WO2017135545A1 - 쥐 또는 토끼의 면역글로불린 g에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 - Google Patents
쥐 또는 토끼의 면역글로불린 g에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 Download PDFInfo
- Publication number
- WO2017135545A1 WO2017135545A1 PCT/KR2016/010461 KR2016010461W WO2017135545A1 WO 2017135545 A1 WO2017135545 A1 WO 2017135545A1 KR 2016010461 W KR2016010461 W KR 2016010461W WO 2017135545 A1 WO2017135545 A1 WO 2017135545A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- immunoglobulin
- lipid body
- binding
- rabbit
- present
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/461—Igs containing Ig-regions, -domains or -residues form different species
- C07K16/464—Igs containing CDR-residues from one specie grafted between FR-residues from another
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/62—DNA sequences coding for fusion proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/531—Production of immunochemical test materials
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/531—Production of immunochemical test materials
- G01N33/532—Production of labelled immunochemicals
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54306—Solid-phase reaction mechanisms
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/544—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being organic
Definitions
- the present invention relates to novel polypeptides that selectively bind to immunoglobulin G in rats or rabbits, and more particularly, the present invention relates to polypeptides that bind to immunoglobulin G in rats or rabbits, methods of producing the polypeptides and It relates to a composition for immunoassay comprising.
- Immunoglobulins are glycoproteins that function as antibodies that neutralize foreign antigens, such as viruses and bacteria, in blood or tissue fluid.
- Immunoglobulin G is the most abundant of immunoglobulins and is an important substance that protects the body by inducing an immune response by binding to an external substance.
- the binding between immunoglobulin G and foreign substances is called an immune response, and the characteristics of mice that produce primary immunoglobulin G that recognizes specific antigens and secondary immunoglobulin G that binds to primary immunoglobulin G using these characteristics are the most commonly used animal species. Or it is produced through the immunological response of rabbits are used in biological immunoassays.
- the lipid body refers to a polypeptide optimized by consensus design by fusion based on the similarity of the structure of the VLR with the N-terminus of internalin B having the structure of LRR (Leucin-rich repeat). Lipbodies are about one-fifth the size of antibodies and can be mass-produced in E. coli, resulting in lower production costs, and excellent thermal and pH stability, which has great advantages for industrial use. In addition, the binding force to the target material can be easily increased to the pico-mole level, and the specificity of the target material has been proved to be excellent.
- the present inventors have developed a lipid body specifically binding to human immunoglobulin G in Korean Patent No. 10-2013-0081009.
- the lipid body developed in the patent has specificity only in human immunoglobulin G, and has a disadvantage in that it does not bind to immunoglobulin G in rats or rabbits used as secondary immunoglobulins used in general biological immunoassays.
- the present inventors have solved the above problems, and in order to develop a specific protein binder specific for immunoglobulin G in rats or rabbits, as a result of the effort, to produce a mutant library using the Lipibody, module-based
- the selected lipidobodies exert superior effects over conventional secondary immunoglobulin G in various immunoassays.
- the present invention has been completed.
- An object of the present invention is a lipid body (Repebody) that specifically binds to immunoglobulin G in rats or rabbits; A polynucleotide encoding said lipid body; An expression vector comprising the polynucleotide; A recombinant microorganism into which the expression vector is introduced; And it provides a method for producing the lipid body using the recombinant microorganism.
- Repebody lipid body that specifically binds to immunoglobulin G in rats or rabbits
- a polynucleotide encoding said lipid body An expression vector comprising the polynucleotide; A recombinant microorganism into which the expression vector is introduced; And it provides a method for producing the lipid body using the recombinant microorganism.
- Still another object of the present invention is to provide a composition for immunoassay containing the lipida body.
- the present invention provides a repeat body represented by the amino acid sequence of any one of SEQ ID NO: 3 and 7 to 12, and selectively binds to immunoglobulin G of rabbits.
- the present invention also provides a polynucleotide encoding the above lipid body.
- the present invention also provides a recombinant vector comprising the polynucleotide.
- the present invention also provides a recombinant microorganism into which the polynucleotide or the recombinant vector is introduced.
- the present invention also comprises the steps of: (i) culturing the recombinant microorganism to express the lipid body; And (ii) it provides a method for producing the lipid body comprising the step of recovering the expressed lipid body.
- the present invention also comprises the steps of: (i) treating a mixture containing rabbit immunoglobulin G antibodies to a column on which the lipidi is adsorbed; And (ii) provides a method for purifying rabbit immunoglobulin G antibody comprising the step of eluting the antibody attached to the column of step (i).
- the present invention also comprises: (i) a surface treatment step of attaching the lipid body to a solid substrate; And (ii) provides a method of immobilizing rabbit immunoglobulin G comprising the step of binding the immunoglobulin G to the surface-treated solid substrate.
- the present invention also provides an immunosensor in which a rabbit immunoglobulin G is immobilized to the solid substrate surface-treated with the lipid body through the lipid body.
- the present invention also comprises the steps of: (a) processing a sample containing a substance having a binding capacity to the immunoglobulin G of the rabbit to the immune sensor; And (b) provides a method for detecting a substance having a binding capacity to the immunoglobulin G of the rabbit using the lipid body comprising the step of confirming the binding of the immune sensor.
- the present invention also comprises a lipid body, rabbit immunoglobulin G ELISA composition; Western blotting composition; And it provides a composition for immunochemical staining.
- the present invention provides a repeat body represented by the amino acid sequence of any one of SEQ ID NOs: 4 to 6 and 13 to 15, which selectively binds to immunoglobulin G in rats.
- the present invention also provides a polynucleotide encoding the above lipid body.
- the present invention also provides a polynucleotide encoding the above lipida body.
- the present invention also provides a recombinant microorganism into which the polynucleotide or the recombinant vector is introduced.
- the present invention also comprises the steps of: (i) culturing the recombinant microorganism to express the lipid body; And (ii) it provides a method for producing the lipid body comprising the step of recovering the expressed lipid body.
- the present invention also comprises the steps of: (i) treating a mixture containing murine immunoglobulin G antibodies in a column to which the lipidi is adsorbed; And (ii) provides a method for purifying the mouse immunoglobulin G antibody comprising the step of eluting the antibody attached to the column of step (i).
- the present invention also comprises: (i) a surface treatment step of attaching the lipid body to a solid substrate; And (ii) provides a method for immobilizing mouse immunoglobulin G comprising the step of binding the immunoglobulin G to the surface-treated solid substrate.
- the present invention also provides an immunosensor in which a mouse immunoglobulin G is immobilized on the solid substrate surface-treated with the lipid body via the lipid body.
- the present invention also comprises the steps of: (a) processing a sample containing a substance having a binding ability to the immunoglobulin G of the mouse to the immune sensor; And (b) provides a method for detecting a substance having a binding ability to the immunoglobulin G in the rat using the lipid body comprising the step of confirming the binding of the immune sensor.
- the present invention also comprises the above-described lipid body, a mouse immunoglobulin G ELISA composition; Western blotting composition; And it provides a composition for immunochemical staining.
- Figure 1 is a schematic diagram showing the overall structure showing the amino acid residues that built a random library for the development of the lipid body binding to rabbit immunoglobulin G in the present invention.
- Figure 2 is a schematic diagram showing the overall structure showing the amino acid residues that built a random library for the development of the lipid body binding to immunoglobulin G in the present invention.
- FIG. 3 is a phage display biopanning of the immunoglobulin G in rabbits using the phage library constructed in the present invention, and finally the binding capacity of the selected Lipibody clone is measured by isothermal titration calorimetry (ITC) One result.
- ITC isothermal titration calorimetry
- FIG. 5 shows the results of confirming specific binding of Lipibodi clones having the highest binding ability to immunoglobulin G in humans, mice and rabbits through ELISA fluorescence.
- Figure 6 is a result of comparing the target protein detection ability of the existing secondary immunoglobulin G enzyme conjugate and lipid body enzyme conjugate through ELISA. In the various concentration ranges of immunoglobulin G, the same immunoglobulin G detection ability was shown to be equal or excellent when the same secondary immunoglobulin G enzyme conjugate and lipid body enzyme conjugate were treated.
- Target proteins are epithelial growth factor receptor (HER2), intracellular fine muscle microfiber ( ⁇ -actin), and phosphorylated kinase (phospho-ERK1 / 2) that are overexpressed in breast cancer cells.
- HER2 epithelial growth factor receptor
- ⁇ -actin intracellular fine muscle microfiber
- phospho-ERK1 / 2 phosphorylated kinase
- Target proteins are epithelial growth factor receptor (EGFR), Epithelial cell adhesion molecule (EpCAM), and HER2 that are overexpressed in cancer cells.
- EGFR epithelial growth factor receptor
- EpCAM Epithelial cell adhesion molecule
- HER2 epithelial cell adhesion molecule
- a polypeptide that specifically binds to a mouse or rabbit was selected and its immunoassay was determined.
- variable lymphocyte receptor (Variable) A library was constructed randomly containing the repeat module of the polypeptide to which the Leucine-rich repeat (LRR) protein portion of Lymphocyte Receptor (VLR) was fused.
- Polypeptide included in the library for the development of the lipid body binding to the rabbit immunoglobulin G is encoded by the polynucleotide sequence of SEQ ID NO: 1 or 75%, preferably 85%, more preferably with the polynucleotide sequence It may be encoded by a polynucleotide sequence having 90%, more preferably 95% or more homology.
- Polypeptide included in the library for the development of the lipid body binding to the mouse immunoglobulin G is encoded by the polynucleotide sequence of SEQ ID NO: 2 or 75%, preferably 85%, more preferably with the polynucleotide sequence It may be encoded by a polynucleotide sequence having 90%, more preferably 95% or more homology.
- the library may be in the form of a phagemid containing the polynucleotide.
- phagemid refers to a circular polynucleotide molecule derived from phage, which is a virus of Escherichia coli as a host, and includes a sequence of proteins and surface proteins necessary for propagation and propagation.
- Recombinant phagemids can be prepared using genetic recombination techniques well known in the art, and site-specific DNA cleavage and ligation can be performed using enzymes or the like generally known in the art.
- the phagemid may include a signal sequence or leader sequence for secretion in addition to expression control elements such as a promoter, an operator, an initiation codon, a termination codon, an enhancer, and mainly fused a desired protein with the surface protein of the phage to label the phage surface. It can be used for the method.
- the promoter of phagemid is mainly inducible and may include a selectable marker for selecting host cells.
- the phagemid comprises MalEss, DsbAss or PelBss, which is a signal sequence or leader sequence for expressing and secreting a polynucleotide encoding the polypeptide constituting the library, and expresses the recombinant protein on the surface of the phage.
- the sequence described in our prior patent (No. 10-2012-0019927) comprising a histidine-tag for identification and a polynucleotide encoding the gp3 domain, which is a type of surface protein of M13 phage for expression on the phage surface Polynucleotide of No. 2, but is not particularly limited thereto.
- the present inventors screened a novel polypeptide (SEQ ID NO: 3) in the form of a lipid body having excellent binding ability to immunoglobulin G in rabbits using a phage display method using a library corresponding to SEQ ID NO: 1 containing the phagemid.
- a novel polypeptide (SEQ ID NOS: 4 to 6) in the form of a lipid body having excellent binding ability to immunoglobulin G in mice was selected (Fig. 1 to 3).
- site-directed mutagenesis was performed to increase the binding ability of rabbits to immunoglobulin G.
- novel polypeptides SEQ ID NOs. 7 to 12
- a site-directed mutagenesis was performed to increase the binding ability of the mouse to immunoglobulin G.
- a novel polypeptide SEQ ID NOs. 13 to 15 having increased binding strength was selected and the binding ability was very high. It could be confirmed (FIGS. 1-4).
- the present invention relates to a repeat body represented by the amino acid sequence of any one of SEQ ID NOs: 3 and 7 to 12, and selectively binds to immunoglobulin G in rabbits.
- the present invention also relates to a lipidbody, represented by the amino acid sequence of any one of SEQ ID NOs: 4-6 and 13-15, which selectively binds to mouse immunoglobulin G.
