were injected intraperitoneally with 100 JCP+Alum solution (i.e.
  • a second equivalent dose was administered to the mice on day 14.
  • Mice were retro-orbitally bled to collect serum for antibody analysis on day 21 (FIG. 5B-5D).
  • mice were intranasally challenged with 100 ⁇ g of
  • mice were again bleed for analysis of antibodies in the serum (FIG. 9A- 9C). Mice were then sacrificed and the spleens from each mouse were collected and homogenized for ex vivo cytokine analysis and proliferation (FIG. 8). Spleens and were harvested, processed into red blood cell-free single cell suspensions and incubated with 1, 25 or 50 ⁇ g/mL JCP complete RPMI culture medium at 37°C for 48hr. 50 ⁇ , supernatant was removed for cytokine analysis and cells were then pulsed with 1 ⁇ [3H]TdR for the last 24 hours of culture. Proliferation was determined by [3H]TdR incorporation as detected by a Topcount Microplate Scintillation Counter (PerkinElmer, Waltham, MA).
  • Example 3 Murine model of JCP allergy and treatment with CRYJ1 and CRYJ2
  • mice are immunized intraperitoneally (i.p.) with two doses of 10 ⁇ g
  • CRYJ1 and CRYJ2 the major Japanese cedar pollen allergens in alum (3 mg) or alum and PBS alone. Mice are then challenged for 20 min with aerosolized CRYJ1 and CRYJ2 (10 mg/ml) for three consecutive days prior to tissue harvest.
  • Lungs are flushed with 1 mL of bronchoalveolar lavage fluid (BALF; 1 mM EDTA and 10% FBS in PBS). Total cell counts are determined and samples are cytospun onto slides and DiffQuik (Siemens, Newark, DE) stained for differential cell counts.
  • BALF bronchoalveolar lavage fluid
  • DiffQuik Siemens, Newark, DE
  • H&E hematoxylin and eosin
  • PAS periodic acid-Schiff
  • CRYJl/2-specific IgE Serum is collected from mice upon sacrifice and CRYJl/2-specific IgE is quantified by sandwich ELISA.
  • Anti-mouse IgE (BD Biosciences) is used as the capture antibody and biotinylated CRYJl/2 (prepared using EZ-Link Sulfo-NHS-LC-Biotin kit from Pierce [Rockford, IL]) is used as a secondary reagent.
  • the quantity of CRYJl/2-IgE is to be determined by a standard curve generated using purified mouse CRYJl/2-IgE.
  • TIMP-CRYJl and/or CRYJ2 TIMP-JCP R
  • 200 mg TIMP-OVA control will be used for efficacy testing in the mouse model of JCP allergy.
  • Six groups of 5- 10 mice will be treated with TIMP-OVA or TIMP-JCP R given as either a one dose (Groups 1-3) or two dose (Groups 3-6) regimen. Animals are sensitized (either before or after TIMP treatment) to JCP antigen. On day 28 and 29 airway challenge will be performed and efficacy of treatment determined using the primary read outs and success measures described below. Note that group 7 is to be sensitized to OVA and is being used as positive allergy control, as these mice will be challenged with OVA instead of JCP.
  • OVA or TIMP-JCP R given as either a one dose (Groups 1-3) or two dose (Groups 4-6) regimen. Animals will then be sensitized to JCP antigen. ON day 28 and 29 airway challenge is performed and efficacy of treatment is determined using the primary read outs and success measures described below. Note that Group 7 is to be sensitized to OVA and is used as a positive allergy control, as these mice are challenged with OVA instead of JCP.
  • JCP 11 or TIMP-OVA after sensitization to JCP Two dose regimens are tested. This includes a one TIMP dose regimen (groups 1-3) and a two dose regimen (groups 4-6), separated by 7 days. On day 28 and 29 air challenge is performed and efficacy of treatment is determined using the primary read outs and success measures described below.
  • TIMP-JCP R treated mice do not have a change in temperature compared to baseline temperature following air challenge. There is no change in blood eosinophil and mast cell numbers compared to baseline measures in TIMP- JCP 11 treated mice.
  • TIMP-JCP R treated mice have significantly reduced JCP-specific IgE compared to TIMP-OVA treated mice sensitized to JCP.
  • TIMP-JCP R treated mice also have significantly reduced systemic IL-4, IL-5, and IL-13 compared to TIMP-OVA treated mice sensitized to JCP.
  • TIMP-JCP R compared to TIMP-OVA treated mice.
  • TIMP-JCP R treated mice do not have a change in temperature compared to baseline temperature following air challenge. There is no change in blood eosinophil and mast cell numbers compared to baseline measures in TIMP- JCP 11 treated mice.
  • TIMP-JCP R treated mice have significantly reduced JCP-specific IgE compared to TIMP-OVA treated mice sensitized to JCP.
  • TIMP-JCP R treated mice also have significantly reduced JCP-specific systemic IL-4, IL-5, and IL-13 compared to TIMP-OVA treated mice sensitized to JCP.
  • TIMP-JCP R treated mice also have reduced specific antigen production compared to TIMP-OVA treated mice.
  • TIMP-JCP in a single-center, non-blinded, placebo controlled study in Japanese Seasonal Allergy Rhinitis (SAR) patients exposed to quantitative high-density Japanese cedar pollen.
  • SAR Seasonal Allergy Rhinitis
  • TNSS total nasal symptom score
