WO2017124001A2 - T cell receptor-like antibodies specific for foxp3-derived peptides - Google Patents

T cell receptor-like antibodies specific for foxp3-derived peptides Download PDF

Info

Publication number
WO2017124001A2
WO2017124001A2 PCT/US2017/013511 US2017013511W WO2017124001A2 WO 2017124001 A2 WO2017124001 A2 WO 2017124001A2 US 2017013511 W US2017013511 W US 2017013511W WO 2017124001 A2 WO2017124001 A2 WO 2017124001A2
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
seq
acid sequence
set forth
chain variable
Prior art date
Application number
PCT/US2017/013511
Other languages
French (fr)
Other versions
WO2017124001A3 (en
Inventor
David A. Scheinberg
Tao DAO
Cheng Liu
Original Assignee
Memorial Sloan-Kettering Cancer Center
Eureka Therapeutics, Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Memorial Sloan-Kettering Cancer Center, Eureka Therapeutics, Inc. filed Critical Memorial Sloan-Kettering Cancer Center
Priority to CN201780017192.9A priority Critical patent/CN109069627A/en
Priority to US16/069,999 priority patent/US11505599B2/en
Priority to EP17739080.4A priority patent/EP3402518A4/en
Priority to JP2018536458A priority patent/JP7022067B2/en
Publication of WO2017124001A2 publication Critical patent/WO2017124001A2/en
Publication of WO2017124001A3 publication Critical patent/WO2017124001A3/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6843—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a material from animals or humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/04—Immunostimulants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2833—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/46—Hybrid immunoglobulins
    • C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854—Immunoglobulins
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/32—Immunoglobulins specific features characterized by aspects of specificity or valency specific for a neo-epitope on a complex, e.g. antibody-antigen or ligand-receptor
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies

Definitions

  • the presently disclosed subject matter relates generally to antibodies against forkhead box P3 (“Foxp3”), specifically antibodies that recognize a Foxp3 peptide in conjunction with a major histocompatibility complex (“MHC”) molecule.
  • Foxp3 forkhead box P3
  • MHC major histocompatibility complex
  • Treg Regulatory T cells expressing Foxp3 play a central role in maintaining self tolerance and immune homeostasis.
  • Treg cells can suppress activation, proliferation and function of a wide variety of immune cells, including CD4 + , CD8 + T cells, Natural killer (“NK”) cells, NK-T cells, B cells, and antigen-presenting cells (APCs) in vitro and in vivo.
  • NK Natural killer
  • APCs antigen-presenting cells
  • Treg cells can also suppress anti- tumor immune responses and favor tumor progression, and thus immunosuppression by tumor-induced regulatory T (Treg) cells presents a major obstacle for successful immunotherapy.Treg cells are considered the most powerful inhibitors of anti-tumor immunity and the greatest barrier to successful immunotherapy. Treg expansion and their negative prognostic implications for tumor growth are general phenomena seen in many types of cancers Therefore, developing strategies to deplete Treg could help reactivate or stimulate immune responses against cancer cells.
  • Treg tumor-induced regulatory T
  • the transcription factor forkhead box P3 (Foxp3) is essential to the establishment and suppressive function of Tregs and therefore would be a highly specific and ideal target for eliminating Treg cells.
  • Foxp3 is an undruggable intracellular protein. Therefore, there is a large unmet need for drugs that selectively inhibit Treg cells.
  • the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof further comprises a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of: (a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 10 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 13 or a modification thereof; (b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 16 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 19 or a modification thereof; (c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 22 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 25 or a
  • CAR Chimeric antigen receptor CDC: Complement dependent cytotoxicity
  • TIL Tumor infiltration lymphocyte
  • the term“vector” refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells.
  • the term includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
  • CDRs are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of
  • affinity is meant a measure of binding strength
  • stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30°C, more preferably of at least about 37°C, and most preferably of at least about 42°C.
  • wash steps will occur at 68°C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Rogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al.
  • the term“isolated,”“purified,” or“biologically pure” refers to material that is free to varying degrees from components which normally accompany it as found in its native state.“Isolate” denotes a degree of separation from original source or surroundings.“Purify” denotes a degree of separation that is higher than isolation.
  • a “purified” or“biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or polypeptide of the presently disclosed subject matter is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid
  • Foxp3 is an ideal target except that it is no druggable by small molecules and it is inside the cell so antibody therapy is not feasible.
  • peptides from Foxp3 protein that are degraded and processed for cell surface presentation can serve as a target of a TCR mimic antibody.
  • TCR-mimic antibodies specific for Foxp3-derived epitopes specifically and directly deplete Foxp3 + Treg cells and tumor cells. The depletion of Treg cells can greatly unleash anti-tumor immunity by removing immunosuppression caused by both Treg cells and tumor cells.
  • a presently disclosed antibody or antigen-binding portion thereof binds to one or more Treg cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more T cell selected from the group consisting of CD4 + T cells, CD127 low T cells, CD25 high T cells, Foxp3 high T cells, and combinations thereof.
  • the heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT017-17, EXT017-18, EXT017-20, EXT017-27, EXT017-28, EXT017- 32, EXT017-53, and EXT017-54 are shown in Table 1 below.
  • the CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242).
  • the presently disclosed antibody or other antigen-binding protein comprises the heavy chain and light chain CDR1s, CDR2s and CDR3s of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017- 28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B.
  • a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26.
  • the antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-20”.
  • a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 57, 63, 69, 75, and 81;
  • a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92.
  • the antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT018-5”.
  • homologous at least about 93% homologous, at least about 94% homologous, at least about 95% homologous, at least about 96% homologous, at least about 97%
  • the percent homology between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
  • the percent homology between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol.
  • the presently disclosed subject matter provides antibodies or antigen-binding portions thereof that cross-compete for binding to a Foxp3 peptide/HLA complex (e.g., a Foxp3 peptide/HLA class I complex, a Foxp3 peptide/HLA-A2 complex, or a Foxp3 peptide/HLA-A*02:01 complex) with any of the anti-Foxp3 antibodies or antigen- binding portions thereof (e.g., scFvs) of the presently disclosed subject matter (e.g., EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017- 28, EXT017-29, EXT017-30, EX
  • the presently disclosed subject matter provides for isolated anti- Foxp3 monoclonal antibodies or antigen-binding portions thereof comprising a heavy chain variable region comprising: (a) a V H CDR1 region comprising the amino acid sequence set forth in SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87; (b) a V H CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88, or an amino acid sequence having
  • the presently disclosed subject matter provides for a method for the generation of antibodies that specifically bind to MHC-restricted peptides, which, when presented as part of a peptide/MHC complex are able to elicit a specific cytotoxic T-cell response.
  • HLA class I molecules present endogenous derived peptides of about 8-12 amino acids in length to CD8 + cytotoxic T lymphocytes.
  • the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141.
  • the scFv comprises the amino acid sequence set forth in SEQ ID NO: 124.
  • the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141.
  • the scFv comprises the amino acid sequence set forth in SEQ ID NO: 132.
  • the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141.
  • the scFv comprises the amino acid sequence set forth in SEQ ID NO: 133.
  • the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141.
  • the scFv comprises the amino acid sequence set forth in SEQ ID NO: 134.
  • the transmembrane domain of the CAR comprises a hydrophobic alpha helix that spans at least a portion of the membrane.
  • SEQ ID NO: 137 is provided below:
  • the co- stimulatory molecule can bind to a co-stimulatory ligand, which is a protein expressed on cell surface that upon binding to its receptor produces a co-stimulatory response, i.e., an intracellular response that effects the stimulation provided when an antigen binds to its CAR molecule.
  • the intracellular domain of the CAR comprises a co-stimulatory signaling region that comprises a CD28 polypeptide.
  • the CAR comprises a CD28 transmembrane domain and a CD28 co-stimulatory signaling domain, where CD28 polypeptide comprised in the
  • a presently disclosed antibody including a bispecific antibody and an engineered antibody disclosed herein or a composition comprising thereof, antigen binding protein (including CAR) or a composition comprising thereof, or
  • Nucleic acids that encode antibodies and antigen-binding proteins identified herein can be used engineer recombinant immune effector cells.
  • Methods and vectors to generate genetically modified T-cells, for example, are known in the art (See Brentjens et al., Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias in Blood
  • a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
  • a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
  • a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 75 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 78 or a modification thereof; and (e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 81 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 84 or a modification thereof.
  • a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80; or
  • the antibody or antigen-binding portion thereof of embodiment 36, 37 or 38 comprising a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 87 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 90 or a modification thereof.
  • the antibody or antigen-binding portion thereof of embodiment 45 comprising a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120.
  • a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80; (m) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in
  • the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
  • the CAR of embodiment 114, wherein the human scFv comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, and 134.
  • a method of killing a Foxp3-expressing cell comprising contacting a Foxp3- expressing cell with the antibody antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof.
  • a method of killing a Foxp3-expressing cell comprising contacting a Foxp3- expressing cell with the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof.
  • bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in killing a Foxp3-expressing cell 131.