- the term "Repebody” of the present invention refers to a polypeptide which is optimized based on the consensus design by fusion based on the similarity between the N-terminus and VLR structure of an internalin having an LRR structure.
- Lipibody proteins can be divided into concave and convex structural regions (FIGS. 1-2). The concave regions are known for their high degree of sequence diversity and important sites for protein interaction. Convex regions, on the other hand, play a role in keeping the overall structure of the protein stable based on highly conserved sequences.
- the lipid body protein may include all of the fusion LRR family proteins in which all proteins belonging to the LRR family having a repeat module are improved in water soluble expression and protein biophysical properties by the above method.
- VLR Variable Lymphocyte Receptor
- Polypeptides fused with the N-terminus and VLR protein of the internalin B protein have increased water solubility and expression than the VLR protein to which the internalin B protein is not fused, and thus can be used for the preparation of a novel protein therapeutic agent based thereon.
- LRR protein means a protein composed of a combination of modules in which leucine is repeated at a predetermined position, and (i) has one or more LRR repeating modules, and (ii) the LRR.
- the repeat module consists of 20 to 30 amino acids, and (iii) the LRR repeat module has "LxxLxxLxLxxN" in a conserved pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan Hydrophobic amino acids, such as N, asparagine, glutamine, serine, cysteine or threonine, x means any amino acid, (iv) LRR family protein means a protein having a three-dimensional structure, such as horseshoe.
- the LRR family protein of the present invention is a repeat module having a sequence known in nature or having a sequence unknown in nature through the design of a consensus design, etc., as well as found using a newly induced mRNA or cDNA in vivo. It may include all variants having a skeletal structure of.
- the term "internal B protein” is a type of LRR family protein expressed in Listeria strains, and has an N-terminal structure different from other LRR family proteins in which other hydrophobic cores are uniformly distributed throughout the molecule. It is known to have a stable expression in microorganisms.
- the N-terminus of these internalin proteins is stable in the microorganisms because the N-terminus, which is the most important for the folding of the repeat module, is not only derived from the microorganism but also has a stable shape in which its shape includes an alpha helix. Can be used effectively.
- N-terminus of an internalin protein refers to the N-terminus of an internalin protein necessary for water-soluble expression and folding of the protein, and refers to an alpha helical capping motif and a repeat module of an internalin protein. it means.
- the N-terminus of the internalin protein includes, without limitation, the N-terminus of the internalin protein necessary for water soluble expression and folding of the protein, and may include, for example, the alpha helical capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" and a repeat module.
- the repeat module pattern may include "LxxLxxLxLxxN".
- L in the repeating module pattern is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine or tryptophan; N means asparagine, glutamine, serine, cysteine or threonine, x means any hydrophilic amino acid.
- the N-terminus of the internalin protein can be selected as the N-terminus having high structural similarity according to the type of LRR family protein that can be fused, and the most stable amino acid can be selected through calculation of binding energy and the like. Variation is possible.
- immunoglobulin G of the present invention is a type of globulin protein having antibody activity contained in body fluids such as serum and accounts for about 70% of immunoglobulins.
- the molecular model is Y-shaped, two tops bind antigens, and the bottom (Fc part) allows antibodies that bind antigens to be biologically active by binding to complement or cells. It is involved in the neutralization, sedimentation and aggregation of toxins and viruses.
- the present invention a polynucleotide encoding the lipid body; It relates to a recombinant vector and a recombinant microorganism comprising the polynucleotide.
- the polynucleotide is not particularly limited thereto, and may be a polynucleotide encoding an amino acid sequence of any one of SEQ ID NOs: 3 to 15, 70% or more of the polynucleotide, and more preferably 80 It may be a polynucleotide having a nucleotide sequence having at least%, more preferably at least 90% homology, but is not particularly limited thereto.
- the term "vector” refers to a DNA preparation containing a nucleotide sequence of a polynucleotide encoding the target protein operably linked to a suitable regulatory sequence to allow expression of the target protein in a suitable host.
- the regulatory sequence includes a promoter capable of initiating transcription, any operator sequence for regulating such transcription, a sequence encoding a suitable mRNA ribosomal binding site, and a sequence regulating termination of transcription and translation.
- the vector used in the present invention is not particularly limited as long as it can be replicated in the host, and any vector known in the art may be used.
- Examples of commonly used vectors include natural or recombinant plasmids, phagemids, cosmids, viruses and bacteriophages.
- pWE15, M13, ⁇ MBL3, ⁇ MBL4, ⁇ IXII, ⁇ ASHII, ⁇ APII, ⁇ t10, ⁇ t11, Charon4A, and Charon21A can be used as the phage vector or cosmid vector
- pBR, pUC, and pBluescriptII systems are used as plasmid vectors.
- pGEM-based, pTZ-based, pCL-based and pET-based and the like can be used.
- the vector usable in the present invention is not particularly limited and known expression vectors can be used.
- pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a vector and the like can be used.
- pET-21a and pET-32a vectors can be used.
- the term "recombinant microorganism” refers to a cell in which a vector having a gene encoding at least one target protein is transfected into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells.
- bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium; Yeast cells; Fungal cells such as Pchia pastoris; Insect cells such as Drozophila and Spodoptera Sf9 cells; Animal cells such as CHO, COS, NSO, 293, bow melanoma cells; Or plant cells.
- the host cell usable in the present invention is not particularly limited, but Escherichia coli may be preferably used as the host cell. Most preferably E. coli BL21 (DE3), OrigamiB (DE3) can be used as the host cell.
- the term “transformation” means introducing a vector comprising a polynucleotide encoding a target protein into a host cell so that the protein encoded by the polynucleotide can be expressed in the host cell.
- Transformed polynucleotides include all of them, as long as they can be expressed in the host cell, whether inserted in the chromosome of the host cell or located outside the chromosome.
- the polynucleotide also includes DNA and RNA encoding the target protein.
- the polynucleotide may be introduced in any form as long as it can be introduced into and expressed in a host cell.
- the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct containing all elements necessary for self-expression.
- the expression cassette typically includes a promoter, transcription termination signal, ribosomal binding site and translation termination signal operably linked to the polynucleotide.
- the expression cassette may be in the form of an expression vector capable of self replication.
- the polynucleotide may be introduced into the host cell in its own form and operably linked with a sequence required for expression in the host cell.
- the present invention (i) culturing the recombinant microorganism to express the lipid body; And (ii) relates to a method for producing a lipid body comprising the step of recovering the expressed lipid body.
- the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, continuous culture method, fed-batch culture method, and the like, and the culture conditions are not particularly limited thereto.
- a basic compound e.g. sodium hydroxide, potassium hydroxide or ammonia
- an acidic compound e.g.
- Controllable, oxygen or oxygen-containing gas mixture can be introduced into the culture to maintain aerobic conditions, the incubation temperature can be maintained at 20 to 45 °C, preferably 25 to 40 °C, for about 10 to 160 hours It is preferable to incubate.
- the polypeptide produced by the culture may be secreted into the medium or remain in the cell.
- the culture medium used may include sugars and carbohydrates (e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose), fats and fats (e.g. soybean oil, sunflower seeds) as carbon sources.
- sugars and carbohydrates e.g. glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose
- fats and fats e.g. soybean oil, sunflower seeds
- Oils, peanut oils and coconut oils fatty acids (e.g. palmitic acid, stearic acid and linoleic acid), alcohols (e.g. glycerol and ethanol) and organic acids (e.g. acetic acid), etc.
- Nitrogen sources include nitrogen-containing organic compounds such as peptone, yeast extract, gravy, malt extract, corn steep liquor, soybean meal and urea, or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and Ammonium nitrate) and the like can be used individually or in combination;
- As a source of phosphorus, potassium dihydrogen phosphate, dipotassium hydrogen phosphate, a corresponding sodium-containing salt, and the like can be used individually or in combination;
- Other metal salts such as magnesium sulfate or iron sulfate, and essential growth-promoting substances such as amino acids and vitamins.
- the method for recovering the polypeptide produced in the culture step of the present invention is to recover the desired lipid body from the culture medium using a suitable method known in the art according to the culture method, for example, batch, continuous or fed-batch culture method. can do.
- the lipid body of the present invention when using the lipid body of the present invention, it was predicted that it can be used for various immunoassays and purification of immunoglobulin G in rats or rabbits.
- the present invention provides a method for treating a lipid body adsorbed on a lipid body according to the present invention, the method comprising the steps of: And (ii) relates to a method for purifying an immunoglobulin G antibody of a mouse or rabbit comprising eluting the antibody attached to the column of step (i).
- the beads to which the lipidi is attached may be packed in the column.
- the repeating body according to the present invention may be one of the amino acid sequences of SEQ ID NOs: 3 and 7 to 12 for rabbits, and one of the amino acid sequences of SEQ ID NOs: 4 to 6 and 13 to 15 for mice.
- the present invention provides a surface treatment step of (i) attaching the lipid body according to the present invention to a solid substrate; And (ii) immobilizing immunoglobulin G in rats or rabbits comprising binding the immunoglobulin G to the surface-treated solid substrate.
- the repeating body according to the present invention may be one of the amino acid sequences of SEQ ID NOs: 3 and 7 to 12 for rabbits, and one of the amino acid sequences of SEQ ID NOs: 4 to 6 and 13 to 15 for mice.
- the solid substrate is a group consisting of biodegradable organic polymer nanoparticles such as CM-5 Au sensor chip, magnetic microparticles, glass plate, gold nanoparticles, PLGA or various (micro) well plates.
- the one selected from can be used.
- the immunoglobulin G used in the present invention is preferably human, but is not limited thereto.
- the solid substrate may bind proteins to adjust the orientation, and increase the uniformity of the surface of the solid substrate.
- Immobilization method of immunoglobulin G using the lipid body of the present invention is physically and chemically stable compared to the method using an antibody-binding protein (protein A, protein G, protein A / G or protein L), and its use is very Not only can it be extensive, it can also be characterized as more economical than conventional methods using low molecular weight compounds or protein A.
- an antibody-binding protein protein A, protein G, protein A / G or protein L
- the present invention relates to an immunosensor in which immunoglobulin G of a rat or rabbit is immobilized on a solid substrate surface-treated with a lipid body according to the present invention.
- the present invention provides a method of treating a sample containing (a) processing a sample containing a substance having a binding ability to immunoglobulin G in rats or rabbits by the immunosensor; And (b) relates to a method for detecting a substance having a binding ability to the immunoglobulin G of rats or rabbits using the lipid body of the present invention comprising the step of confirming the binding of the immune sensor.
- the immunosensor can be obtained by immobilizing the immunoglobulin G to be detected after surface treatment with a lipid body according to the invention that specifically binds to the Fc region of immunoglobulin G on a solid substrate. Identification of binding using the antigen-antibody reaction using the immunosensor may vary depending on the type of solid substrate. For example, when the solid substrate is magnetic microparticles, the magnetic microparticles may be boiled in a buffer solution and then measured by PAGE method. In addition, when the solid substrate is a glass plate, it is possible to measure and measure fluorescence by treating fluorescently labeled immunoglobulin G to the lipidi.
- the visual detection method in which color development is observed by the enzymatic reaction or the spectroscopic detection method in which reflected light or transmitted light measures the change in absorbance and indirectly generated by the antigen-antibody reaction product It can also be detected by an electrochemical method of measuring current or potential.
- the present invention relates to a composition for ELISA of immunoglobulin G of a rat or rabbit, comprising the lipid body according to the present invention.
- ELISA compositions are used to perform detection or quantitative analysis of a target compound of interest using an antibody conjugated with an enzyme.
- Commercially available ELISA compositions generally have sandwich ELISA to improve sensitivity and specificity. It is prepared in the form of a composition for.
- the composition for sandwich ELISA includes two kinds of antibodies capable of binding to a target substance, one of which is bound to an immobilized substrate, and the other is used to perform color reaction by binding to an enzyme.
- a sample is added to an immobilized substrate to which an antibody is bound to bind an antigen present in the sample to an antibody bound to the substrate to form a substrate-antibody-antigen complex.