  • the secondary objectives are to analyze and evaluate changes in Total Symptom Score (TSS), symptom scores, amount of nasal discharge, number of sneeze, and patient's impression in patents with allergic Rhinitis, and to evaluate the safety of TIMP-JCP administered in intravenous route in patients receiving high-density exposure to pure Japanese cedar pollen.
  • TSS Total Symptom Score
  • Inclusion criteria • Japanese patients with SAR.
  • a positive IgE for Japanese cedar pollen antigen: Determined by Fluorescence-Enzyme Immunoassay (FEIA) or Chemiluminescent Enzyme Immunoassay (CLEIA) within 1.5 years prior to the day of the screening exposure test.
  • FIONA Fluorescence-Enzyme Immunoassay
  • CLIA Chemiluminescent Enzyme Immunoassay
  • TNSS TNSS
  • nasal congestion score 2 (moderate) or more at least one assessment point of 90 to 150 minutes after the start of the screening exposure.
  • TNSS and nasal congestion scores may be at any other assessment points if it meets the criteria) ⁇ Age >20 and ⁇ 65 years (no gender preferences).
  • TIMP-JCP including anti-contestants and immune modifying agents
  • Anti-allergic drugs include antihistamines (HI and H2 blockers: oral administration, nose drops, eye drops, injection, and topical use), anticholinergic agents, vasoconstrictor nose drops, antihistamine-containing cold remedies, agents that can be expected to have an anti-allergic/ antihistaminic effect (including Chinese medicines and glycyrrhizin), and other agents that are indicated for allergic symptoms (sneezing, rhinorrhea, nasal congestion, and eye itching etc.).
  • Steroids oral, inhaled, nose drops, eye drops, or topical use
  • immunosuppressants oral, topical use, or injected
  • azole fungicides and histamine containing gamma-globulin preparations.
  • Azole fungicides macrolide antibiotics, and preparations containing aluminum hydroxide/magnesium hydroxide.
  • SAE's unexpected drug related serious adverse events
  • Drug TIMP-JCP, Poly(lactic-co-glycolic acid) tolerogenic immune modifying
  • TIMP-JCP is provided as sterile lyophilized white powder in a vial. Each vial contains 500mg of TIMP-JCP. TIMP-JCP is given at a dose of [adjust per Phase 1 results -initial assumption is 10mg/kg] .
  • Duration of Treatment/Study Patient enrolment occurs following patient screening and informed consent. Dosing begins upon recruitment into the study. Dosing will be given at day 0 and once more at day 14. The first high-density Japanese cedar pollen exposure occurs at day 18-21 (patients are exposed to 8,000 grains/m 3 of JCP for 5 hours in environmental exposure unit).
  • the second high-density Japanese cedar pollen exposure occurs at day 32-35 (patients are exposed to 8,000 grains/m3 of JCP for 5 hours in environmental exposure unit).
  • follow up visits occur at days 42, 49, and 56.
  • the final follow- up visit occurs at day 63, which is 4 weeks after the second exposure.
  • TIMP-JCP is to be diluted in normal saline (NS; 0.9% Sodium Chloride, NaCl) by slow IV infusion over 30 minutes. TIMP-JCP may be discontinued at any time if the Investigator determines that alternative therapy should be administered
  • Antibody IgG antibody, specific IgG antibody (anti-JCP, anti-CRYJl, and anti-CRYJ2), specific IgG4 antibody (anti-JCP), IgE antibody, specific IgE antibody (anti-JCP) • Cytokines (IFN-gamma, IL-4, IL-5, IL-10, IL-12, and IL-13)
  • Nasal discharge amount The weight of tissue papers after blowing patient's nose is measured every 1 hour. A difference from the weight before blowing the nose is calculated as nasal discharge amount.
  • Subjects treated with TIMP-JCP show less occurrence and severity of allergic reactions to Japanese cedar pollen exposure. This is manifested by reduced TNSS in TIMP-JCP-treated subjects compared to placebo-treated subjects. JCP-treated subjects also have reduced levels specific IgG antibody (anti-JCP, anti-CRYJl, and anti-CRYJ2), specific IgG4 antibody (anti-JCP), IgE antibody, specific IgE antibody (anti-JCP); reduced Peripheral B and T cell responses to Japanese cedar pollen; and lower TSS scores, symptom scores, nasal discharge amount, and number of sneezes compared to placebo group.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Optics & Photonics (AREA)
  • Organic Chemistry (AREA)
  • Nanotechnology (AREA)
  • Biomedical Technology (AREA)
  • Physics & Mathematics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pulmonology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Inorganic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Dermatology (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2017/017248 2016-02-09 2017-02-09 Timps encapsulating japanese cedar pollen epitopes Ceased WO2017139498A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2018560744A JP2019504895A (ja) 2016-02-09 2017-02-09 スギ花粉エピトープを封入するtimp(組織性メタロプロテアーゼ阻害因子)
KR1020187025977A KR20180105243A (ko) 2016-02-09 2017-02-09 일본 삼나무 꽃가루 에피토프를 캡슐화하는 timps
JP2022059997A JP2022101576A (ja) 2016-02-09 2022-03-31 スギ花粉エピトープを封入するtimp(組織性メタロプロテアーゼ阻害因子)
JP2025001876A JP2025069142A (ja) 2016-02-09 2025-01-06 スギ花粉エピトープを封入するtimp(組織性メタロプロテアーゼ阻害因子)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662293261P 2016-02-09 2016-02-09
US62/293,261 2016-02-09