  • the bispecific antibody of embodiment 131, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4 + T cells, CD25 high T cells,
  • a method of selectively inhibiting a T cell in a subject comprising administering the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to the subject, wherein the T cell is selected from the group consisting of CD4 + T cells, CD25 high T cells, CD127 low T cells, Foxp3 high T cells, and combinations thereof.
  • a method of treating cancer comprising administering an effective amount of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject.
  • a method of treating cancer comprising administering an effective amount of the antibody or antigen-binding portion thereof of any one of embodiments 1-75, the CAR of any one of embodiments 99-118, the bispecific antibody of any one of embodiments 80- 83, the immunoconjugate of embodiment 77 or 78, or a composition comprising thereof to a subject suffering from cancer, thereby inhibiting a T cell in the subject.
  • a kit for treating cancer comprising the bispecific antibody of any one of embodiments 80-83.
  • Tregs do not express a specific cell surface molecule which can be targeted by a mAb nor a selectively druggable
  • the selected clones were enriched by 3-4 rounds of panning processes. Positive clones were determined by standard ELISA method against biotinylated single chain
  • Step 3 Goat (Fab)2 anti-mouse Ig conjugated to FITC or PE (1:100 dilution), on ice, 30 minutes, then wash.
  • FIG. 6A-6H show the binding data of phage scFv clones to Fox3-7.
  • Figure 6I shows the binding data of phage scFv clones to Fox3-2.
  • Figure 6J shows the binding data of phage scFv clones to Fox3- 4.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cell Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Urology & Nephrology (AREA)
  • Epidemiology (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Zoology (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Abstract

The presently disclosed subject matter provides antigen-binding proteins (e.g., chimeric antigen receptors) and antibodies or antigen-binding portions thereof that bind to a Foxp3 peptide/MHC molecule complex. Such antibodies, fusion proteins and conjugates thereof are useful for inhibiting regulatory T cells and treating cancers.

Description

T CELL RECEPTOR-LIKE ANTIBODIES SPECIFIC FOR FOXP3- DERIVED PEPTIDES CROSS-REFERENCE TO RELATED APPLICATIONS This application claims priority to U.S. Provisional Patent Application Serial No. 62/278,815, filed January 14, 2016, to which priority is claimed and the contents of which are incorporated herein in their entireties. GRANT INFORMATION
This invention was made with government support under Grant No. NIH NCI p30 ca 008748 from National Institutes of Health. The government has certain rights in the presently disclosed subject matter. TECHNICAL FIELD
The presently disclosed subject matter relates generally to antibodies against forkhead box P3 (“Foxp3”), specifically antibodies that recognize a Foxp3 peptide in conjunction with a major histocompatibility complex (“MHC”) molecule. BACKGROUND OF THE PRESENTLY DISCLOSED SUBJECT MATTER
For induction of cytotoxic T cell (“CTL”) responses, intracellular proteins are usually degraded by the proteasome or endo/lysosomes, and the resulting peptide fragments bind to MHC class I or II molecules. These peptide-MHC complexes are displayed at the cell surface where they provide targets for T cell recognition via a peptide-MHC (pMHC)-T cell receptor (“TCR”) interaction (Oka et al., The Scientific World Journal 2007; 7: 649-665; Kobayashi et al., Cancer Immunol. Immunother.2006; 55 (7): 850-860).
To improve efficacy, cell marker antigens can be targeted with monoclonal antibody (“mAb”) therapy. Mab therapy has been shown to exert powerful antitumor effects by multiple mechanisms, including complement-dependent cytotoxicity (“CDC”), antibody-dependent cellular cytotoxicity (“ADCC”) and direct cell inhibition or apoptosis-inducing effects on cells which express target molecules and have the functions of supressing anti-tumor immune responses and favoring tumor progression. Furthermore, mAb can be used as carriers to specifically deliver a cytotoxic moiety such as a radionuclide, cytotoxic drug or toxin to the target cells (Miederer et al., Adv Drug Deliv Rev 2008; 60 (12): 1371-1382). A tremendous benefit would exist if, in addition to a cellular immunotherapy approach, a humoral immunotherapy approach was available to target non-cell surface antigens. Therefore, a mAb that mimics a T cell receptor in that it is specific for a target comprising a fragment of an intracellular protein in conjunction with an MHC molecule, for example, a Foxp3 peptide/HLA-A2 complex, would be a novel and effective therapeutic agent alone or as a vehicle capable of delivering potent anti-cancer reagents, such as drugs, toxins and radioactive elements. Such mAbs would also be useful as diagnostic or prognostic tools.
Regulatory T (Treg) cells expressing Foxp3 play a central role in maintaining self tolerance and immune homeostasis. Treg cells can suppress activation, proliferation and function of a wide variety of immune cells, including CD4+, CD8+ T cells, Natural killer (“NK”) cells, NK-T cells, B cells, and antigen-presenting cells (APCs) in vitro and in vivo. The dysfunction of Treg cells, leads to autoimmune diseases, allergy and maintenance of allo-graft tolerance. On the other hand, Treg cells can also suppress anti- tumor immune responses and favor tumor progression, and thus immunosuppression by tumor-induced regulatory T (Treg) cells presents a major obstacle for successful immunotherapy.Treg cells are considered the most powerful inhibitors of anti-tumor immunity and the greatest barrier to successful immunotherapy. Treg expansion and their negative prognostic implications for tumor growth are general phenomena seen in many types of cancers Therefore, developing strategies to deplete Treg could help reactivate or stimulate immune responses against cancer cells. A number of strategies for depletion or interference with Treg function have been attempted, e.g., depletion of Treg by monoclonal antibodies (mAb) specific for CD25, glucorticoid-induced TNF- related protein (GITR) and ligand-directed toxins targeted to cell surface receptor CD25 (such as Dennileukin diftitox). However, both CD25 and GITR are expressed not only in Treg cells, but also in activated CD4 and CD8 effector T cells. The problem with these strategies is a lack of specificity of currently available agents, resulting in depletion of the beneficial anti-tumor effector T cells. The transcription factor forkhead box P3 (Foxp3) is essential to the establishment and suppressive function of Tregs and therefore would be a highly specific and ideal target for eliminating Treg cells. However, Foxp3 is an undruggable intracellular protein. Therefore, there is a large unmet need for drugs that selectively inhibit Treg cells. SUMMARY OF THE PRESENTLY DISCLOSED SUBJECT MATTER
The presently disclosed subject matter identifies and characterizes antigen- binding proteins, such as antibodies and chimeric antigen receptors, that are able to target Foxp3 transcription factor. The presently disclosed antibodies target a peptide/MHC complex as it would typically appear on the surface of a cell following antigen processing of Foxp3 protein and presentation by the cell. In certain embodiments, a presently disclosed antibody is a T Cell Receptor mimics (TCRm) antibody. In certain embodiments, a TCRm antibody mimics T-cell receptors in that the antibodies have the ability to specifically recognize and bind to a peptide in an MHC-restricted fashion, that is, when the peptide is bound to an MHC antigen (e.g., a human MHC molecule). The peptide/MHC complex recapitulates the antigen as it would typically appear on the surface of a cell following antigen processing and presentation of the Foxp3 protein to a T-cell. In certain embodiments, TCRm antibodies are soluble antibodies that function like a T-Cell receptor in that they recognize the peptide presented in the HLA groove (versus the 3D topology of the complete protein from which the peptide comes) and can elicit the downstream T-cell immune effectors.
In certain non-limiting embodiments, the antibody or antigen-binding portion thereof either does not bind to its target Foxp3 peptide in the absence of its partner MHC molecule. In certain non-limiting embodiments, the antibody or antigen-binding portion thereof bind to its target Foxp3 peptide in the absence of its partner MHC molecule with a binding affinity which is at least 10-fold, or at least 100-fold, or at least 1000-fold less than the binding affininty of the antibody or antigen-binding portion thereof to the peptide/MHC complex.
The antibodies disclosed herein specifically recognize and bind to epitopes of a peptide/MHC complex (e.g., a Foxp3/HLA complex, more specifically, a Foxp3/HLA class I complex, more specifically, a Foxp3/HLA-A complex, and more specifically, a Foxp3/HLA-A2 complex, even more specifically, a Foxp3/HLA-A*02:01 complex). Examples of Foxp3 peptides that are recognized by the antigen-binding proteins of the presently disclosed subject matter as part of a human MHC-peptide complex include, but are not limited to, Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof, and Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof.
In certain embodiments, therefore, the presently disclosed subject matter provides for an isolated antibody, or an antigen-binding portion thereof, which binds to a Foxp3 peptide bound to a human MHC molecule. The Foxp3 peptide binds to the MHC molecule to form a Foxp3/MHC complex. In certain embodiments, the MHC molecule is an HLA class I molecule. In certain embodiments, the HLA class I molecule is HLA- A. In certain embodiments, the HLA-A is HLA-A2. In certain embodiments, the HLA- A2 is HLA-A*02:01.