- the reaction is performed by adding another antibody bound to the enzyme that performs the color reaction to form a complex of substrate-antibody-antigen-antibody-enzyme, and reacting by adding a substrate developed by the enzyme, and confirming color development from the substrate.
- the target antigen target substance
- the complex of substrate-antibody-antigen-antibody-enzyme is not formed, so that the color reaction does not occur even when the substrate is added.
- the conventional ELISA composition an antibody in which HRP is directly bound cannot be used.
- HRP having a size of about 44 kDa is directly bound to an antibody of 100 to 200 kDa
- the structure of the antibody is changed due to HRP, thus functioning as a normal antibody. It can't be done. Therefore, the conventional ELISA composition is prepared to include an antibody in which HRP is bound indirectly using a HRP-bound secondary antibody or using a biotin-streptavidin linker, which has a disadvantage in that it is time and costly. .
- the ELISA composition of the present invention may use a lipid body of the form directly bonded to the HRP, the lipid body having a size of about 29 kDa is bound to the target material even when HRP having a relatively large size of 44 kDa is bound Because it is not affected. Therefore, the ELISA composition of the present invention is not only excellent in specificity and sensitivity, but also easy to manufacture, including a lipid body directly bonded to HRP.
- the present invention relates to a composition for Western blotting of immunoglobulin G, comprising a lipid body according to the present invention, in rats or rabbits.
- western blotting is a technique of finding a specific protein from various protein mixtures, and a molecular sieve made of acrylamide by mixing a protein extracted from cells or tissues with a sample buffer.
- electrophoresis causes a substance called sodium dodecylsulfate (SDS-page) in the sample buffer to charge the whole of the protein and bring the protein towards the positive.
- SDS-page sodium dodecylsulfate
- molecular sieves interfere with the progress of the protein, and small molecules move quickly and large molecules move slowly to form bands of various sizes.
- the membrane is placed on a gel separated according to the size and electricity is supplied. When spilled, the protein is transferred to the membrane in a separated state.
- the secondary antibody mainly uses an antibody against immunoglobulin G, but when used instead of the lipid body according to the present invention, it may have advantages of superior sensitivity and specificity, and easy to manufacture.
- the present invention relates to a composition for immunochemical staining of immunoglobulin G in a rat or rabbit, comprising a lipid body according to the present invention to which a fluorescent substance is bound.
- immunochemical staining involves attaching a primary antibody to an antigen and then attaching a secondary antibody directly attached to the enzyme and reacting the substrate solution of the enzyme for color development, or reacting a secondary antibody with biotin, followed by strong biotin. It refers to a method of observing the presence of the original antigen under a microscope by reacting avidin, which has a property of adhering to avidin, with a reagent attached to the enzyme (ABC method) and then reacting the substrate solution with the enzyme to develop color. In this method, the final color development depends on various factors that determine the degree of reaction of the enzyme, and in particular, the ABC method, which is the most commonly used method, stains through several steps.
- the fluorescent material may be a fluorescent dye, a tetracysteine fluorescent motif (tetracystein motif) fluorescent protein, fluorescent nanoparticles or quantum dot (quantum dot), but is not limited thereto.
- Example 1 Library construction for immunoglobulin G-specific binding lipido screening of mice and rabbits using phage display
- Phage display was performed using the library phage already constructed in the prior patent (No. 10-2012-0019927) for screening for lipidi specifically binding to rabbit immunoglobulin G (FIG. 1). It is located in the carboxyl terminal direction based on the polypeptide sequence of the lipid body binding to human immunoglobulin G developed in the prior patent (No. 10-2013-0081009) for screening the lipid body specifically binding to mouse immunoglobulin G.
- Six amino acid residues 240, 241, 242, 243, 244 and 255 were selected ( Figure 2).
- 1 and 2 are schematic diagrams showing the overall structure of amino acid residues for which a random library is to be constructed.
- Mutagenic primers for library construction were synthesized to replace the selected amino acids with NNK degenerate codons.
- the obtained library was introduced into E. coli XL1-Blue by electroporation to obtain a transformant, thereby constructing a library having a diversity of 1.0 ⁇ 10 8 level.
- polypeptides capable of binding to immunoglobulin G in rats and rabbits were selected and purified.
- immunoglobulin G in rats or rabbits was added to the immunotube at a concentration of 30 ⁇ g / ml and coated at 4 ° C. for 12 hours. It was.
- the coated immunotubes were washed once with PBS and blocked with PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 for 2 hours at 4 ° C.
- the purified phages were then added to the coated immunotubes at a concentration of 10 12 cfu / ml and allowed to react at room temperature for 2 hours.
- Phage selected by the method of Example 2 was performed using a 96-well plate coated with immunoglobulin G and BSA of rats and rabbits.
- 41 lipidobody candidates having a higher absorbance (OD 450 ) of rabbit immunoglobulin G than BSA 10 times or more compared with BSA were selected for screening of lipobodies that bind to rabbit immunoglobulin G, and their respective amino acid sequences were identified.
- one kind of lipid body sequence having the same sequence was identified (SEQ ID NO: 3).
- the signal detection and cross-reaction by nonspecific binding which was a disadvantage of the existing secondary immunoglobulin G, were confirmed by Fluorescence ELISA.
- Human, rat, and rabbit immunoglobulin G was coated on a 96-well plate at 30 ⁇ g / ml and stored at 4 ° C. for 10 hours. Then washed once with PBS solution (TPBS) containing 0.05% Tween 20.
- F4-FITC showed fluorescence values only in human immunoglobulin G, A6-FITC only in rat immunoglobulin G, and E2-FITC only in rabbit immunoglobulin G. It was confirmed (FIG. 5). This suggests that the selected Lipibodi overcomes the detection limit by the nonspecific reaction and cross-reaction of the existing secondary immunoglobulin G and specifically binds only to immunoglobulin G of each animal species and that it is possible to replace the existing secondary immunoglobulin G. it means.
- the selected Lipibody was applied to the actual ELISA, and the experiment was performed to compare the target protein detection ability when treated under the same conditions as the existing secondary immunoglobulin G.
- the lipid body enzyme conjugate Prior to the experiment of binding the enzyme to the lipid body as a marker for detection, the lipid body enzyme conjugate (repebody-HRP) was produced, and the binder efficiency was obtained at a yield of 90% or more.
- immunoglobulin G in humans, rats, and rabbits was coated in 96-well plates at various concentration ranges of 0 to 2 ⁇ g / ml and stored at 4 ° C. for 10 hours. Then washed once with PBS solution (TPBS) containing 0.05% Tween 20.
- TPBS PBS solution
- F4-HRP, A6-HRP, E2-HRP and existing secondary immunoglobulin G-HRP were treated to the coated plates at 0.2 ⁇ g / ml. After the reaction at room temperature for 1 hour and washed three times with TPBS and treated with HRP substrate Tetramethylbenzidine (TMB) for 20 minutes, the fluorescence value was measured at 450nm wavelength by treatment with sulfuric acid to stop the reaction.
- TMB Tetramethylbenzidine
- A6-HRP that binds to immunoglobulin G in rats was confirmed.
- 20 ⁇ g of cell lysates were separated by protein size through SDS-PAGE.
- the primary rat immunoglobulin G which binds specifically to actin, was treated with 0.2 ⁇ g / ml of anti- ⁇ -actin mouse IgG. After 1 hour reaction at room temperature it was washed three times with TPBS.
- Example 8 Verification of utility in the immunocytochemistry of selected lipid bodies
- Target protein detection and cell imaging of repeat body quantum dot conjugates through immunochemical staining (Immunocytochemistry).
- Target proteins are epithelial growth factor receptor (EGFR), Epithelial cell adhesion molecule (EpCAM), and HER2 that are overexpressed in cancer cells.
- EGFR epithelial growth factor receptor
- EpCAM Epithelial cell adhesion molecule
- HER2 epithelial cell adhesion molecule
- F4-QD, A6-QD, and E2-QD a conjugate was prepared by introducing an NHS / EDC linker that combines a QD with a carboxyl group and a primary amine group of Lipibody. The binder yield was 99% to obtain the binder with very high efficiency. At this time, QD was used to emit green in the wavelength band of 525 nm.
- the animal cells in the cell culture solution were incubated for 48 hours in an 8-well cell culture chamber and attached to the surface, followed by 2 ⁇ g of Cetuximab, anti, a primary immunoglobulin G that specifically binds to a target protein.
- -EpCAM mouse IgG, anti-HER2 rabbit IgG was treated for 1 hour at 4 degrees after treatment.
- 20 nM of F4-QD, A6-QD, E2-QD were combined for 1 hour at 4 degrees after treatment.
- DAPI solution was dropped for nuclear staining and slide glass attachment.
- Lipibodies identified in Examples 5 to 8 overcome the disadvantages of non-specific reaction of the existing secondary immunoglobulin G, limit of detection due to cross reaction, and high production cost, and binding to the target protein is specific. It is a novel and innovative protein that can significantly reduce the cost of production to one tenth of the existing secondary immunoglobulin G in that the cross reaction is remarkably low and mass production is possible in E. coli. Its use means that it can be used for the production of targeted oriented DDS transporters and biological drugs for immune sensor / immune chip and drug delivery by showing sufficient target protein detection ability when applied to various immunoassays.
- novel polypeptides according to the invention specifically bind to immunoglobulin G in each of rats or rabbits, replace existing expensive secondary immunoglobulin G and can be used in various biological immunoassays, as well as the polypeptides and immunity of the invention Hybrids of globulin G are useful for various immune sensor / immune chip fabrication and drug screening.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Zoology (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Plant Pathology (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Peptides Or Proteins (AREA)
Abstract
본 발명은 쥐 또는 토끼의 면역글로불린 G에 선택적으로 결합하는 신규한 폴리펩티드에 관한 것으로, 보다 구체적으로 본 발명은 쥐 또는 토끼의 면역글로불린 G에 결합하는 폴리펩티드, 상기 폴리펩티드를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현벡터, 상기 발현벡터가 도입된 형질전환체 및 상기 형질전환체를 이용하여 상기 폴리펩티드를 생산하는 방법 및 상기 폴리펩티드를 포함하는 면역분석용 조성물에 관한 것이다. 본 발명에 따른 신규한 폴리펩티드는 쥐 또는 토끼 각각의 면역글로불린 G에 특이적으로 결합하고 기존의 값비싼 이차 면역글로불린 G를 대체하며 다양한 생물학적 면역분석법에 사용될 수 있을 뿐만 아니라, 본 발명의 폴리펩티드와 면역글로불린 G의 혼성체를 이용하여 다양한 면역 센서/면역 칩 제작 및 약물 스크리닝에 유용하다.
Description
본 발명은 쥐 또는 토끼의 면역글로불린 G에 선택적으로 결합하는 신규한 폴리펩티드에 관한 것으로, 보다 구체적으로 본 발명은 쥐 또는 토끼의 면역글로불린 G에 결합하는 폴리펩티드, 상기 폴리펩티드를 생산하는 방법 및 상기 폴리펩티드를 포함하는 면역분석용 조성물에 관한 것이다.
면역글로불린은 바이러스나 박테리아 등의 외부 항원을 중화시키는 항체의 기능을 담당하는 당단백질로 혈액이나 조직액에 들어있다. 면역글로불린 G는 면역글로불린 중 가장 많이 존재하며 외부물질과의 결합으로 면역 반응을 불러일으킴으로써 신체를 보호하는 중요한 물질이다.
면역글로불린 G와 외부물질간의 결합을 면역반응이라고 하며 이러한 특성을 이용하여 특정 항원을 인식하는 일차 면역글로불린 G의 생산 및 일차 면역글로불린 G에 결합하는 이차 면역글로불린 G를 동물 종으로 가장 많이 사용되는 쥐 또는 토끼의 면역학적 반응을 통해 생산하여 생물학적 면역분석법에 활용되고 있다.