Publications (1)

Publication Number Publication Date
WO2017139498A1 true WO2017139498A1 (en) 2017-08-17

Family

ID=59563413

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/017248 Ceased WO2017139498A1 (en) 2016-02-09 2017-02-09 Timps encapsulating japanese cedar pollen epitopes

Country Status (3)

Country Link
JP (3) JP2019504895A (enExample)
KR (1) KR20180105243A (enExample)
WO (1) WO2017139498A1 (enExample)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9999600B2 (en) 2013-04-03 2018-06-19 N-Fold Llc Nanoparticle compositions
US10265416B2 (en) 2010-08-10 2019-04-23 École Polytechnique Fédérale de Lausanna (EPFL) Compositions for generation of immune tolerance to specific antigens
US10392437B2 (en) 2010-08-10 2019-08-27 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
EP3400069A4 (en) * 2016-01-04 2019-09-25 Cour Pharmaceuticals Development Company Inc. Particles for the Encapsulation of Fusion Proteins with Bundled Epitopes
US10800838B2 (en) 2010-08-10 2020-10-13 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10821157B2 (en) 2014-02-21 2020-11-03 Anokion Sa Glycotargeting therapeutics
US10940209B2 (en) 2014-02-21 2021-03-09 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US10946079B2 (en) 2014-02-21 2021-03-16 Ecole Polytechnique Federale De Lausanne Glycotargeting therapeutics
US10953101B2 (en) 2014-02-21 2021-03-23 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US11071776B2 (en) 2012-04-23 2021-07-27 N-Fold Llc Nanoparticles for treatment of allergy
JP2021525549A (ja) * 2018-05-25 2021-09-27 ザ ウィスター インスティテュート 腫瘍特異的ネオ抗原およびその使用方法
US11253579B2 (en) 2017-06-16 2022-02-22 The University Of Chicago Compositions and methods for inducing immune tolerance
US12383617B2 (en) 2018-05-09 2025-08-12 The University Of Chicago Compositions and methods concerning immune tolerance

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090156480A1 (en) * 2005-08-25 2009-06-18 Mitsuru Akashi Biodegradable nanoparticle having t-cell recognizable epitope peptide immobilized thereon or encapsulated therein
US20150283218A1 (en) * 2013-08-13 2015-10-08 Northwestern University Peptide conjugated particles