In certain embodiments, the Foxp3 peptide is a portion of a human Foxp3 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1. In certain embodiments, the Foxp3 peptide has a length of 8-12 amino acids. In certain
embodiments, the Foxp3 peptide has a length of 9 amino acids. In certain embodiments, the Foxp3 peptide has a length of 10 amino acids.
In certain embodiments, the antibody or antigen-binding portion binds to Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8. In certain embodiments, the antibody or antigen-binding portion binds to a portion of Foxp3-7. In certain
embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof comprises a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of (a) a heavy chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 11 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 14 or a modification thereof; (b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 17 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino an acid sequence set forth in SEQ ID NO: 20 or a modification thereof; (c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 23 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 26 or a modification thereof; (d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 29 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 32 or a modification thereof; (e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 35 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 38 or a modification thereof; (f) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 41 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 44 or a modification thereof; (g) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 47 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 50 or a modification thereof; and (h) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 53 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 56 or a modification thereof. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof further comprises a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of: (a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 10 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 13 or a modification thereof; (b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 16 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 19 or a modification thereof; (c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 22 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 25 or a modification thereof; (d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 28 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 31 or a modification thereof; (e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 34 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 37 or a modification thereof; (f) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 40 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 43 or a modification thereof; (g) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 46 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 49 or a modification thereof; and (h) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 52 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 55 or a modification thereof. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof further comprises a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of: (a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 9 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 12 or a modification thereof; (b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 15 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 18 or a modification thereof; (c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 21 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 24 or a modification thereof; (d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 27 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 30 or a modification thereof; (e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 33 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 36 or a modification thereof; (f) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 39 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 42 or a modification thereof; (g) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 45 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 48 or a modification thereof; and (h) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 51 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 54 or a modification thereof.
In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14; (b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3
comprising an amino acid sequence set forth in SEQ ID NO: 20; (c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32; (e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38; (f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44; (g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50; or (h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof comprises a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44.
In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof comprises a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous, or at least about 90% homologous, or at least about 95% homologous, or at least about 98% homologous, to the sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107, and/or a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous, or at least about 90% homologous, or at least about 95% homologous, or at least about 98% homologous, to the sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108. Such antibody or antigen-binding portion thereof comprises (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94; (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96; (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98; (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100; (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102; (f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104; (g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106; or (h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-7 or a portion thereof comprises a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104.
In certain embodiments, the antibody or antigen-binding portion binds to Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-2 or a portion thereof comprises a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of: (a) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 59 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 62 or a modification thereof; (b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 65 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 68 or a modification thereof; (c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 74 or a modification thereof; (d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 77 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 80 or a modification thereof; and (e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 83 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 86 or a modification thereof. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-2 or a portion thereof further comprises a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of: (a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 58 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 61 or a modification thereof; (b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 64 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 67 or a modification thereof; (c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 70 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 73 or a modification thereof; (d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 76 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 79 or a modification thereof; and (e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 82 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 85 or a modification thereof. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-2 or a portion thereof further comprises a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of: (a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 57 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 60 or a modification thereof; (b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 63 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 66 or a modification thereof; (c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 69 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof; (d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 75 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 78 or a modification thereof; and (e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 81 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 84 or a modification thereof.
In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-2 or a portion thereof comprises (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62; (b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3
comprising an amino acid sequence set forth in SEQ ID NO: 68; (c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74; (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80; or (e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86.
In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-2 or a portion thereof comprises a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 109, 111, 113, 115, and 117, and/or a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous, or at least about 90% homologous, or at least about 95% homologous, or at least about 98% homologous, to the sequence selected from the group consisting of SEQ ID NOS: 110, 112, 114, 116, and 118. Such antibody or antigen-binding portion thereof comprises (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110; (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112; (c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114; (d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116; or (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118.
In certain embodiments, the antibody or antigen-binding portion binds to Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-2 or a portion thereof comprises a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87 or a modification thereof; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88 or a modification thereof; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89 or a modification thereof; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90 or a modification thereof; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91 or a modification thereof; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92 or a modification thereof.
In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-4 or a portion thereof comprises a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous, or at least about 90% homologous, or at least about 95% homologous, or at least about 98% homologous, to the sequence of SEQ ID NO: 119, and/or a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence of SEQ ID NOS: 120. In certain embodiments, the antibody or antigen-binding portion thereof that binds to Foxp3-4 or a portion thereof comprises a heavy chain variable region that comprises the amino acid sequence set forth in SEQ ID NO: 119, and/or a light chain variable region that comprises the amino acid sequence set forth in SEQ ID NOS: 120
The modification can be one or more deletions, insertions, and/or substitutions. The modification thereof can comprise no more than 2, no more than 3, no more than 4, or no more than 5 modifications. The modification can be a conversative modification or non-a conservative modification.
In certain embodiments, the antibody or antigen-binding portion thereof binds to the N-terminal of the Foxp3 peptide. In certain embodiments, the antibody or antigen- binding portion thereof binds to C-terminal of the Foxp3 peptide. The antibody or antigen-binding portion thereof specifically binds to the Foxp3 peptide, e.g., binds to the Foxp3 peptide with a binding affinity (KD) of 1 x 10-7 M or less.
The presently disclosed subject matter also provides for isolated antibodies or antigen-binding portions thereof, which (i) cross-compete for binding to a Foxp3 peptide bound to a human MHC molecule with any of the antibodies or antigen-binding portions thereof disclosed herein, and (ii) specifically bind to the Foxp3 peptide with a binding affinity (KD) of about 5 x 10-7 M or less.
In certain non-limiting embodiments, the antibody or antigen-binding portion thereof either does not bind to its target Foxp3 peptide in the absence of its partner MHC molecule, or does so with an affinity which is at least 10-fold, or at least 100-fold, or at least 1000-fold less.
The presently disclosed subject matter further provides for isolated antibodies or antigen-binding portions thereof, which bind to the same or a substantially overlapping equivalent epitope on Foxp3 peptide bound to a human MHC molecule with any of the antibodies or antigen-binding portions thereof disclosed herein.
In certain embodiments, the antibody or antigen-binding portion thereof is a fully human antibody or an antigen-binding portion thereof. In certain embodiments, the antibody or antigen-binding portion thereof is a chimeric antibody or an antigen-binding portion thereof. In certain embodiments, the antibody or antigen-binding portion thereof is a humanized antibody or an antigen-binding portion thereof. In certain embodiments, the antigen-binding portion of the antibody is an Fab, Fab', F(ab')2, Fv or single chain Fv (scFv). In certain embodiments, the antibody or antigen-binding portion thereof is of an IgG1, IgG2, IgG3, or IgG4 isotype. In certain embodiments, the antibody or antigen- binding portion thereof is of an IgG1 isotype. In certain embodiments, an antigen binding portion is comprised in a fusion protein with one or more non-immunoglobulin component.
In certain embodimetns, the above-described antibody comprises one or more post-translational modifications. In certain non-limiting embodiments, the one or more post-translational modifications comprise afucosylation. For example, the antibody comprises an afucosylated Fc region.
In another aspect, the presently disclosed subject matter provides for an immunoconjugate comprising a first component which is an antigen-binding protein, antibody or antigen-binding portion thereof as disclosed herein. The immunoconjugate comprises a second component that is a cytotoxin, a detectable label, a radioisotope, a therapeutic agent, a binding protein or a molecule having a second amino acid sequence. Where the second component is a binding protein or second antibody, the binding protein or second antibody has binding specificity for a target that is different from the HLA-peptide complex for which the first is specific. In a related aspect, therefore, the presently disclosed subject matter provides for a bispecific antibody comprising an antigen-binding protein or functional fragment thereof as described herein. In certain embodiments, the bispecific antibody recognizes the Foxp3 peptide bound to the MHC molecule (Foxp3/MHC complex), and a cell surface protein. In certain embodiments, the cell surface protein is CD3 or CD16.
In yet another aspect, the presently disclosed subject matter provides for antigen- binding proteins, including antibodies and chimeric antigen receptors (CARs) specific for a Foxp3 peptide/HLA complex, e.g., a Foxp3/HLA class I complex, more
specifically, a Foxp3/HLA-A complex, and more specifically, a Foxp3/HLA-A2 complex, even more specifically, a Foxp3/HLA-A*02:01 complex. The presently disclosed subject matter also provides for nucleic acid encoding the presently disclosed CARs, vectors comprising such nucleic acids, including vectors to facilitate expression and/or secretion of an antigen-binding protein (e.g., an antibody or CAR) in accordance with the presently disclosed subject matter.
In another related aspect, the presently disclosed subject matter provides for host cells comprising the nucleic acids or antigen-binding proteins disclosed herein, including recombinant immune effector cells, such as, T-cells genetically modified to express a CAR comprising an antigen-binding region in accordance with the presently disclosed subject matter. In certain embodiments, the host cell is a T cell. In certain embodiments, the host cell is a Treg cell. Cells that have been engineered to produce antibodies in accordance with the disclosure are also encompassed by the presently disclosed subject matter.
In a related aspect, the presently disclosed subject matter provides for
pharmaceutical compositions comprising the antigen-binding proteins, antibodies, nucleic acids, vectors, or cells comprising the nucleic acids or antigen-binding proteins disclosed herein, together with a pharmaceutically acceptable carrier.