그러나 일차 면역글로불린 G에 결합하는 이차 면역글로불린 G의 제작에 있어 실험동물의 사용, 하이브리도마 제작 및 배양에 필요한 경제적, 시간적 문제점이 있다. 또한 신호 검출을 위한 효소 및 형광 표지자를 화학적 반응을 통해 결합해야하는 후처리 과정이 필요하다. 이 과정에서 이차 면역글로불린 G 구조의 불안정성에 의한 최종 산물의 효율이 감소되는 문제점이 있다. 그리고 이차 면역글로불린 G의 비특이적 반응성 및 교차반응에 의한 검출 한계가 나타나고 있다.
이러한 배경 하에, 본 발명자들은 리피바디 (repebody)라는 단백질을 이용하여 기존의 이차 면역글로불린 G를 대체할 수 있는 새로운 폴리펩티드를 설계하였다. 상기 리피바디는 LRR (Leucin-rich repeat)의 구조를 갖는 인터날린 B의 N-말단과 VLR의 구조의 유사성을 바탕으로 융합하여 컨센시스 디자인으로 최적화시킨 폴리펩티드를 의미한다. 리피바디는 크기가 항체의 1/5 수준이고 대장균에서 대량생산이 가능하여 생산 단가를 낮출 수 있고, 열 및 pH 안정성이 매우 우수하여 산업적인 사용에 큰 장점을 가지고 있다. 또한 표적 물질에 대한 결합력을 pico-mole 수준까지 매우 용이하게 증대시킬 수 있으며 표적 물질에 대한 특이성이 매우 탁월함을 입증한 바가 있다.
본 발명자들은 대한민국 특허 제10-2013-0081009호에서 사람 면역글로불린 G에 대해 특이적으로 결합하는 리피바디를 개발한 바 있다. 하지만, 상기 특허에서 개발한 리피바디는 사람 면역글로불린 G에만 특이성이 있어, 일반적인 생물학적 면역분석법에 활용되는 이차면역글로불린으로 사용되는 쥐 또는 토끼의 면역글로불린G에는 결합하지 않는 단점이 있었다.
이에, 본 발명자들은 상기 문제점들을 해결하고, 쥐 또는 토끼의 면역글로불린 G에 특이적인 결합 단백질 (Specific protein binder)을 개발하기 위해, 예의 노력한 결과, 리피바디를 이용하여 돌연변이 라이브러리를 제작하고, 모듈 기반 결합력 증대를 통해 쥐 또는 토끼의 면역글로불린 G에 특이적인 결합력을 갖는 신규한 폴리펩티드를 선별할 경우, 선별된 리피바디가 다양한 면역분석법에서 기존의 이차면역글로불린G에 비하여 탁월한 효과를 발휘한다는 것을 확인하고, 본 발명을 완성하게 되었다.
발명의 요약
본 발명의 목적은 쥐 또는 토끼의 면역글로불린 G에 특이적으로 결합하는 리피바디(Repebody); 상기 리피바디를 코딩하는 폴리뉴클레오티드; 상기 폴리뉴클레오티드를 포함하는 발현벡터; 상기 발현벡터가 도입된 재조합 미생물; 및 상기 재조합 미생물를 이용해 상기 리피바디를 생산하는 방법을 제공하는데 있다.
본 발명의 다른 목적은 상기 리피바디를 이용하여 쥐 또는 토끼의 면역글로불린 G를 고정 또는 정제하는 방법을 제공하는데 있다.
본 발명의 또다른 목적은 상기 리피바디를 함유하는 면역분석용 조성물을 제공하는데 있다.
상기 목적을 달성하기 위하여, 본 발명은 서열번호 3 및 7 내지 12 중 어느 하나의 아미노산 서열로 표시되고, 토끼의 면역글로불린 G에 선택적으로 결합하는 리피바디(repebody)를 제공한다.
본 발명은 또한, 상기 리피바디를 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오티드 또는 상기 재조합 벡터가 도입되어 있는 재조합 미생물을 제공한다.
본 발명은 또한, (i) 상기 재조합 미생물을 배양하여 리피바디를 발현시키는 단계; 및 (ii) 상기 발현된 리피바디를 회수하는 단계를 포함하는, 상기 리피바디의 제조방법을 제공한다.
본 발명은 또한, (i) 상기 리피바디를 흡착시킨 컬럼에 토끼의 면역글로불린 G 항체를 함유하는 혼합물을 처리하는 단계; 및 (ii) 상기 단계 (i)의 컬럼에 부착된 항체를 용출하는 단계를 포함하는 토끼의 면역글로불린 G 항체의 정제방법을 제공한다.
본 발명은 또한, (i) 상기 리피바디를 고체기판에 부착하는 표면처리 단계; 및 (ii) 상기 표면처리된 고체기판에 면역글로불린 G를 결합시키는 단계를 포함하는 토끼의 면역글로불린 G의 고정화 방법을 제공한다.
본 발명은 또한, 상기 리피바디로 표면처리된 고체기판에 상기 리피바디를 매개로 토끼의 면역글로불린 G가 고정된 면역센서를 제공한다.
본 발명은 또한, (a) 상기 면역센서에 토끼의 면역글로불린 G에 대한 결합능을 갖는 물질을 함유하는 시료를 처리하는 단계; 및 (b) 상기 면역센서의 결합유무를 확인하는 단계를 포함하는 상기 리피바디를 이용한 토끼의 면역글로불린 G에 대한 결합능을 가지는 물질을 검출하는 방법을 제공한다.
본 발명은 또한, 상기 리피바디를 포함하고, 토끼의 면역글로불린 G의 ELISA용 조성물; 웨스턴 블로팅용 조성물; 및 면역화학염색용 조성물을 제공한다.
본 발명은 서열번호 4 내지 6 및 13 내지 15 중 어느 하나의 아미노산 서열로 표시되고, 쥐의 면역글로불린 G에 선택적으로 결합하는 리피바디(repebody)를 제공한다.
본 발명은 또한, 상기 리피바디를 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명은 또한, 상기 상기 리피바디를 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오티드 또는 상기 재조합 벡터가 도입되어 있는 재조합 미생물을 제공한다.
본 발명은 또한, (i) 상기 재조합 미생물을 배양하여 리피바디를 발현시키는 단계; 및 (ii) 상기 발현된 리피바디를 회수하는 단계를 포함하는, 상기 리피바디의 제조방법을 제공한다.
본 발명은 또한, (i) 상기 리피바디를 흡착시킨 컬럼에 쥐의 면역글로불린 G 항체를 함유하는 혼합물을 처리하는 단계; 및 (ii) 상기 단계 (i)의 컬럼에 부착된 항체를 용출하는 단계를 포함하는 쥐의 면역글로불린 G 항체의 정제방법을 제공한다.
본 발명은 또한, (i) 상기 리피바디를 고체기판에 부착하는 표면처리 단계; 및 (ii) 상기 표면처리된 고체기판에 면역글로불린 G를 결합시키는 단계를 포함하는 쥐의 면역글로불린 G의 고정화 방법을 제공한다.
본 발명은 또한, 상기 리피바디로 표면처리된 고체기판에 상기 리피바디를 매개로 쥐의 면역글로불린 G가 고정된 면역센서를 제공한다.
본 발명은 또한, (a) 상기 면역센서에 쥐의 면역글로불린 G에 대한 결합능을 갖는 물질을 함유하는 시료를 처리하는 단계; 및 (b) 상기 면역센서의 결합유무를 확인하는 단계를 포함하는 상기 리피바디를 이용한 쥐의 면역글로불린 G에 대한 결합능을 가지는 물질을 검출하는 방법을 제공한다.
본 발명은 또한, 상기 리피바디를 포함하고, 쥐의 면역글로불린 G의 ELISA용 조성물; 웨스턴 블로팅용 조성물; 및 면역화학염색용 조성물을 제공한다.
도 1은 본 발명에서 토끼의 면역글로불린 G에 결합하는 리피바디 개발을 위해 무작위적인 라이브러리를 구축한 아미노산 잔기들을 표시한 전체 구조를 나타내는 개략도이다.
도 2는 본 발명에서 쥐의 면역글로불린 G에 결합하는 리피바디 개발을 위해 무작위적인 라이브러리를 구축한 아미노산 잔기들을 표시한 전체 구조를 나타내는 개략도이다.
도 3은 본 발명에서 구축한 파지 라이브러리를 이용하여 토끼의 면역글로불린 G에 대한 파지 디스플레이 바이오 패닝을 수행 후 최종적으로 선별된 리피바디 클론의 결합력을 등온 적정 열량측정법 (Isothermal titration calorimetry, ITC)으로 측정한 결과이다.
도 4는 본 발명에서 구축한 파지 라이브러리를 이용하여 쥐의 면역글로불린 G에 대한 파지 디스플레이 바이오 패닝을 수행 후 최종적으로 선별된 리피바디 클론의 결합력을 등온 적정 열량측정법 (Isothermal titration calorimetry, ITC)으로 측정한 결과이다.
도 5는 ELISA fluorescence를 통해 사람, 쥐, 토끼의 면역글로불린 G에 대해 가장 높은 결합력을 가지는 리피바디 클론들의 특이적인 결합여부를 확인한 결과이다. 본 발명자의 선행 특허(제 10-2013-0081009)에서 개발된 사람 면역글로불린 G에 특이적으로 결합하는 리피바디의 특이성 또한 함께 확인되었다. 모든 클론이 BSA에는 결합하지 않고 각각의 면역글로불린 G에 대해서는 특이적으로 결합함을 확인할 수 있다.
도 6은 ELISA를 통해 기존 이차 면역글로불린 G 효소 결합체와 리피바디 효소 결합체의 표적 단백질 검출 능력을 비교한 결과이다. 면역글로불린 G의 다양한 농도 구간에서 같은 질량의 기존 이차 면역글로불린 G 효소 결합체와 리피바디 효소 결합체를 처리하였을 때 면역글로불린 G 검출 능력이 동등하거나 우수한 결과를 보여줌을 알 수 있다.
도 7은 Western blot을 통해 리피바디 효소 결합체의 표적 단백질 검출 능력을 확인한 결과이다. 표적 단백질은 유방암 세포에서 과발현 되는 상피세포성장인자 수용체 (HER2), 세포 내 가는근육미세섬유 (β-actin), 인산화 키나아제 (phospho-ERK1/2)이다. 다양한 동물 세포 종류의 세포 용해 후 여러 가지 단백질이 섞여 있는 세포 용해물 중 표적 단백질만 인지하는 일차 면역글로불린 G를 선 처리 한 후 일차 면역글로불린 G에 결합하는 리피바디 효소 결합체를 처리하였을 때 표적 단백질만을 특이적으로 검출해내는 것을 알 수 있다.
도 8은 면역화학염색법(Immunocytochemistry)을 통해 리피바디 양자점 (quantum dot) 결합체의 표적 단백질 검출 및 이미징을 확인한 결과이다. 표적 단백질은 암세포에서 과발현 되는 상피세포성장인자 수용체 (EGFR), Epithelial cell adhesion molecule (EpCAM), HER2이다. 표적 단백질에 특이적으로 결합하는 일차 면역글로불린 G의 처리 후 리피바디 양자점 결합체의 형광 신호를 검출 한 결과 일차 면역글로불린 G를 처리한 군에서만 형광 신호가 검출됨을 알 수 있다.
발명의 상세한 설명 및 바람직한
구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법 및 이하에 기술하는 실험 방법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 쥐 또는 토끼에 특이적으로 결합하는 폴리펩티드를 선별하고, 이의 면역분석학적 활용도를 확인하고자 하였다.
본 발명에서는, 리피바디 개발을 위한 라이브러리에 포함된 폴리펩티드를 쥐 또는 토끼의 면역글로불린 G의 파지미드를 이용한 바이오패닝을 통해 특이적으로 결합하는 폴리펩티드의 선별을 수행하고, 이들의 결합력을 개선하는 작업을 수행하였다. 그 결과 쥐 또는 토끼의 면역글로불린 G에 특이적인 폴리펩티드를 제조하였다.