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012174160A1 (en) * 2011-06-14 2012-12-20 The United States Of America , As Represented By The Secretary, Department Of Health And Human Services Tem8 antibodies, conjugates thereof, and their use

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090156480A1 (en) * 2005-08-25 2009-06-18 Mitsuru Akashi Biodegradable nanoparticle having t-cell recognizable epitope peptide immobilized thereon or encapsulated therein
US20150283218A1 (en) * 2013-08-13 2015-10-08 Northwestern University Peptide conjugated particles

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10265416B2 (en) 2010-08-10 2019-04-23 École Polytechnique Fédérale de Lausanna (EPFL) Compositions for generation of immune tolerance to specific antigens
US10265415B2 (en) 2010-08-10 2019-04-23 École Polytechnique Fédérale De Lausanne (Epfl) Compositions for inducing antigen-specific tolerance
US10392437B2 (en) 2010-08-10 2019-08-27 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US12060414B2 (en) 2010-08-10 2024-08-13 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10471155B2 (en) 2010-08-10 2019-11-12 École Polytechnique Fédérale De Lausanne (Epfl) Antigen-specific tolerance and compositions for induction of same
US10800838B2 (en) 2010-08-10 2020-10-13 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US11884721B2 (en) 2010-08-10 2024-01-30 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US10919963B2 (en) 2010-08-10 2021-02-16 École Polytechnique Fédérale De Lausanne (Epfl) Erythrocyte-binding therapeutics
US11246943B2 (en) 2010-08-10 2022-02-15 École Polytechnique Fédérale De Lausanne (Epfl) Antigen-specific tolerance and compositions for induction of same
US11071776B2 (en) 2012-04-23 2021-07-27 N-Fold Llc Nanoparticles for treatment of allergy
US9999600B2 (en) 2013-04-03 2018-06-19 N-Fold Llc Nanoparticle compositions
US10946079B2 (en) 2014-02-21 2021-03-16 Ecole Polytechnique Federale De Lausanne Glycotargeting therapeutics
US10953101B2 (en) 2014-02-21 2021-03-23 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US10940209B2 (en) 2014-02-21 2021-03-09 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US11654188B2 (en) 2014-02-21 2023-05-23 Ecole Polytechnique Federale De Lausanne (Epfl) Glycotargeting therapeutics
US11666638B2 (en) 2014-02-21 2023-06-06 Ecole Polytechnique Federale De Lausanne (Epfl) Glycotargeting therapeutics
US11793882B2 (en) 2014-02-21 2023-10-24 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US11801305B2 (en) 2014-02-21 2023-10-31 École Polytechnique Fédérale De Lausanne (Epfl) Glycotargeting therapeutics
US10821157B2 (en) 2014-02-21 2020-11-03 Anokion Sa Glycotargeting therapeutics
EP3400069A4 (en) * 2016-01-04 2019-09-25 Cour Pharmaceuticals Development Company Inc. Particles for the Encapsulation of Fusion Proteins with Bundled Epitopes
US11253579B2 (en) 2017-06-16 2022-02-22 The University Of Chicago Compositions and methods for inducing immune tolerance
US12383617B2 (en) 2018-05-09 2025-08-12 The University Of Chicago Compositions and methods concerning immune tolerance
JP2021525549A (ja) * 2018-05-25 2021-09-27 ザ ウィスター インスティテュート 腫瘍特異的ネオ抗原およびその使用方法

Also Published As

Publication number Publication date
JP2019504895A (ja) 2019-02-21
JP2022101576A (ja) 2022-07-06
JP2025069142A (ja) 2025-04-30
KR20180105243A (ko) 2018-09-27

Similar Documents

Publication Publication Date Title
JP2025069142A (ja) スギ花粉エピトープを封入するtimp(組織性メタロプロテアーゼ阻害因子)
US11389517B2 (en) Peptide conjugated particles
JP7586863B2 (ja) 共有ポリマー抗原コンジュゲート化粒子
KR102283760B1 (ko) 펩티드 접합된 입자
US12502436B2 (en) Covalent polymer-antigen conjugated particles
HK40030584A (en) Peptide conjugated particles
HK1225279B (en) Peptide conjugated particles
HK1225279A1 (en) Peptide conjugated particles

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17750780

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2018560744

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20187025977

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 1020187025977

Country of ref document: KR

122 Ep: pct application non-entry in european phase

Ref document number: 17750780

Country of ref document: EP

Kind code of ref document: A1