In another aspect, the presently disclosed subject matter provides for a method for detecting Foxp3/MHC on the surface of cells or tissues using Foxp3 antibodies of the presently disclosed subject matter.
In another aspect, the presently disclosed subject matter provides for methods of killing a Foxp3-expressing cell in a subject. In certain embodiments, the method comprises administering to the subject an antibody or antigen-binding portion thereof (including bispecific antibody), an antigen-binding protein (including CAR), an immunoconjugate, nucleic acid encoding the antigen-binding protein or antibody or a cell comprising the nucleic acids or proteins as disclosed herein.
In another aspect, the presently disclosed subject matter provides for methods of inducing an immune response in a subject. In certain embodiments, the method comprises administering to the subject an antibody or antigen-binding portion thereof (including bispecific antibody), an antigen-binding protein (including CAR), an immunoconjugate, nucleic acid encoding the antigen-binding protein or antibody or a cell comprising the nucleic acids or proteins as disclosed herein.
In another aspect, the presently disclosed subject matter provides for methods of selectively inhibiting (e.g., inactivating, inhibiting the proliferation of or killing) regulatory T cells in a subject. In certain embodiments, the method comprises administering to the subject an antibody or antigen-binding portion thereof (including bispecific antibody), an antigen-binding protein (including CAR), an immunoconjugate, nucleic acid encoding the antigen-binding protein or antibody or a cell comprising the nucleic acids or proteins as disclosed herein. In certain embodiments, the method reduces number of regulatory T cells, depletes regulatory T cells, inhibits
immunosuppressive activity of regulatory T cells, and/or blocks regulatory T cells trafficking into lymph nodes or tumors.
In yet another aspect, the presently disclosed subject matter provides for methods for treating cancer, comprising administering to a subject suffering cancer a
therapeutically effective amount of an antibody or antigen-binding portion thereof (including bispecific antibody), an antigen-binding protein (e.g., a CAR), an
immunoconjugate, nucleic acid encoding the antigen-binding protein or antibody or a cell comprising the nucleic acids or proteins as disclosed herein, thereby inducing the death of the cancer cell in the subject. In certain embodiments, the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof. In certain embodiments, the subject is a human. In certain embodiments, the subject is a non- human animal such as but not limited to a non-human primate, a dog, a cat, a horse, a cow, a pig, a mouse, a rat, a hamster, a rabbit, etc. In certain embodiments, the cancer cell expresses Foxp3. Furthermore, the presently disclosed subject matter provides for kits for treating cancer comprising an antibody or antigen-binding portion thereof (including bispecific antibody), an antigen-binding protein (including CAR), an immunoconjugate, nucleic acid encoding the antigen-binding protein or antibody or a cell comprising the nucleic acids or proteins as disclosed herein.
BRIEF DESCRIPTION OF THE DRAWINGS
Figures 1A-1D represent peptide-specific T-cell response of Foxp3 peptides. (A) CD3 T cells from HLA-A*02:01 (also referred to as“HLA-A0201” or“HLA-A*0201”) donors were stimulated with Foxp3-4 or Foxp3-6 peptides for 3 rounds and T cell response was tested against Foxp3-1, -2, -3, -4, -5 or -6 peptides by IFN-g elispot assay. (B) T cells from the same donor were further stimulated another 2 rounds with the Foxp3-4 or -6 peptide and tested against Foxp3-4 or Foxp3-6 peptide. (C and D) T cells from a different HLA-A2+ donor were stimulated with Foxp3-1 or-3 (3 rounds), or Foxp3-2 or -5 peptide (5 rounds) and the peptide-specific T cell response was tested against the stimulating peptide. Controls: CD14+APCs and CD14+ cells pulsed with irrelevant peptide EW. Data represent the mean value+/- SD from triplicate micro-well cultures.
Figures 2A-2D represent peptide-specific T-cell response of Foxp3 peptides. (A and B)CD3 T cells from a third HLA-A*02:01+ donor were stimulated with indicated Foxp3 peptides for 5 rounds and tested against the stimulating peptides. In a different experiment, T cells stimulated with Foxp3-4, 6 or -7 peptide were tested against the stimulating peptide pulsed onto autologous CD14+ APCs (C), Un-pulsed Foxp3+ HLA- A2+cell lines MAC-1, MAC2A, Foxp3+HLA-A2-cell line Jurkat or CD4+CD25+/HLA- A2+ Treg cells generated in vitro were used as target cells (D).
Figure 3 represents epitope-specific T cell response of Foxp3 peptides. CD3 T cells from a HLA-A*02:01+ donor were stimulated with the Foxp3-peptides 1, 2, 4, 5, 6 or 7 for 4 rounds and the recognition of Foxp3 is tested against Foxp3+/HLA-A2+ cell lines MAC-1, MAC-2A or Foxp3+/HLA-A2- cell line Jurkat, by IFN-γ ELISPOT assay.
Figures 4A-4F represent peptide-specific T cell cytotoxicity of Foxp3 peptides. CD3 T cells from a HLA-A*02:01+ donor were stimulated with Foxp3-derived peptides Foxp3-1, -2, -4, (A, C, and E) -5, -6 or-7 (B, D and F) for 5 rounds and the cytotoxicity against the stimulating peptides on T2 cells was measured by 51Cr-release assay. T2 cells alone or pulsed with EW were used as negative controls. Each data point represents average +/- SD from triplicate cultures.
Figures 5A-5D represent induction of peptide-specific T cell response by Foxp3- TLI in the context of HLA-A0201 molecule. (A) CD3 T cells from HLA-A0*201+Foxp3 donors were stimulated with Foxp3-TLI peptide for four rounds and T cell response was tested against TLI peptide or with irrelevant peptide EW by IFN-γ elispot assay.
CD14+APC serve as a negative control. (B) TLI-stimulated T cells also recognize HLA- A0201+ Treg-like cell lines MAC-1 and MAC-2A cells but not HLA-A0*201- Jurkat cells. (C and D) T cells from the same donor were stimulated for five rounds and the cytotoxicity was measured by 51Cr-release assay against the stimulating peptides pulsed onto T2 cells (C) or unpulsed target cells (D) by 51Cr-release assay. HLA-A0*201 negative AML cell line HL-60 were used as a negative control. (C) The T-cells were able to kill T2 cells pulsed with Foxp3 peptide, and (D) MAC-1 and MAC-2A cells but not HLA-A0201-HL-60 cells. Each data point represents average +/- SD from triplicate cultures.
Figures 6A-6J represent binding of the phage scFv clones to T2 cells pulsed with Foxp3-7 peptide, Foxp3-2 peptide and Foxp3-4 peptide. (A) Representative data from flow cytometry analysis on T2 cells for phage clones specific for the Foxp3-7 peptide. Negative controls were no second antibody, no antibody, and an irrelevant antibody Pr435. T2 cells alone (B, D, F), pulsed with control peptide R3 (C, G), or pulsed with EW peptide (E, H). (I) Representative data from flow cytometry analysis on T2 cells for phage clones specific for the Foxp3-2 peptide. (J) Representative data from flow cytometry analysis on T2 cells for phage clones specific for the Foxp3-4 peptide. Phage clones #9, 11, 17, 18, 21, 26, 27, 28, 32 did not show any significant binding to T2 cells alone or pulsed with R3 peptide, but bound to the T2 cells pulsed with Foxp3-7 peptide, with the strongest binding of clone #32. The data represent the data from five similar experiments. Staining controls include unstained cells, secondary mAb (GAM) or irrelevant phage Pr435-#20.
Figures 7A-7C represent binding of the indicated bi-specific antibody (BsAb) (also referred to as“BiTE”) constructs to Foxp3+/HLA-A2+ T lymphoma cell lines MAC-1, MAC-2A, and CD3+ T cell line Jurkat. (A) Binding of the indicated BsAb constructs to Foxp3+/HLA-A2+ T lymphoma cell line MAC-1. Since the BsAb constructs were myc-tagged, the binding was tested by staining the cells with the BsAbs, followed by a secondary mAb, mouse anti-myc conjugated to FITC. Controls included unstained cell, control BsAb NC-16 or secondary mAb GA6xHis. HLA-A2 expression was measured by staining the cells with anti-A2 mAb BB7 and its isotype control mouse IgG2b, as indicated. Binding strength is shown by median fluorescent intensity.(B) Binding of the indicated BsAb constructs to Foxp3+/HLA-A2+ T lymphoma cell line MAC-2A. Controls included unstained cell, control BsAb NC-16 or secondary mAb GA6xHis. HLA-A2 expression was measured by staining the cells with anti-A2 mAb BB7 and its isotype control mouse IgG2b, as indicated. Binding strength is shown by median fluorescent intensity. (C) Similarly, the binding of the #32 BiTE to CD3 arm was measured on CD3+ T cell line Jurkat, as described in (A).. Controls included unstained cell, control BsAb NC-16 or secondary mAb GA6xHis. HLA-A2 expression was measured by staining the cells with anti-A2 mAb BB7 and its isotype control mouse IgG2b, as indicated. Binding strength is shown by median fluorescent intensity.