즉, 본 발명의 일 실시예에서는 쥐 또는 토끼의 면역글로불린 G와 특이적으로 결합할 수 있는 신규한 폴리펩티드를 개발하기 위하여, 인터날린 B (Internalin B) 단백질의 N-말단, 가변 림프구 수용체(Variable Lymphocyte Receptor, VLR) 의 LRR (Leucine-rich repeat) 단백질 부분이 융합된, 폴리펩티드의 반복 모듈을 무작위적으로 포함하는 라이브러리를 구축하였다. 상기 토끼의 면역글로불린 G에 결합하는 리피바디 개발을 위한 라이브러리에 포함된 폴리펩티드는 서열번호 1의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 해당 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다. 상기 쥐의 면역글로불린 G에 결합하는 리피바디 개발을 위한 라이브러리에 포함된 폴리펩티드는 서열번호 2의 폴리뉴클레오티드 서열에 의하여 코딩되거나 또는 해당 폴리뉴클레오티드 서열과 75%, 바람직하게는 85%, 보다 바람직하게는 90%, 더욱 바람직하게는 95% 이상의 상동성을 갖는 폴리뉴클레오티드 서열에 의하여 코딩될 수 있다.
또한, 상기 라이브러리는 상기 폴리뉴클레오티드를 포함하는 파지미드의 형태가 될 수 있다. 본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로부터 유래된 원형의 폴리뉴클레오티드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들의 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호 서열 또는 리더 서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주 세포를 선택하기 위한 선택성 마커를 포함할 수도 있다. 본 발명의 목적상 상기 파지미드는 상기 라이브러리를 구성하는 폴리펩티드를 코딩하는 폴리뉴클레오티드를 발현 및 분비하기 위한 신호 서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지의 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면으로의 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오티드를 포함하는 본 발명자의 선행 특허 (제10-2012-0019927호)에 기술된 서열번호 2의 폴리뉴클레오티드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명자들은 상기 파지미드를 포함하는 서열번호 1에 해당하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 토끼의 면역글로불린 G에 대한 결합력이 우수한 리피바디 형태의 신규한 폴리펩티드(서열번호 3)를 선별하였다. 상기 파지미드를 포함하는 서열번호 2에 해당하는 라이브러리를 이용한 파지 디스플레이 방법을 사용하여 쥐의 면역글로불린 G에 대한 결합력이 우수한 리피바디 형태의 신규한 폴리펩티드(서열번호 4 내지 6)를 선별하였다(도 1 내지 3).
이후, 토끼의 면역글로불린 G에 대한 결합력을 증대시키기 위하여 위치지정 돌연변이(site directed mutagenesis)를 수행한 결과 결합력이 증대된 신규한 폴리펩티드(서열번호 7 내지 12)를 선별하였다. 또한, 쥐의 면역글로불린 G에 대한 결합력을 증대시키기 위하여 위치지정 돌연변이(site directed mutagenesis)를 수행한 결과 결합력이 증대된 신규한 폴리펩티드(서열번호 13 내지 15)를 선별하여, 그 결합력이 매우 높은 것을 확인할 수 있었다(도 1 내지 도 4).
따라서, 본 발명은 일 관점에서, 서열번호 3 및 7 내지 12 중 어느 하나의 아미노산 서열로 표시되고, 토끼의 면역글로불린 G에 선택적으로 결합하는 리피바디(repebody)에 관한 것이다.
본 발명은 또한 서열번호 4 내지 6 및 13 내지 15 중 어느 하나의 아미노산 서열로 표시되고, 쥐의 면역글로불린 G에 선택적으로 결합하는 리피바디(repebody)에 관한 것이다.
본 발명의 용어 "리피바디(Repebody)"란, LRR 구조를 갖는 인터날린의 N-말단과 VLR 구조의 유사성을 바탕으로 융합하여 컨센서스 디자인으로 최적화시킨 폴리펩티드이다. 리피바디 단백질은 구조상 오목한 지역(concave)과 볼록한 지역(convex)으로 나누어 질 수 있다 (도 1 내지 도 2). 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상 시킨 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명의 용어 "가변 림프구 수용체(Variable Lymphocyte Receptor, VLR)"란, 먹장어와 칠성장어에서 발현되는 LRR 패밀리 단백질의 일종을 의미하는데, 먹장어와 칠성장어에서 발현되는 면역 기능 단백질로 다양한 항원 물질에 결합할 수 있는 골격으로 유용하게 사용될 수 있다. 상기 인터날린 B 단백질의 N-말단 및 VLR 단백질이 융합된 폴리펩티드는 인터날린 B 단백질이 융합되지 않은 VLR 단백질보다 수용성 및 발현양이 증가하므로, 이를 기반으로 한 신규 단백질 치료제 제조에 사용될 수 있다.
본 발명에서 용어 "LRR(Leucine Rich Repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌을, x는 임의의 아미노산을 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖고 있는 단백질을 의미한다. 본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체 내에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것과 더불어 컨센서스 디자인(consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명에서 용어 "인터날린 B 단백질"이란, 리스테리아(Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종으로, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 상이한 N-말단 구조를 가지고 있어 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘(folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐만 아니라 그 형태가 알파 나선을 포함하는 안정적인 모양을 가졌기에 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명에서 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프(capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 제한 없이 포함하며, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" 및 반복 모듈을 포함할 수 있다. 또한 반복 모듈 패턴은 "LxxLxxLxLxxN"을 포함할 수 있다. 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 임의의 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어, "면역글로불린 G (IgG)"는 혈청 등의 체액 중에 함유되는 항체활성을 갖는 글로불린 단백질의 한 종류로 면역글로불린의 약 70%를 차지하고 있다. 분자량은 약 160,000인 당단백질로서, 분자모형은 Y자형이고 2개의 상단이 항원과 결합하고 하단 (Fc 부분)은 항원과 결합하는 항체가 보체나 세포와 결합하여 생물활성을 가지도록 하며 전반적인 면역반응에 관여하여 독소나 바이러스의 중화, 침강, 응집반응이 일어나도록 한다.
본 발명은 다른 관점에서, 상기 리피바디를 코딩하는 폴리뉴클레오티드; 상기 폴리뉴클레오티드를 포함하는 재조합 벡터 및 재조합 미생물에 관한 것이다.
본 발명에 있어서, 상기 폴리뉴클레오티드는 특별히 이에 제한되지 않으나, 상기 서열번호 3 내지 15 중 어느 하나의 아미노산 서열을 코딩하는 폴리뉴클레오티드가 될 수 있고, 상기 폴리뉴클레오티드와 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상의 상동성을 가지는 염기 서열을 가지는 폴리뉴클레오티드일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명의 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오티드의 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, λMBL3, λMBL4, λIXII, λASHII, λAPII, λt10, λt11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a 벡터를 사용할 수 있다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물 세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니나, 바람직하게는 대장균을 숙주 세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주 세포로 사용할 수 있다.
본 발명에서 용어 "형질전환"이란, 표적 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 벡터를 숙주 세포 내에 도입하여 숙주 세포 내에서 상기 폴리뉴클레오티드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 형질 전환된 폴리뉴클레오티드는 숙주 세포 내에 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오티드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오티드는 숙주 세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오티드는, 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (Expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오티드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오티드는 그 자체의 형태로 숙주세포에 도입되어, 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다.
본 발명은 또 다른 관점에서, (i) 상기 재조합 미생물을 배양하여 리피바디를 발현시키는 단계; 및 (ii) 상기 발현된 리피바디를 회수하는 단계를 포함하는 리피바디의 생산 방법에 관한 것이다.
상기 방법에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45℃, 바람직하게는 25 내지 40℃를 유지할 수 있고, 약 10 내지 160 시간동안 배양함이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩티드는 배지중으로 분비되거나 세포내에 잔류할 수 있다.
아울러, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예: 팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예: 아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명의 상기 배양 단계에서 생산된 폴리펩티드를 회수하는 방법은 배양방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 배양액으로부터 목적하는 리피바디를 회수할 수 있다.
한편, 본 발명의 리피바디를 이용할 경우, 다양한 면역분석법 및 쥐 또는 토끼의 면역글로불린 G의 정제에 활용될 수 있을 것으로 예측하였다.
본 발명의 다른 실시예에서는 본 발명의 리피바디-효소 결합체 또는 리피바디-양자점 결합체 제조한 후, 이를 면역분석법에 활용한 결과, 기존의 이차 면역글로불린 G-효소 복합체 또는 이차 면역글로불린 G-양자점 결합체 보다 탁월하게 뛰어난 정확도 및 민감도를 나타내는 것을 확인할 수 있었다(도 5 내지 도 8).
따라서, 본 발명은 또 다른 관점에서, (i) 본 발명에 따른 리피바디를 흡착시킨 컬럼에 쥐 또는 토끼의 면역글로불린 G 항체를 함유하는 혼합물을 처리하는 단계; 및 (ii) 상기 단계 (i)의 컬럼에 부착된 항체를 용출하는 단계를 포함하는 쥐 또는 토끼의 면역글로불린 G 항체의 정제방법에 관한 것이다.
이때, 단계 (i)에서 리피바디를 컬럼에 직접적으로 흡착시키는 대신에, 리피바디가 부착된 비드를 컬럼에 패킹할 수도 있다. 상기 본 발명에 따른 리피바디는 토끼의 경우에는 서열번호 3 및 7 내지 12의 아미노산 서열 중 하나일 수 있고, 쥐의 경우에는 서열번호 4 내지 6 및 13 내지 15의 아미노산 서열 중 하나 일 수 있다.
본 발명은 또 다른 관점에서, (i) 본 발명에 따른 리피바디를 고체기판에 부착하는 표면처리 단계; 및 (ii) 상기 표면처리된 고체기판에 면역글로불린 G를 결합시키는 단계를 포함하는 쥐 또는 토끼의 면역글로불린 G의 고정화 방법에 관한 것이다. 상기 본 발명에 따른 리피바디는 토끼의 경우에는 서열번호 3 및 7 내지 12의 아미노산 서열 중 하나일 수 있고, 쥐의 경우에는 서열번호 4 내지 6 및 13 내지 15의 아미노산 서열 중 하나 일 수 있다.
상기 방법에 있어서, 고체기판은 CM-5 Au 센서 칩, 자성미세입자, 유리판, 금나노입자, PLGA 등 생분해성 유기 고분자나노입자 또는 각종 (미세)웰플레이트[(micro)well plate]으로 구성된 군으로부터 선택된 것을 사용할 수 있다. 본 발명에서 사용되는 면역글로불린 G는 인간인 것이 바람직하나 이에 한정되지 않는다. 상기 (i) 단계에서의 표면처리에 의하여 고체기판은 배향성이 조절되도록 단백질을 결합할 수 있으며, 고체기판 표면의 균일성을 증가시킬 수 있다. 본 발명의 리피바디를 이용한 면역글로불린 G의 고정화 방법은 기존의 항체결합 단백질(단백질A, 단백질G, 단백질A/G 또는 단백질 L)을 사용한 방법에 비해 물리·화학적으로 안정하며, 그 용도가 매우 광범위할 수 있을 뿐만 아니라, 또한 기존의 저분자 화합물 또는 protein A를 사용한 방법에 비해 경제적임을 그 특징으로 할 수 있다.
본 발명은 또 다른 관점에서, 본 발명에 따른 리피바디로 표면처리된 고체기판에 상기 리피바디를 매개로 쥐 또는 토끼의 면역글로불린 G가 고정된 면역센서에 관한 것이다.
본 발명은 또 다른 관점에서, (a) 상기 면역센서에 쥐 또는 토끼의 면역글로불린 G에 대한 결합능을 갖는 물질을 함유하는 시료를 처리하는 단계; 및 (b) 상기 면역센서의 결합유무를 확인하는 단계를 포함하는 본 발명의 리피바디를 이용하여 쥐 또는 토끼의 면역글로불린 G에 대한 결합능을 가지는 물질을 검출하는 방법에 관한 것이다.