Figures 8A-8B represent epitope specificity. (A) The Foxp3-TLI peptide sequence was substituted with alanine at positions 1, 2, 3, 4, 5, 7, 8, 9 or with glycine (G10) at position ten (sequences in Figures 8A-8B). T2 cells were pulsed with indicated peptides at 50ug/ml and the binding of #32-BiTE was measured by flow cytometry. (B) Cells were simultaneously stained with anti-HLA-A2 mAb, clone BB7.2, to measure the relative binding of the peptides to HLA-A2 molecule.
Figures 9A-9E represent specific binding of #32 mAb to natural Treg cells in PBMC in healthy donors. PBMCs were stained with mAbs specific for CD4, CD25 CD127 and mAb#32 mouse IgG1. Data show the binding of mAb #32 to CD4+CD25 highCD127 low Tregs (A), CD4+25 highCD127high population (B), CD8+CD25highCD127 high (C) from aHLA-A0*201+ donor, or CD4+CD25 highCD127low Tegs from a HLA-A-0*201 negative donor (D, E). Data show representative results from 3 sets of different individuals. #32 mAb recognizes CD4+CD25highCD127 low Tregs from HLA-A0201+ donor (A) but not HLA-A-0*201 negative donors (D, E).
Figures 10A-10B represent specific binding of #32 mAb to Treg cells in vitro generated from a HLA-A*02:01+ donor. The results were similar between Tregs generated by either (A) allo-PBMC or (B) MAC-2A cell stimulation. CD4+ T cells were FACS sorted and stimulated with allo-PBMC or allo-tumor (MAC-2A) in the presence of IL-2 (100 unit) and TGF-β (10ng/ml) for a week. Cells were stained with mAbs to CD4, CD25, foxp3 and mAb #32/APC. Mab #32 binding was determined by gating on the DAPI-, CD4 and CD25 double positive cells. The data shows an overlay of mouse mAb #32 (red) and its isotype control mouse IgG1 (green) and rat isotype control for mAb to foxp3 (orange).. #32 mAb only bound to CD4+CD25+Foxp3+ Tregs.
Figures 11A-11E represents BiTE#32-mediated T cell killing against Foxp3+ T lymphoma cells. PBMCs were incubated with TLI-pulsed T2 cells (A: blue line: #32 BiTE against T2 alone; red: control BiTE against T2 alone; green: #32 BiTE against T2 pulsed with TLI peptide; purple: control BiTE against T2 pulsed with TLI peptide; light blue: #32 BITE against T2 pulsed with EW peptide; orange: control BiTE against T2 pulsed with control peptide), HL-60 (B), MAC-1 (C), MAC-2A (D), or Jurkat (E) target cells at an E: T ratio of 50:1, with or without BiTEs at the concentrations ranging from 1ug/ml to 0.0003 ug/ml. The cytotoxicity was measured by 5 hr 51Crelease assay. The data represent the mean value of triplicate microwell cultures.
Figures 12A-12D represent #32 BsAb-mediated T cell killing against Treg from a HLA-A*02:01+ donor. (A and B) Non HLA- A2 T cells were incubated with T reg clones (T reg clone 1 (A) and T reg clone 3 (B)) generated from a HLA-A*02:01+ donor in the presence or absence of BsAb #32 or control BsAb (1 µg/ml) at an E: T ratio 5:1, overnight. The percentage of Foxp3+ cells in A2+T cells was determined by flow cytometry. Foxp3+ cells were gated on HLA-A2+ (BB7.2). Reduction of the HLA- A2+Foxp3+ cells indicated the #32 BsAb-mediated T cell killing. Data shows a representative data from duplicate cultures. (C) Flow cytometer data shown in Figures 12A and 12B was summarized as a bar graph to show the reduction of percent Treg cells. Each data point shows the average of duplicate cultures. (D) T reg cells lysis data of #32 BsAb, control- BsAb and No BsAb.
Figures 13A-13H represent histograms of the 8 EXT017-phage binding to T2 cells loaded with the panel of alanine mutants. (A) Histogram of EXT017-17 phage binding to T2 cells loaded with the panel of alanine mutants. (B) Histogram of EXT017- 18 phage binding to T2 cells loaded with the panel of alanine mutants. (C) Histogram of EXT017-20 phage binding to T2 cells loaded with the panel of alanine mutants. (D) Histogram of EXT017-27 phage binding to T2 cells loaded with the panel of alanine mutants. (E) Histogram of EXT017-28 phage binding to T2 cells loaded with the panel of alanine mutants. (F) Histogram of EXT017-32 phage binding to T2 cells loaded with the panel of alanine mutants. (G) Histogram of EXT017-53 phage binding to T2 cells loaded with the panel of alanine mutants. (H) Histogram of EXT017-53 phage binding to T2 cells loaded with the panel of alanine mutants.
DETAILED DESCRIPTION
I. Definitions
Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of ordinary skill in the art with a general definition of many of the terms used in the presently disclosed subject matter: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed.1994); The
Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991); Molecular Cloning: a Laboratory Manual 3rd edition, J. F. Sambrook and D. W. Russell, ed. Cold Spring Harbor
Laboratory Press 2001; Recombinant Antibodies for Immunotherapy, Melvyn Little, ed. Cambridge University Press 2009;“Oligonucleotide Synthesis” (M. J. Gait, ed., 1984); “Animal Cell Culture” (R. I. Freshney, ed., 1987);“Methods in Enzymology” (Academic Press, Inc.);“Current Protocols in Molecular Biology” (F. M. Ausubel et al., eds., 1987, and periodic updates);“PCR: The Polymerase Chain Reaction”, (Mullis et al., ed., 1994); “A Practical Guide to Molecular Cloning” (Perbal Bernard V., 1988);“Phage Display: A Laboratory Manual” (Barbas et al., 2001). The contents of these references and other references containing standard protocols, widely known to and relied upon by those of skill in the art, including manufacturers' instructions are hereby incorporated by reference as part of the presently disclosed subject matter. As used herein, the following terms have the meanings ascribed to them below, unless specified otherwise.
The following abbreviations are used throughout the present application:
Ab: Antibody
ADCC: Antibody-dependent cellular cytotoxicity
ALL: Acute lymphocytic leukemia
AML: Acute myeloid leukemia
APC: Antigen presenting cell
β2M: Beta-2-microglobulin
BiTE: Bi-specific T cell engaging antibody
CAR: Chimeric antigen receptor CDC: Complement dependent cytotoxicity
CMC: Complement mediated cytotoxicity
CDR: Complementarity determining region
CL: Constant domain of the light chain
CH1: 1st constant domain of the heavy chain
CH1, 2, 3: 1st, 2nd and 3rd constant domains of the heavy chain
CH2, 3: 2nd and 3rd constant domains of the heavy chain
CHO: Chinese hamster ovary
CTL: Cytotoxic T cell
E:T Ratio: Effector:Target ratio
Fab: Antibody binding fragment
FACS: Flow assisted cytometric cell sorting
FBS: Fetal bovine serum
FR: Framework region
HC: Heavy chain
HLA: Human leukocyte antigen
Ig: Immunoglobulin
IRES: Internal ribosome entry site
KD: Dissociation constant
koff: Dissociation rate
kon: Association rate
MHC: Major histocompatibility complex
MM: Multiple myeloma
scFv: Single-chain variable fragment
TCR: T cell receptor
TIL: Tumor infiltration lymphocyte
TLI: Foxp3-7 peptide (sequence TLIRWAILEA (SEQ ID NO: 8))
VH: Variable heavy chain includes heavy chain hypervariable region and heavy chain variable framework region
VL: Variable light chain includes light chain hypervariable region and light chain variable framework region
Foxp3: Foxhead box P3 As used herein, the term“about” or“approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example,“about” can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively,“about” can mean a range of up to 20%, e.g., up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, e.g., within 5-fold, or within 2-fold, of a value.
As used herein, the term“cell population” refers to a group of at least two cells expressing similar or different phenotypes. In non-limiting examples, a cell population can include at least about 10, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, at least about 1000 cells expressing similar or different phenotypes.
As used herein, the term“antigen-binding protein” refers to a protein or polypeptide that comprises an antigen-binding region or antigen-binding portion, that is, has a strong affinity to another molecule to which it binds. Antigen-binding proteins encompass antibodies, chimeric antigen receptors (CARs) and fusion proteins.
The terms“antibody” and“antibodies” refer to antigen-binding proteins of the immune system. As used herein, the term“antibody” includes whole, full length antibodies having an antigen-binding region, and any fragment thereof in which the “antigen-binding portion” or“antigen-binding region” is retained, or single chains, for example, single chain variable fragment (scFv), thereof. The term“antibody” means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term “antibody” means not only intact immunoglobulin molecules but also the well-known active fragments F(ab')2, and Fab. F(ab')2, and Fab fragments that lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med.24:316-325 (1983). In certain embodiments, an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant (CH) region. The heavy chain constant region is comprised of three domains, CH1, CH2 and CH3. Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant CL region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further sub- divided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs arranged from amino- terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (C1 q) of the classical complement system.