본 발명에 있어서, 상기 면역센서는 고체기판에 면역글로불린 G의 Fc 부위에 특이적으로 결합하는 본 발명에 따른 리피바디로 표면처리한 후 검출하고자 하는 면역글로불린 G를 고정화함으로써 수득할 수 있다. 상기 면역센서를 이용한 항원-항체 반응을 이용한 결합유무의 확인은 고체기판의 종류에 따라 달라질 수 있다. 예컨대, 상기 고체기판이 자성미세입자인 경우 상기 자성미세입자 자체를 완충용액에서 끓인 후, PAGE 방법으로 측정할 수 있다. 아울러, 상기 고체기판이 유리판인 경우 형광 표지된 면역글로불린 G를 리피바디에 처리함으로써 형광을 측정하여 측정할 수 있다. 또한, 효소-면역글로불린 G 복합체를 처리하여, 효소 반응에 의해 색의 전개가 관찰되는 육안 검출법 또는 반사광 또는 투과광이 흡광도의 변화를 측정하는 분광학적 검출법 및 항원-항체 반응 생성물에 의해 간접적으로 발생된 전류 또는 전위를 측정하는 전기화학적 방법으로도 검출할 수 있다.
본 발명은 또 다른 관점에서, 본 발명에 따른 리피바디를 포함하고, 쥐 또는 토끼의 면역글로불린 G의 ELISA용 조성물에 관한 것이다.
일반적으로, ELISA용 조성물은 효소와 결합된 항체를 이용하여 목적하는 표적물질의 검출 또는 정량분석을 수행하기 위하여 사용되는데, 상업적으로 판매되는 ELISA용 조성물은 민감도 및 특이도를 향상시키기 위하여 대체로 샌드위치 ELISA용 조성물의 형태로 제조된다. 상기 샌드위치 ELISA용 조성물은 표적물질에 결합할 수 있는 두 종류의 항체를 포함하는데, 하나는 고정화기판에 결합된 형태이고, 다른 하나는 효소와 결합되어 발색반응을 수행하기 위하여 사용된다.
상기 샌드위치 ELISA용 조성물을 사용하는 방법은, 항체가 결합된 고정화기판에 시료를 가하여 시료에 존재하는 항원을 상기 기판에 결합된 항체에 결합시켜 기판-항체-항원 복합체를 형성한 다음, 상기 기판에 발색반응을 수행하는 효소가 결합된 다른 항체를 가하여 반응시켜서 기판-항체-항원-항체-효소의 복합체를 형성하고, 이에 상기 효소에 의해 발색되는 기질을 가하여 반응시키고, 상기 기질로부터 발색여부를 확인하거나 또는 발색수준을 측정함으로써, 상기 시료에 목적하는 항원(표적물질)이 존재하는 지 또는 상기 항원의 양이 얼마나 되는지를 확인하게 된다. 만일, 상기 시료에 목적하는 항원이 없다면, 기판-항체-항원-항체-효소의 복합체가 형성되지 않으므로, 상기 기질을 가하여도 발색반응이 일어나지 않는다.
종래의 ELISA용 조성물에서는 HRP가 직접적으로 결합된 항체를 사용할 수 없는데, 약 44kDa의 크기를 갖는 HRP를 100 내지 200kDa의 항체에 직접 결합시키면, HRP로 인하여 항체의 구조가 변화되어 정상적인 항체의 기능을 수행할 수 없기 때문이다. 따라서, 종래의 ELISA용 조성물은 HRP가 결합된 2차 항체를 사용하거나 또는 바이오틴-스트렙타비딘 링커를 이용하여 간접적으로 HRP가 결합된 항체를 포함하도록 제작되어, 시간과 비용이 많이 드는 단점이 있었다.
이에 반하여, 본 발명의 ELISA용 조성물은 HRP와 직접적으로 결합한 형태의 리피바디를 사용할 수 있는데, 약 29kDa의 크기를 갖는 리피바디는 44kDa의 상대적으로 거대한 크기를 갖는 HRP가 결합되어도 표적물질과의 결합력에 영향을 받지 않기 때문이다. 따라서, 본 발명의 ELISA용 조성물은 특이도와 민감도가 뛰어날 뿐만 아니라, HRP가 직접적으로 결합된 리피바디를 포함하여 그 제작이 간편하다.
본 발명은 또 다른 관점에서, 본 발명에 따른 리피바디를 포함하고, 쥐 또는 토끼의 면역글로불린 G의 웨스턴 블로팅(Western Blotting)용 조성물에 관한 것이다.
본 발명에서, 웨스턴 블로팅(western blotting)은 여러 단백질 혼합물로부터 어떤 특정 단백질을 찾아내는 기법으로서, 세포나 조직으로부터 추출한 단백질을 샘플 버퍼(sample buffer)와 섞어 아크릴아미드(acrylamide)로 만든 분자체(molecular sieve)에 올려놓고 전기영동을 하면 샘플 버퍼에 들어있던 SDS(sodium dodecylsulfate, SDS-page)라는 물질이 단백질 전체에 (-) 전기를 띠게 해서 (+) 전기 쪽으로 단백질이 끌려가게 된다. 이때 분자체가 단백질의 진행을 방해하여 작은 분자는 빨리, 큰분자는 느리게 이동하여 여러 크기의 밴드(band)를 형성하게 되는데, 이때 크기에 따라 분리된 젤(gel)위에 멤브레인을 올려놓고 전기를 흘려주면 단백질은 분리된 상태로 멤브레인에 옮겨진다. 여기서 검출하고자 하는 특정 단백질에 대한 일차 항체(primary antibody)를 결합시키고 다시 그 항체에 특이적인 2차 항체(secondary antibody)를 결합시켜 발색 내지는 형광에 의해 나타나는 반응을 X-ray로 이미지화하는 방법을 의미한다. 일반적으로 2차 항체는 면역글로불린 G에 대한 항체를 주로 사용하나, 본 발명에 따른 리피바디를 대신 사용할 경우, 민감도와 특이성이 뛰어나고, 제작이 간편한 장점을 가질 수 있다.
본 발명은 또 다른 관점에서, 형광물질이 결합한 본 발명에 따른 리피바디를 포함하고, 쥐 또는 토끼의 면역글로불린 G의 면역화학염색용 조성물에 관한 것이다.
일반적으로, 면역화학 염색법은 항원에 대한 일차 항체를 반응시켜 붙인 다음 직접 효소가 붙은 이차 항체를 붙이고 효소의 기질액을 반응시켜 발색을 시키거나, 바이오틴이 붙은 이차항체를 반응 시키고 이후에 바이오틴과 강력하게 붙는 성질이 있는 아비딘에 효소가 달라붙어있는 시약을 반응 시키고(ABC 법) 이후에 이 효소에 대한 기질액을 반응시켜서 색깔을 발색시켜 현미경하에서 원래 항원의 존재를 관찰하는 방법을 의미한다. 이와 같은 방법은 효소의 반응 정도를 결정짓는 여러 가지 요소들에 의해 최종 발색 정도가 달라지고 특히 가장 흔히 이용되고 있는 ABC 법에서는 여러 단계를 거쳐서 염색하므로 원래 존재하는 항원은 여러 단계로 증폭되어 선명한 색깔의 발색을 얻게 되나 이 모든 단계들이 최종 발색농도에 영향을 미치기 때문에 조직 내 항원 양을 정량적으로 알고자하는 원래의 목적을 이루기에는 부족함이 있는 반면, 본 발명에 따른 리피바디를 포함하는 면역화학염색용 조성물은 이차항체 대신 면역글로불린 G에 특이적으로 결합하고, 형광물질이 결합한 리피바디를 이용하여, 민감도와 정확도가 높고, 간단하게 면역조직화학 염색을 수행할 수 있다.
본 발명에 있어서, 상기 형광물질은 형광염료, 테트라시스테인 형광성 모티프(tetracystein motif) 형광 단백질, 형광 나노입자 또는 양자점(quantum dot)인 것을 특징으로 할 수 있으나, 이에 한정되는 것은 아니다.
실시예
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 파지 디스플레이를 이용한 쥐와 토끼의 면역글로불린 G 특이적 결합 리피바디 선별을 위한 라이브러리 구축
토끼의 면역글로불린 G에 특이적으로 결합하는 리피바디 선별을 위해 선행특허 (제10-2012-0019927호)에서 이미 구축한 라이브러리 파지를 이용하여 파지 디스플레이를 수행하였다 (도 1). 쥐의 면역글로불린 G에 특이적으로 결합하는 리피바디 선별을 위해 선행특허 (제10-2013-0081009호)에서 개발된 사람 면역글로불린 G에 결합하는 리피바디의 폴리펩티드 서열을 기반으로 카르복실기말단 방향에 위치한 여섯 아미노산 잔기 240, 241, 242, 243, 244 그리고 255번을 선택하였다 (도 2). 도 1과 도 2는 무작위적인 라이브러리를 구축하고자 하는 아미노산 잔기들을 표시한 전체 구조를 나타내는 개략도이다.
상기 선택한 아미노산을 NNK 동의코돈 (degenerate codon)으로 치환하도록, 라이브러리 구축을 위한 돌연변이 유발 프라이머 (mutagenic primer)를 합성하였다.
이어, 상기 프라이머들을 이용하여 두 모듈에 대한 겹침 중합효소 연쇄 반응 (overlap PCR)을 수행하며 라이브러리 DNA를 수득하고, 본 발명자의 선행 특허 (제10-2012-0019927호)에 기술된 서열번호 2의 파지미드 pBEL118M에 삽입하여 최종적인 라이브러리 파지미드를 확보하였다.
상기 확보된 라이브러리를 전기천공법 (electroporation)으로 대장균 XL1-Blue에 도입하여 형질전환체를 수득함으로써, 1.0×108 수준의 다양성을 갖는 라이브러리를 구축하였다.
실시예 2: 리피바디 라이브러리의 패닝 과정을 통한 쥐와 토끼의 면역글로불린 G와 결합하는 폴리펩티드 선별
실시예 1에서 구축한 라이브러리를 사용하여 쥐와 토끼의 면역글로불린 G에 결합할 수 있는 폴리펩티드를 선별하여 정제하였다. 쥐 또는 토끼의 면역글로불린 G와 결합할 수 있는 후보를 선별하기 위하여, 쥐 또는 토끼의 면역글로불린 G를 면역튜브 (Immuno-tube)에 30 ㎍/㎖의 농도로 가하고, 4℃에서 12시간동안 코팅하였다. 상기 코팅된 면역튜브를 PBS로 1회 세척하고, 1% BSA와 0.05 % Tween 20을 포함하는 PBS 용액 (TPBSA)으로 4℃에서 2시간동안 블로킹 (Blocking) 하였다. 그런 다음, 상기 정제된 파지를 1012 cfu/ml의 농도로 상기 코팅된 면역튜브에 가하고, 상온에서 2시간 반응시켰다. 반응이 종료된 후, 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 총 2분간 5번씩 세척하였다. 마지막으로, 1 ml 0.2 M Glycine-HCl (pH 2.2)를 상기 면역튜브에 가하고, 상온에서 12분간 반응시킴으로써, 쥐 또는 토끼의 면역글로불린 G와 결합할 수 있는 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다. 상기 용출액에 60 ㎕의 1.0 M Tris-HCl (pH 9.0)를 가하여 중화시키고, 숙주세포인 10 ml 대장균 XL1-Blue 용액 (OD600 = 0.5)에 가한 다음, 2xYT 플레이트에 도말하는 바이오패닝 (Bio-panning) 과정을 동일하게 5회 반복하여 수행하였다.
그 결과, 각 패닝 과정을 통해 쥐와 토끼의 면역글로불린 G와 특이적으로 결합하는 파지가 농축됨을 확인하였다. 상기 결과는 쥐와 토끼의 면역글로불린 G와 결합하는 라이브러리 파지가 특이적으로 증가하는 것을 확인하였다.
실시예 3: 선별된 리피바디의 쥐와 토끼의 면역글로불린 G에 대한 특이적인 결합여부 확인 및 서열 분석
실시예 2의 방법을 통하여 선별한 파지를 쥐와 토끼의 면역글로불린 G와 BSA가 코팅된 96-웰 플레이트를 이용하여 ELISA를 수행하였다. 먼저 토끼의 면역글로불린 G에 결합하는 리피바디를 선별하기 위해 BSA 대비 토끼의 면역글로불린 G의 흡광도(OD450)가 10배 이상 높은 41개의 리피바디 후보들을 선별하고, 이들 각각의 아미노산 서열을 확인한 결과, 상기 선별된 파지에서 모두 같은 서열을 갖는 1 종류의 리피바디 서열을 확인하였다(서열번호 3).