The term“antigen-binding portion”,“antigen-binding fragment”, or“antigen- binding region” of an antibody, as used herein, refers to that region or portion of an antibody that binds to the antigen and which confers antigen specificity to the antibody; fragments of antigen-binding proteins, for example, antibodies includes one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., an peptide/HLA complex). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of antigen- binding portions encompassed within the term“antibody fragments” of an antibody include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CH1 domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., 1989 Nature 341:544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules. These are known as single chain Fv (scFv); see e.g., Bird et al., 1988 Science 242:423-426; and Huston et al., 1988 Proc. Natl. Acad. Sci.85:5879-5883. These antibody fragments are obtained using conventional techniques known to those of ordinary skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
An“isolated antibody” or“isolated antigen-binding protein” is one which has been identified and separated and/or recovered from a component of its natural environment.“Synthetic antibodies” or“recombinant antibodies” are generally generated using recombinant technology or using peptide synthetic techniques known to those of skill in the art.
As used herein, the term“single-chain variable fragment” or“scFv” is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an
immunoglobulin (e.g., mouse or human) covalently linked to form a VH::VL
heterodimer. The heavy (VH) and light chains (VL) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N- terminus of the VH with the C-terminus of the VL, or the C-terminus of the VH with the N-terminus of the VL. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility. Despite removal of the constant regions and the introduction of a linker, scFv proteins retain the specificity of the original
immunoglobulin. Single chain Fv polypeptide antibodies can be expressed from a nucleic acid comprising VH - and VL -encoding sequences as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). See, also, U.S. Patent Nos.5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos.20050196754 and
20050196754. Antagonistic scFvs having inhibitory activity have been described (see, e.g., Zhao et al., Hyrbidoma (Larchmt) 200827(6):455-51; Peter et al., J Cachexia Sarcopenia Muscle 2012 August 12; Shieh et al., J Imunol2009183(4):2277-85;
Giomarelli et al., Thromb Haemost 200797(6):955-63; Fife eta., J Clin Invst 2006 116(8):2252-61; Brocks et al., Immunotechnology 19973(3):173-84; Moosmayer et al., Ther Immunol 19952(10:31-40). Agonistic scFvs having stimulatory activity have been described (see, e.g., Peter et al., J Bioi Chern 200325278(38):36740-7; Xie et al., Nat Biotech 199715(8):768-71; Ledbetter et al., Crit Rev Immunol199717(5-6):427-55; Ho et al., BioChim Biophys Acta 20031638(3):257-66).
As used herein,“F(ab)” refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have a Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen). As used herein,“F(ab')2” refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab') (bivalent) regions, wherein each (ab') region comprises two separate amino acid chains, a part of a H chain and a light (L) chain linked by an S-S bond for binding an antigen and where the remaining H chain portions are linked together. A“F(ab')2” fragment can be split into two individual Fab' fragments.
As used herein, the term“vector” refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
As used herein, the term“expression vector” refers to a recombinant nucleic acid sequence, e.g., a recombinant DNA molecule, containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism. Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences. Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
As used herein,“CDRs” are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of
immunoglobulin heavy and light chains. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987). Generally, antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region. CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope. In certain embodiments, the CDRs regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S.
Department of Health and Human Services, NIH Publication No.91-3242).
As used herein, the term“affinity” is meant a measure of binding strength.
Without being bound to theory, affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups.
Affinity also includes the term“avidity,” which refers to the strength of the antigen- antibody bond after formation of reversible complexes. Methods for calculating the affinity of an antibody for an antigen are known in the art, comprising use of binding experiments to calculate affinity. Antibody activity in functional assays (e.g., flow cytometry assay) is also reflective of antibody affinity. Antibodies and affinities can be phenotypically characterized and compared using functional assays (e.g., flow cytometry assay).
Nucleic acid molecules useful in the presently disclosed subject matter include any nucleic acid molecule that encodes an antibody or an antigen-binding portion thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence. Polynucleotides having“substantial homology” or“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. Homology and the percent homology can be determined by standard software programs such as BLAST or FASTA. By“hybridize” is meant pair to form a double-stranded molecule between
complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol.152:399; Kimmel, A. R. (1987) Methods Enzymol.152:507).
For example, stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate. Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide. Stringent temperature conditions will ordinarily include temperatures of at least about 30°C, more preferably of at least about 37°C, and most preferably of at least about 42°C. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art. Various levels of stringency are accomplished by combining these various conditions as needed. In a preferred:
embodiment, hybridization will occur at 30°C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS. In a more preferred embodiment, hybridization will occur at 37°C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 µg/ml denatured salmon sperm DNA (ssDNA). In a most preferred embodiment, hybridization will occur at 42°C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 µg/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
For most applications, washing steps that follow hybridization will also vary in stringency. Wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt
concentration or by increasing temperature. For example, stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate. Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25°C, more preferably of at least about 42°C, and even more preferably of at least about 68°C. In a preferred embodiment, wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42° C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68°C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Rogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
As used herein, the term“cross-compete” or“compete” refers to the situation where binding of a presently disclosed antibody or an antigen-binding portion thereof to a given antigen, e.g., a Foxp3 peptide or a Foxp3/HLA class I complex (e.g., a
Foxp3/HLA-A complex, e.g., a Foxp3/HLA-A2 complex, e.g., a Foxp3/HLA-A*02:01 complex), decreases or reduces binding of a reference antibody or an antigen-binding portion thereof, e.g., that comprises the VH and VL CDR1, CDR2, and CDR3 sequences or VH and VL sequences of any of the presently disclosed antibodies or antigen-binding portions thereof to the same antigen. The term“cross-compete” or“compete” also refers to the situation where binding of a reference antibody or an antigen-binding portion thereof to a given antigen, e.g., a Foxp3 peptide or a Foxp3/HLA class I complex (e.g., a Foxp3/HLA-A complex, e.g., a Foxp3/HLA-A2 complex, e.g., a Foxp3/HLA-A*02:01 complex), decreases or reduces binding of a presently disclosed antibody or an antigen- binding portion thereof to the same antigen. The“cross-competing” or“competing” antibodies or antigen-binding portions thereof bind to the same or substantially the same epitope, an overlapping or substantially overlapping epitope, or an adjacent epitope on the antigen (e.g., a Foxp3 peptide or a Foxp3/HLA class I complex (e.g., a Foxp3/HLA- A complex, e.g., a Foxp3/HLA-A2 complex, e.g., a Foxp3/HLA-A*02:01 complex)) as the reference antibody or antigen-binding portion thereof.
As used herein, an“effective amount” or“therapeutically effective amount” is an amount sufficient to affect a beneficial or desired clinical result upon treatment. An effective amount can be administered to a subject in one or more doses. In terms of treatment, an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease. The effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the immunoresponsive cells administered.
As used herein, the term“heterologous nucleic acid molecule or polypeptide” refers to a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell. This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
As used herein, the term“increase” refers to alter positively by at least about 5%, including, but not limited to, alter positively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
As used herein, the term“reduce” refers to alter negatively by at least about 5% including, but not limited to, alter negatively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
As used herein, the term“isolated,”“purified,” or“biologically pure” refers to material that is free to varying degrees from components which normally accompany it as found in its native state.“Isolate” denotes a degree of separation from original source or surroundings.“Purify” denotes a degree of separation that is higher than isolation. A “purified” or“biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or polypeptide of the presently disclosed subject matter is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid
chromatography. The term“purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
As used herein, the term“specifically binds” or“specifically binds to” or “specifically target” is meant a polypeptide or fragment thereof (including an antibody or an antigen-binding portion thereof) that recognizes and binds a biological molecule of interest (e.g., a Foxp3/MHC complex, (e.g., a Foxp3/HLA complex, more specifically, a Foxp3/HLA class I complex, more specifically, a Foxp3/HLA-A complex, more specifically, a Foxp3/HLA-A2 complex, or more specifically, a Foxp3/HLA-A*02:01 complex), but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample. In certain embodiments, an antibody or an antigen-binding portion thereof that“specifically binds to a Foxp3/MHC complex” refers to an antibody or an antigen-binding portion thereof that binds to a Foxp3/MHC complex with a KD of 5 x 10-7 M or less, 1 x 10-7 M or less, 5 x 10-8 M or less, 1 x 10-8 M or less, 5 x 10-9 M or less, 1 x 10-9 M or less, 5 x 10-10 M or less, 1 x 10-10 M or less, 5 x 10-11 M or less, or 1 x 10-11 M or less.
As used herein, the term“treating” or“treatment” refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. By preventing progression of a disease or disorder, a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
As used herein, the term“subject” refers to any animal (e.g., a mammal), including, but not limited to, humans, and non-human animals (including, but not limited to, non-human primates, dogs, cats, rodents, horses, cows, pigs, mouses, rats, hamsters, rabbits, and the like (e.g., which is to be the recipient of a particular treatment, or from whom cells are harvested). In certain embodiments, the subject is a human.