쥐의 면역글로불린 G에 결합하는 리피바디를 선별하기 위해 BSA 대비 쥐의 면역글로불린 G의 흡광도(OD450)가 4배 이상 높은 4개의 리피바디 후보들을 선별하고, 이들 각각의 아미노산 서열을 확인한 후, 동일한 아미노산 서열을 갖는 클론을 제외하였다. 그 결과, 상기 선별된 파지에서 총 3 종류의 리피바디 서열을 확인하였다(서열번호 4 내지 6).
실시예 4: 리피바디의 결합력 증가를 위한 모듈 기반 친화력 증대 방법 수행
다양한 면역분석법에 사용하기 위해서 기존 이차 면역글로불린 G의 일차 면역글로불린 G에 대한 결합력과 비슷한 수준을 갖는 리피바디 개량이 필요하다. 따라서 결합력이 증대된 리피바디를 확보하기 위해 선행특허 (제10-2012-0019927호)에서 구축한 모듈 기반 친화력 증대 기술을 사용하였다. 우선, 상기 실시예 3에서 선별된 토끼의 면역글로불린 G에 결합하는 E2 리피바디의 폴리펩티드를 코딩하는 폴리뉴클레이도타이드 서열을 기반으로 첫 번째 라이브러리와 인접한 모듈 (LRRV5, LRRVE)을 선택하여 상기 선행특허 실시예 2와 동일한 방식으로 오목한 지역의 6개 잔기를 돌연변이 시켰다. 다시 총 다섯 번의 패닝 과정을 거쳐 결합력이 증대된 총 6가지 리피바디 클론들을 확보하였고, ITC를 통해 해리상수를 측정한 결과 최종적으로 74 nM 수준의 가장 높은 결합력을 가지는 E2 리피바디를 확보하였다 (도 3).
다음으로, 실시예 3에서 선별된 쥐의 면역글로불린 G에 결합하는 리피바디 총 3가지 클론 중 H12 리피바디의 폴리펩티드를 코딩하는 폴리뉴클레오티드 서열을 기반으로 리피바디 아미노말단 지역의 두 모듈 (LRR1, LRRV2)을 선택하여 상기 선행특허 실시예 2와 동일한 방식으로 오목한 지역의 6개 잔기를 돌연변이 시켰다. 다시 총 다섯 번의 패닝 과정을 거쳐 결합력이 증대된 총 3가지 리피바디 클론들을 확보하였고, ITC를 통해 해리상수를 측정한 결과, A6 리피바디가 16nM 수준으로 가장 높은 결합력을 가지는 것을 확인하였다 (도 4).
실시예 5: 선별된 리피바디의 기존 이차 면역글로불린 G 대체 가능성 분석
실시예 4에서 확보한 2종류의 리피바디와 함께 선행특허 (제10-2013-0081009호)에서 개발한 사람 면역글로불린 G에 결합하는 F4 리피바디를 이용하여 사람, 쥐, 토끼의 면역글로불린 G에 결합하는 기존 이차 면역글로불린 G 대체 가능성을 분석하기 위해, 기존 이차 면역글로불린 G의 단점이었던 비특이적 결합에 의한 신호 검출 및 교차 반응 여부를 Fluorescence ELISA를 통해 확인하였다. 사람, 쥐, 토끼의 면역글로불린 G를 30 ㎍/㎖으로 96-웰 플레이트에 코팅하여 4 ℃에서 10시간 보관하였다. 이후 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 1번 세척하였다. 485 nm에서 에너지를 흡수하여 510 nm에서 빛을 방출하는 형광 표지자인 NHS-Fluorescein(NHS-FITC)을 리피바디의 일차 아민기에 결합시켜 리피바디 형광 표지자 결합체(repebody-FITC)를 제작한 후, 10 ㎍/㎖ 의 동일 농도로 상기 코팅된 96-웰 플레이트에 처리하였다. 상온에서 1시간 반응 후 TPBS로 3번 세척하였다.
리피바디 형광 표지자 결합체의 발광 정도를 측정한 결과, F4-FITC는 사람의 면역글로불린 G에서만, A6-FITC는 쥐의 면역글로불린 G에서만, E2-FITC는 토끼의 면역글로불린 G에서만 형광 값을 나타내는 것을 확인하였다 (도 5). 이는 선별된 리피바디가 기존 이차 면역글로불린 G의 비특이적 반응 및 교차반응에 의한 검출 한계를 극복하고 특이적으로 각 동물 종의 면역글로불린 G에만 결합하는 것을 알 수 있으며 기존 이차 면역글로불린 G 대체 가능성하다는 것을 의미한다.
실시예 6: 선별한 리피바디의 ELISA 분석에서의 활용능력 검증
선별한 리피바디를 이용하여 실제 ELISA에 적용하고, 기존 이차 면역글로불린 G와 동일한 조건으로 처리하였을 때 표적 단백질 검출 능력을 비교하는 실험을 수행하였다. 검출을 위한 표지자로 효소를 리피바디에 결합하는 실험을 선행하여 리피바디 효소 결합체 (repebody-HRP)를 제작하였고 결합체 효율은 90% 이상 수득률을 확보하였다. ELISA 실험을 위해 사람, 쥐, 토끼의 면역글로불린 G를 0~2 ㎍/㎖으로 다양한 농도 구간을 설정하여 96-웰 플레이트에 코팅하여 4 ℃에서 10시간 보관하였다. 이후 0.05% Tween 20을 포함하는 PBS 용액 (TPBS)으로 1번 세척하였다. F4-HRP, A6-HRP, E2-HRP 및 기존 이차 면역글로불린 G-HRP를 0.2 ㎍/㎖으로 상기 코팅된 플레이트에 처리하였다. 상온에서 1시간 반응 후 TPBS로 3번 세척 후 HRP의 기질인 Tetramethylbenzidine (TMB)를 20분간 처리하였고, 반응을 중지하기 위해 황산을 처리하여 450nm 파장에서 형광 값을 측정하였다.
그 결과 기존 이차 면역글로불린 G와 동등한 수준으로 최소 50 ng/ml 까지 사람, 쥐, 토끼의 면역글로불린 G를 검출하는 것을 확인하였다 (도 6). 이는 실제 사용되는 일차 면역글로불린 G의 농도 0.1~1 ㎍/㎖의 50배 이상 낮은 농도도 검출 할 수 있는 우수한 능력임을 알 수 있다.
실시예 7: 선별한 리피바디의 western blot에서 활용능력 검증
선별한 리피바디를 이용하여 실제 western blot에 적용하여 복잡한 세포 용해물 중 표적 단백질만을 특이적으로 검출하는 능력을 평가하는 실험을 수행하였다. 우선, 사람 면역글로불린 G에 결합하는 F4-HRP의 검출 능력을 확인하였다. 사람 유방암 세포 (SK-Br-3 및 MCF-7)를 용해 후 용액에 녹아 있는 다양하고 복잡한 단백질 중 HER2를 검출하기 위해 20 ㎍의 세포 용해물을 SDS-PAGE을 통해 단백질의 크기 별로 분리하였고, HER2에 특이적으로 결합하는 일차 사람 면역글로불린 G인 1 ㎍/㎖의 Herceptin을 처리하였다. 상온에서 1시간 반응 후 TPBS로 3번 세척하였다. 이후 2 ㎍/㎖의 F4-HRP를 처리하여 상온에서 1시간 반응 후 TPBS로 3번 세척하였다. 기질을 처리하여 chemiluminescent 신호를 검출한 결과 HER2만을 특이적으로 결합하여 신호가 검출되는 것을 확인하였다(도 7).
다음으로 쥐의 면역글로불린 G에 결합하는 A6-HRP의 검출 능력을 확인하였다. 다양한 종류의 동물 암세포 A431, HeLa, Panc-1, HT-29, U2OS의 세포 용출액 중 β-actin을 검출하기 위해 20 ㎍의 세포 용해물을 SDS-PAGE을 통해 단백질의 크기 별로 분리하였고, β-actin에 특이적으로 결합하는 일차 쥐 면역글로불린 G인 0.2 ㎍/㎖의 anti-β-actin mouse IgG을 처리하였다. 상온에서 1시간 반응 후 TPBS로 3번 세척하였다. 이후 0.5 ㎍/㎖의 A6-HRP를 처리하여 상온에서 1시간 반응 후 TPBS로 3번 세척하였다. 기질을 처리하여 chemiluminescent 신호를 검출한 결과 β-actin만을 특이적으로 결합하여 신호가 검출되는 것을 확인하였다 (도 7).
마지막으로 토끼의 면역글로불린 G에 결합하는 E2-HRP의 검출 능력을 확인하였다. 다양한 종류의 동물 암세포 HeLa, Panc-1, HCC827의 세포 용출액 중 인산화 키나아제 (phospho-ERK1/2)을 검출하기 위해 20 ㎍의 세포 용해물을 SDS-PAGE을 통해 단백질의 크기 별로 분리하였고, phospho-ERK1/2에 특이적으로 결합하는 일차 토끼 면역글로불린 G인 1 ㎍/㎖의 anti-phospho-ERK1/2 rabbit IgG을 처리하였다. 상온에서 1시간 반응 후 TPBS로 3번 세척하였다. 이후 2 ㎍/㎖의 E2-HRP를 처리하여 상온에서 1시간 반응 후 TPBS로 3번 세척하였다. 기질을 처리하여 chemiluminescent 신호를 검출한 결과 phospho-ERK1/2만을 특이적으로 결합하여 신호가 검출되는 것을 확인하였다 (도 7).
실시예 8: 선별한 리피바디의 immunocytochemistry에서 활용능력 검증
면역화학염색법(Immunocytochemistry)을 통해 리피바디 양자점 (quantum dot) 결합체(repebody-QD)의 표적 단백질 검출 및 세포 이미징을 수행한 결과이다. 표적 단백질은 암세포에서 과발현 되는 상피세포성장인자 수용체 (EGFR), Epithelial cell adhesion molecule (EpCAM), HER2이다. F4-QD, A6-QD, E2-QD를 만들기 위해 카르복시기가 노출된 QD와 리피바디의 일차 아민그룹을 결합시키는 NHS/EDC 링커를 도입하여 결합체를 제작하였다. 결합체 수득률은 99%로 매우 높은 효율로 결합체를 확보하였다. 이 때 QD는 525 nm 파장 대에서 초록을 발광하는 것으로 사용하였다.
세포 배양액(RPMI-1640)에 존재하는 상기 동물 세포를 8-웰 세포 배양 챔버에 48시간 배양하여 표면에 부착한 후, 표적 단백질에 특이적으로 결합하는 일차 면역글로불린 G인 2 ㎍의 Cetuximab, anti-EpCAM mouse IgG, anti-HER2 rabbit IgG의 처리 후 4도씨에서 1시간 동안 결합시켰다. 이후 DPBS로 2번 세척한 후 20 nM의 F4-QD, A6-QD, E2-QD를 처리 후 4도씨에서 1시간 동안 결합시켰다. 이후 DPBS로 2번 세척한 후 핵 염색 및 슬라이드 글라스 부착을 위해 DAPI 용액을 떨어트려 주었다. 컨포칼 현미경을 이용하여 표적 단백질에 결합된 repebody-QD의 형광 신호를 검출 한 결과 일차 면역글로불린 G를 처리한 군에서만 형광 신호가 검출되는 것을 확인하였다(도 8).