II. Foxp3 and Treg Cells
Foxp3 has been identified as a key player in Treg function, and is the most definitive marker of CD4+CD25+ Treg cells. Foxp3 is required for Treg cell lineage differentiation, maintenance and suppressive function. Apart from naturally occurring Treg cells that arise in the thymus, inducible Treg cells have been identified, with predominance in infection and cancer. Extrathymic generation of Treg cells requires Foxp3 induction by suboptimal antigen stimulation of CD4+T cells in the presence of transforming growth factor (TGF)-β. Analysis of Foxp3 expression in tumor-infiltrating lymphocytes (TILs) has shown that the accumulation of Treg cells correlates with poor prognosis in many cancer types, including breast, lung, melanoma, ovarian and pancreatic cancers (1-4). Therapeutically targeting the Treg population promote antitumor immunity and tumor rejection in mouse models of various types of cancer (5, 6). It has also been shown in patients that depletion of Treg cells enhances vaccine- mediated anti-tumor immunity in pancreatic cancer and induces regression of melanoma metastasis (7-9). These studies demonstrate a prominent tumor-promoting role of Treg cells in cancer by suppression of immune response.
In addition to the accumulation of Foxp3+ Treg cells in tumor infiltrating lymphocytes (TIL)s, local lymph nodes and the blood of cancer patients, which confers growth and metastatic advantage of cancer cells by inhibiting anti-tumor immunity, the expression of Foxp3 has also been shown in some cancer cells. Foxp3-expressing pancreatic carcinoma cells and cutaneous T cell lymphoma cells have been shown to suppress T cell proliferation (2, 11). Therefore, cancer cells may share suppressive effects with regulatory T (Treg) cells, and that mimicking Treg function may represent a new mechanism of immune evasion in cancer.
Overall, Treg cells are considered the most powerful inhibitors of anti-tumor immunity and the greatest barrier to successful immunotherapy. A number of strategies for depletion or interference with Treg function have been attempted. These include: depletion of Treg by monoclonal antibodies (mAb) specific for CD25, glucorticoid- induced TNF-related protein (GITR) and ligand-directed toxins targeted to cell surface receptor CD25 (such as Dennileukin diftitox). However, both CD25 and GITR are expressed not only in Treg cells, but also in activated CD4 and CD8 effector T cells. In addition, disruption of tumor homing by Treg, and modulation of T cell plasticity have all been attempted. The problem with these strategies is a lack of specificity, resulting in depletion of the beneficial anti-tumor effector T cells.
Hence there is a need for drugs that could selectively inhibit Treg cells. To the best knowledge of the inventors, no drugs could selectively inhibit Treg cells, no effective targets for Treg cells on the cell surface that could be or are currently being used to suppress Treg cells or to kill Treg cells, and no selective drugs that can deplete Treg cells.
Foxp3 is an ideal target except that it is no druggable by small molecules and it is inside the cell so antibody therapy is not feasible. However, peptides from Foxp3 protein that are degraded and processed for cell surface presentation can serve as a target of a TCR mimic antibody. TCR-mimic antibodies specific for Foxp3-derived epitopes specifically and directly deplete Foxp3+ Treg cells and tumor cells. The depletion of Treg cells can greatly unleash anti-tumor immunity by removing immunosuppression caused by both Treg cells and tumor cells.
Tregs can be identified using various surface cell markers, such as CD4 (cluster of differentiation 4) and CD25 (alpha chain of IL-2 receptor). Additionally, it is known that activated conventional T cells can transiently express Foxp3. The expression of CD127 can be used as a cell marker to distinguish activated conventional T cells from Tregs. CD127 is also known asthe alpha chain of IL-7 receptor. It has been found that Tregs express low CD127, whereas activated T cells express high CD127.
In certain embodiments, Tregs are identified by one or more of presence of CD4 (CD4+), low expression level of CD127 (CD127low), high expression level of CD25 (CD25high), and high expression level of Foxp3 (Foxp3high). In certain embodiments, Tregs are identified by the presence of CD4 and high expression level of CD25, e.g., CD4+CD25high T cells. In certain embodiments, Tregs are identified by the presence of CD4, and low expression level of CD127,e.g., CD4+CD127low T cells. In certain embodiments, Tregs are identified by the presence of CD4, high expression level of CD25 and low expression level of CD127, e.g., CD4+CD25highCD127low T cells.
In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more Treg cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more T cell selected from the group consisting of CD4+ T cells, CD127low T cells, CD25high T cells, Foxp3 high T cells, and combinations thereof. The combinations include all possible combinations including CD4+ T cells, CD127low T cells, CD25high T cells, and Foxp3 high T cells: e.g., any two of CD4+ T cells, CD127low T cells, CD25high T cells, and Foxp3 high T cells (e.g., CD4+ CD127low T cells, CD4+ CD25high T cells, CD4+ Foxp3 high T cells, CD127low CD25high T cells, D127lowFoxp3 high T cells, or CD25high Foxp3 high T cells), any three of CD4+ T cells, CD127low T cells, CD25high T cells, and Foxp3 high T cells (e.g., CD4+ CD127low CD25high T cells, CD4+CD127low Foxp3 high T cells, CD4+ CD25high Foxp3 high T cells, or CD127low CD25high Foxp3 high T cells), and all four of CD4+ T cells, CD127low T cells, CD25high T cells, and Foxp3 high T cells (e.g., CD4+ CD127low CD25high Foxp3 high T cells).
In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD127low T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more Foxp3high T cell. In certain embodiments, a presently disclosed antibody or antigen- binding portion thereof binds to one or more CD25high T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4+ T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4+CD25high T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4+CD127low T cell. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to one or more CD4+CD25highCD127low T cell. III. Anti-Foxp3 Antibodies Targeting Foxp3/MHC Peptide Complex
The presently disclosed subject matter employs an approach to obtaining therapeutic antibodies to any protein, including those proteins that are inaccessible because they are not expressed on the cell surface, e.g., Foxp3.
In order to target antigens derived from intracellular or nuclear proteins, development of a therapeutic antibody an uncommon approach is required. This approach is to generate recombinant antibodies (Abs, e.g., monoclonal Abs (mAb)) that recognize the peptide/MHC complex expressed on the cell surface, with the same specificity as a T-cell receptor (TCR). Such Abs share functional homology with TCRs regarding target recognition, but confer higher affinity and capabilities of arming with potent cytotoxic agents that antibodies feature. Technically, TCR-like mAbs may be generated by conventional hybridoma techniques or by in vitro antibody library techniques known to those of skill in the art, to produce human, humanized or chimeric antibodies.
Only 10% of a cell’s proteins are destined for expression on the cell surface. Therefore, monoclonal antibodies do not exist for the vast majority of proteins. In contrast, nearly all proteins within the cell are processed and presented on the cell surface as peptides within the context of MHC molecules for recognition by T cell receptors. Traditionally, the MHC-peptide complex could only be recognized by a T-cell receptor (TCR), limiting the ability to detect an epitope of interest using T cell-based readout assays. Phage display methodology now has enabled the reliable generation of monoclonal antibodies to these unique epitopes, thus opening the door to a new universe of antigens that were previously inaccessible. The use of phage display libraries has made it possible to select large numbers of antibody repertoires for unique and rare antibodies against very defined epitopes (for more details on phage display (see
McCafferty et al., Nature, 348: 552-554.). The rapid identification of human Fab or scFv fragments highly specific for tumor antigen-derived peptide-MHC complex molecules has thus become possible (Noy, Expert Rev Anticancer Ther 2005:5 (3): 523-536.
Chames et al., Proc Nalt Acad Sci USA 2000; 97: 7969-7974; Held et al., Eur J.
Immunol.2004: 34:2919-2929; Lev et al., Cancer Res 2002; 62: 3184-3194). Immuno- toxins, generated by fusing TCR-like Fab specific for melanoma Ag MART-126-35/A2 or gp100280-288/A2 to a truncated form of Pseudomonas endotoxin, have been shown to inhibit human melanoma growth both in vitro and in vivo (Klechevsky et al., Cancer Res 2008; 68 (15): 6360-6367). The presently disclosed subject matter involves the development of a TCR-like, fully human Ab (e.g., mAb) that recognizes, for example, the Foxp3 peptide/HLA-A2 complex for cancer therapy. Therefore, the presently disclosed subject matter provides for methods and compositions to construct phage- antibody reagents that will recognize specific MHC/peptide complexes on the cell surface in order to vastly expand Treg specific targets. The presently disclosed subject matter provides for antibodies (e.g., monoclonal antibodies) to the neo-epitopes of peptide/MHC complexes derived from the prototypical intracellular Treg marker, Foxp3.