실시예 5 내지 8에서 확인한 리피바디의 면역분석법 적용 실험 결과 기존 이차 면역글로불린 G의 비특이적 반응, 교차 반응에 따른 검출 한계 및 높은 생산 단가 등의 단점들을 극복하고, 표적 단백질에 대한 결합이 특이적이며 교차 반응이 현저히 낮음을 알 수 있고 대장균에서 대량 생산이 가능하다는 점에서 고가의 생산 단가를 기존 이차 면역글로불린 G의 10분의 1로 낮출 수 있는 신규하고 혁신적인 단백질이다. 이의 용도로서 다양한 면역분석법에 적용하였을 때 충분한 표적 단백질 검출 능력을 보여줌으로써 면역 센서/면역 칩 및 약물전달용 표적지향형 DDS 수송체 및 생물학적 의약품 제조에 활용이 가능하다는 것을 의미한다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는 바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
본 발명에 따른 신규한 폴리펩티드는 쥐 또는 토끼 각각의 면역글로불린 G에 특이적으로 결합하고 기존의 값비싼 이차 면역글로불린 G를 대체하며 다양한 생물학적 면역분석법에 사용될 수 있을 뿐만 아니라, 본 발명의 폴리펩티드와 면역글로불린 G의 혼성체를 이용하여 다양한 면역 센서/면역 칩 제작 및 약물 스크리닝에 유용하다.
전자파일 첨부하였음.
Claims (26)
- 서열번호 3 및 7 내지 12 중 어느 하나의 아미노산 서열로 표시되고, 토끼의 면역글로불린 G에 선택적으로 결합하는 리피바디(repebody).
- 제1항의 리피바디를 코딩하는 폴리뉴클레오티드.
- 제2항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
- 제2항의 폴리뉴클레오티드 또는 제3항의 재조합 벡터가 도입되어 있는 재조합 미생물.
- (i) 제4항의 재조합 미생물을 배양하여 리피바디를 발현시키는 단계; 및(ii) 상기 발현된 리피바디를 회수하는 단계를 포함하는, 제1항의 리피바디의 제조방법.
- (i) 제1항의 리피바디를 흡착시킨 컬럼에 토끼의 면역글로불린 G 항체를 함유하는 혼합물을 처리하는 단계; 및(ii) 상기 단계 (i)의 컬럼에 부착된 항체를 용출하는 단계를 포함하는 토끼의 면역글로불린 G 항체의 정제방법.
- (i) 제1항의 리피바디를 고체기판에 부착하는 표면처리 단계; 및(ii) 상기 표면처리된 고체기판에 면역글로불린 G를 결합시키는 단계를 포함하는 토끼의 면역글로불린 G의 고정화 방법.
- 제1항의 리피바디로 표면처리된 고체기판에 상기 리피바디를 매개로 토끼의 면역글로불린 G가 고정된 면역센서.
- 하기 단계를 포함하는, 토끼의 면역글로불린 G에 대한 결합능을 가지는 물질을 검출하는 방법:(a) 제8항의 면역센서에 토끼의 면역글로불린 G에 대한 결합능을 갖는 물질을 함유하는 시료를 처리하는 단계; 및(b) 상기 면역센서의 결합유무를 확인하는 단계.
- 제1항의 리피바디를 포함하는 토끼의 면역글로불린 G의 ELISA용 조성물.
- 제1항의 리피바디를 포함하는 토끼의 면역글로불린 G의 웨스턴 블로팅(Western Blotting)용 조성물.
- 형광물질이 결합된 제1항의 리피바디를 포함하는 토끼의 면역글로불린 G의 면역화학염색용 조성물.
- 제12항에 있어서, 상기 형광물질은 형광염료, 테트라시스테인 형광성 모티프(tetracystein motif) 형광 단백질, 형광 나노입자 또는 양자점(quantum dot)인 것을 특징으로 하는 면역화학염색용 조성물.
- 서열번호 4 내지 6 및 13 내지 15 중 어느 하나의 아미노산 서열로 표시되고, 쥐의 면역글로불린 G에 선택적으로 결합하는 리피바디(repebody).
- 제14항의 리피바디를 코딩하는 폴리뉴클레오티드.
- 제15항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
- 제15항의 폴리뉴클레오티드 또는 제16항의 재조합 벡터가 도입되어 있는 재조합 미생물.
- (i) 제17항의 재조합 미생물을 배양하여 리피바디를 발현시키는 단계; 및(ii) 상기 발현된 리피바디를 회수하는 단계를 포함하는, 제14항의 리피바디의 제조방법.
- (i) 제14항의 리피바디를 흡착시킨 컬럼에 쥐의 면역글로불린 G 항체를 함유하는 혼합물을 처리하는 단계; 및(ii) 상기 단계 (i)의 컬럼에 부착된 항체를 용출하는 단계를 포함하는 쥐의 면역글로불린 G 항체의 정제방법.
- (i) 제14항의 리피바디를 고체기판에 부착하는 표면처리 단계; 및(ii) 상기 표면처리된 고체기판에 면역글로불린 G를 결합시키는 단계를 포함하는 쥐의 면역글로불린 G의 고정화 방법.
- 제14항의 리피바디로 표면처리된 고체기판에 상기 리피바디를 매개로 쥐의 면역글로불린 G가 고정된 면역센서.
- 하기 단계를 포함하는, 쥐의 면역글로불린 G에 대한 결합능을 가지는 물질을 검출하는 방법:(a) 제21항의 면역센서에 쥐의 면역글로불린 G에 대한 결합능을 갖는 물질을 함유하는 시료를 처리하는 단계; 및(b) 상기 면역센서의 결합유무를 확인하는 단계.
- 제14항의 리피바디를 포함하는 쥐의 면역글로불린 G의 ELISA용 조성물.
- 제14항의 리피바디를 포함하고는 쥐의 면역글로불린 G의 웨스턴 블로팅(Western Blotting)용 조성물.
- 형광물질이 결합된 제14항의 리피바디를 포함하는 쥐의 면역글로불린 G의 면역화학염색용 조성물.
- 제25항에 있어서, 상기 형광물질은 형광염료, 테트라시스테인 형광성 모티프(tetracystein motif) 형광 단백질, 형광 나노입자 또는 양자점(quantum dot)인 것을 특징으로 하는 면역화학염색용 조성물.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/074,530 US10995153B2 (en) | 2016-02-01 | 2016-09-20 | Polypeptide selectively binding to immunoglobulin G of mouse or rabbit and use thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR10-2016-0012183 | 2016-02-01 | ||
| KR1020160012183A KR101818152B1 (ko) | 2016-02-01 | 2016-02-01 | 쥐 또는 토끼의 면역글로불린 g에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017135545A1 true WO2017135545A1 (ko) | 2017-08-10 |
Family
ID=59499969
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2016/010461 Ceased WO2017135545A1 (ko) | 2016-02-01 | 2016-09-20 | 쥐 또는 토끼의 면역글로불린 g에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 |
Country Status (3)
| Country | Link |
|---|---|
| US (1) | US10995153B2 (ko) |
| KR (1) | KR101818152B1 (ko) |
| WO (1) | WO2017135545A1 (ko) |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101896595B1 (ko) * | 2018-03-23 | 2018-09-10 | 주식회사 레피젠 | 쥐 면역글로불린 g1 정제용 조성물 및 이의 용도 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140243210A1 (en) * | 2005-01-13 | 2014-08-28 | Ruben Carbonell | Purification of immunoglobulins using affinity chromatography and peptide ligands |
| US20140274790A1 (en) * | 2011-08-24 | 2014-09-18 | Kagoshima University | IgG-BINDING PEPTIDE AND METHOD FOR DETECTING AND PURIFYING IgG USING SAME |
| KR20150007077A (ko) * | 2013-07-10 | 2015-01-20 | 한국과학기술원 | 면역글로불린 g에 대한 리피바디 및 그 용도 |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR101140254B1 (ko) | 2010-08-27 | 2012-04-26 | (주) 이이시스 | 순시적인 아크 검출기능을 갖는 아크 검출 회로 및 이를 이용한 대기압 플라즈마 생성용 전원 공급 장치 |
-
2016
- 2016-02-01 KR KR1020160012183A patent/KR101818152B1/ko active Active
- 2016-09-20 US US16/074,530 patent/US10995153B2/en active Active
- 2016-09-20 WO PCT/KR2016/010461 patent/WO2017135545A1/ko not_active Ceased
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20140243210A1 (en) * | 2005-01-13 | 2014-08-28 | Ruben Carbonell | Purification of immunoglobulins using affinity chromatography and peptide ligands |
| US20140274790A1 (en) * | 2011-08-24 | 2014-09-18 | Kagoshima University | IgG-BINDING PEPTIDE AND METHOD FOR DETECTING AND PURIFYING IgG USING SAME |
| KR20150007077A (ko) * | 2013-07-10 | 2015-01-20 | 한국과학기술원 | 면역글로불린 g에 대한 리피바디 및 그 용도 |
Non-Patent Citations (2)
| Title |
|---|
| LEE ET AL.: "Design of a Binding Scaffold Based on Variable Lymphocyte Receptors of Jawless Vertebrates by Module Engineering", PNAS, vol. 109, no. 9, 28 February 2012 (2012-02-28), pages 3299 - 3304, XP055200364 * |
| ZHANG ET AL.: "Specificity and Regenerability of Short Peptide Ligands Supported on Polymer Layers for Immunoglobulin G Binding and Detection", ACS APPLIED MATERIALS AND INTERFACES, vol. 5, 8 July 2013 (2013-07-08), pages 8030 - 8037, XP055405786 * |
Also Published As
| Publication number | Publication date |
|---|---|
| KR101818152B1 (ko) | 2018-02-28 |
| KR20170091320A (ko) | 2017-08-09 |
| US20190040157A1 (en) | 2019-02-07 |
| US10995153B2 (en) | 2021-05-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN103201293B (zh) | 评估和鉴定或发展条件活性治疗蛋白的方法 | |
| WO2016002189A1 (ja) | 抗プログルカゴン抗体 | |
| WO2020009482A1 (ko) | 항 알파-시누클레인 항체 및 그 용도 | |
| CN116199783A (zh) | Alp单克隆抗体及其应用 | |
| CN107383199B (zh) | 一种s-腺苷蛋氨酸合成酶的单克隆抗体及其应用 | |
| WO2023231888A1 (zh) | 抗人生长激素单域抗体及其应用 | |
| WO2017135545A1 (ko) | 쥐 또는 토끼의 면역글로불린 g에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도 | |
| CN113621079B (zh) | Fab抗体与小牛肠碱性磷酸酶的融合蛋白及其制备方法 | |
| CN111705066B (zh) | 一种经基因修饰的tigit蛋白及其单克隆抗体和应用 | |
| WO2016018133A9 (ko) | 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도 | |
| CN120209142A (zh) | 一种靶向Ly6G6D的纳米抗体及其应用 | |
| CN111778257A (zh) | 一种经基因修饰的cd96蛋白及其单克隆抗体和应用 | |
| KR102486958B1 (ko) | 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도 | |
| KR102760674B1 (ko) | 중증열성혈소판감소증후군 바이러스 Gc 항원에 특이적으로 결합하는 항체 및 이의 용도 | |
| CN115894683A (zh) | 检测甲胎蛋白的单克隆抗体及其应用 | |
| CN111763255A (zh) | 一种经基因修饰的vegfa蛋白及其单克隆抗体与应用 | |
| KR102942224B1 (ko) | 개 홍역 바이러스 검출용 항체, 및 이를 이용한 개 홍역 바이러스 검출방법 | |
| KR102842427B1 (ko) | 바다코끼리 칼리시바이러스에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 및 이들의 용도 | |
| CN112739719A (zh) | 结合Gα蛋白的单域抗体 | |
| KR102942223B1 (ko) | 바다코끼리 칼리시바이러스 검출용 항체, 및 이를 이용한 바다코끼리 칼리시바이러스 검출방법 | |
| CN111647049B (zh) | 多肽和多肽偶联物及其制备方法和应用 | |
| KR101624703B1 (ko) | 적색 형광단백질에 결합하는 신규한 폴리펩타이드 | |
| KR20260021142A (ko) | 웨스트 나일 바이러스에 특이적으로 결합하는 항체, 및 이의 용도 | |
| KR20250179730A (ko) | 웨스트 나일 바이러스에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 및 이들의 용도 | |
| KR20250129142A (ko) | 큰돌고래 파라인플루엔자 바이러스 1형 검출용 항체, 및 이를 이용한 큰돌고래 파라인플루엔자 바이러스 1형 검출방법 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16889523 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16889523 Country of ref document: EP Kind code of ref document: A1 |