In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a high binding affinity, for example with a KD of about 5 x 10-7 M or less, e.g., about 1 x 10-7 M or less, about 5 x 10-8 M or less, about 1 x 10-8 M or less, about 5 x 10-9 M or less about 1 x 10-9 M or less, about 5 x 10-10 M or less, about 1 x 10-10 M or less, about 5 x 10-11 M or less, or about 1 x 10-11 M or less. In certain embodiments, a presently disclosed antibody or antigen- binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of from about 1 x 10-11 M to about 5 x 10-7 M, e.g., from about 1 x 10-11 M to about 1 x 10-10 M, from about 1 x 10-11 M to about 5 x 10-11 M, from about 5 x 10-11 M to about 1 x 10-10 M, from about 1 x 10-10 M to about 1 x 10-9 M, from about 1 x 10-10 M to about 5 x 10-10 M, from about 5 x 10-10 M to about 1 x 10-9 M, from 1 x 10-9 M to about 1 x 10-8 M, from 1 x 10-9 M to about 5 x 10-9 M, from 5 x 10-9 M to about 1 x 10-8 M, from about 1 x 10-8 M to about 1 x 10-7 M, from about 1 x 10-8 M to about 5 x 10-8 M, or from about 5 x 10-8 M to about 1 x 10-7 M. In certain embodiments, a presently disclosed antibody or antigen- binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of from about 1 x 10-7 M to about 2.5 x 10-7 M, e.g., from about 1 x 10-7 M to about 1.5 x 10-7 M, from about 1.5 x 10-7 M to about 2 x 10-7 M, or from about 2 x 10-7 M to about 2.5 x 10-7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 1.4 x 10-7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 1.9 x 10-7 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 2.2 x 10-7 M. In certain
embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of from about 3 x 10-8 M to about 7 x 10-8 M, e.g., from about 3 x 10-8 M to about 4 x 10-8 M, from about 4 x 10-8 M to about 5 x 10-8 M, from about 5 x 10-8 M to about 6 x 10-8 M, or from about 6 x 10-8 M to about 7 x 10-8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 3.3 x 10-8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 3.5 x 10-8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 4.8 x 10-8 M. In certain
embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 4.9 x 10-8 M. In certain
embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 5 x 10-8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 7 x 10-8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 7.2 x 10-8 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of from about 1 x 10-10 M to about 5 x 10-10 M, e.g., from about 1 x 10-10 M to about 2 x 10-10 M, from about 2 x 10-10 M to about 3 x 10-10 M, from about 3 x 10-10 M to about 4 x 10-10 M M, or 4 x 10-10 M to about 5 x 10-10 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 2 x 10-10 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 5 x 10-10 M. In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to a Foxp3 peptide/MHC complex with a KD of about 4.6 x 10-10 M.
In the presently disclosed subject matter, antigen-binding proteins, including antibodies, having an antigen-binding region based on scFvs that are selected from human scFv phage display libraries using recombinant HLA-peptide complexes are described. These molecules demonstrated exquisite specificity, for example as shown with anti-Foxp3 antibodies that recognize only Foxp3/MHC complexes (e.g.,
Foxp3/HLA complexes, more specifically, Foxp3/HLA class I complexes, more specifically, Foxp3/HLA-A complexes, more specifically, Foxp3/HLA-A2 complexes, and more specifically, Foxp3/HLA-A*02:01 complexes). In addition, along with their inability to bind to MHC-complexes containing other peptides, the molecules are also unable to bind to the peptides themselves, further demonstrating their TCR-like specificity.
Recombinant antibodies with TCR-like specificity represent a new and valuable tool for research and therapeutic applications in tumor immunology and immunotherapy. Foxp3 is a well-established and validated Treg marker.
The presently disclosed antigen-binding portion can be a Fab, Fab′, F(ab′)2, Fv or a single chain variable fragment (scFv). In certain non-limiting embodiments, the presently disclosed antigen-binding portion thereof is a scFv. In certain embodiments, the scFv is a human scFv. The scFvs of the presently disclosed subject matter selected by phage display are initially tested for their ability to bind to peptide presented on the surface of HLA-positive cells. After T2 cells are incubated in the presence of peptide, fluorescently labeled antibodies can be used to selectively recognize the antigen pulsed cells using flow cytometry.
In certain embodiments, the presently disclosed subject matter provides for antibodies that have the scFv sequence fused to one or more constant domains of the heavy or light chain variable region of the antibodies to form an antibody with an Fc region of a human immunoglobulin to yield a bivalent protein, increasing the overall avidity and stability of the antibody. In addition, the Fc portion allows the direct conjugation of other molecules, including but not limited to fluorescent dyes, cytotoxins, radioisotopes, etc. to the antibody for example, for use in antigen quantitation studies, to immobilize the antibody for affinity measurements, for targeted delivery of a therapeutic agent, and/or to test for Fc-mediated cytotoxicity using immune effector cells and many other applications.
The molecules of the presently disclosed subject matter are based on the identification and selection of scFv using phage display, the amino acid sequence of which confers the molecules’ specificity for the MHC restricted peptide of interest and forms the basis of all antigen-binding proteins of the disclosure. The scFv, therefore, can be used to design a diverse array of“antibody” molecules, including, for example, full length antibodies, fragments thereof, such as Fab and F(ab′)2, minibodies, fusion proteins, including scFv-Fc fusions, multivalent antibodies, that is, antibodies that have more than one specificity for the same antigen or different antigens, for example, bispecific T-cell engaging antibodies (BiTe), tribodies, etc. (see Cuesta et al.,
Multivalent antibodies: when design surpasses evolution. Trends in Biotechnology 28:355-3622010).
In constructing a recombinant immunoglobulin, appropriate amino acid sequences for constant regions of various immunoglobulin isotypes and methods for the production of a wide array of antibodies are known to those of ordinary skill in the art.
Phage display technology allows for the rapid selection and production of antigen-specific scFv and Fab fragments, which are useful in and of themselves, or which can be further developed to provide complete antibodies, antigen binding proteins or antigen binding fragments thereof. Complete Abs with Fc domains have a number of advantages over the scFv and Fab antibodies. First, only full length Abs exert immunological function such as CDC and ADCC mediated via Fc domain. Second, bivalent mAbs offer stronger antigen-binding affinity than monomeric Fab Abs. Third, plasma half- life and renal clearance will be different with the Fab and bivalent mAb. The particular features and advantages of each can be matched to the planned effector strategy. Fourth, bivalent mAb may be internalized at different rates than scFv and Fab, altering immune function or carrier function. Alpha emitters, for example, do not need to be internalized to kill the targets, but many drugs and toxins will benefit from internalization of the immune complex. In certain embodiments, therefore, once scFv clones specific for a Foxp3 peptide-HLA complex are obtained from phage display libraries, a full length IgG Ab (e.g., mAb) using the scFv fragments is produced.
To produce recombinant human monoclonal IgG in HEK293 or Chinese hamster ovary (CHO) cell lines cells, a full length IgG mAb can be engineered based on a method known to those of skill in the art (Tomomatsu et al., Production of human monoclonal antibodies against FceRIa by a method combining in vitro immunization with phage display. Biosci Biotechnol Biochem 73(7): 1465-14692009). Briefly, antibody variable regions can be sub-cloned into mammalian expression vectors, with matching Lambda or Kappa light chain constant sequences and IgG1 subclass Fc (for example) (Lidija P, et al. An integrated vector system for the eukaryotic expression of antibodies or their fragments after selection from phage display libraries. Gene 1997; 187(1 ): 9-18; Lisa JH, et al. Crystallographic structure of an intact lgG1 monoclonal antibody. Journal of Molecular Biology 1998; 275 (5): 861-872). Kinetic binding analysis (Yasmina NA, et al. Probing the binding mechanism and affinity of tanezumab, a recombinant humanized anti-NGF monoclonal antibody, using a repertoire of biosensors. Protein Science 2008; 17(8): 1326-1335) can be used to confirm specific binding of full length IgG to a Foxp3/HLA class I complex with a KD in nanomolar range.
In certain embodiments, the presently disclosed subject matter provides for an antigen-binding protein that is a full length antibody (anti-Foxp3 antibody), the heavy and light chains of an antibody of the presently disclosed subject matter may be full- length (e.g., an antibody including at least one, and preferably two, complete heavy chains, and at least one, and preferably two, complete light chains). The antibody can be of an IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, or IgE isotype. In certain embodiments, an antigen binding portion is comprised in a fusion protein with one or more non-immunoglobulin component. In certain embodiments, the antibody is of an IgG1, IgG2, IgG3, or IgG4 isotype. In one non-limiting embodiment, the antibody is of an IgG1 isotype (e.g., a human IgG1 antibody). The choice of antibody type may depend on the immune effector function that the antibody is designed to elicit. The light chain constant region can be a kappa or lambda constant region, preferably is a kappa constant region.
In certain embodiments, a presently disclosed antibody or other antigen-binding protein specifically binds to a Foxp3 peptide bound to an MHC molecule, e.g., a HLA molecule, more specifically, a HLA class I molecule, more specifically, a HLA-A molecule, more specifically, a HLA-A2, even more specifically, HLA-A*02:01. The Foxp3 peptide can include 6-20 amino acids, e.g., 8-12 amino acids, e.g., 8, 9, 10, 11, or 12 amino acids. In certain embodiments, the Foxp3 peptide is a 9-mer peptide. In certain embodiments, the Foxp3 peptide is a 10-mer peptide. The Foxp3 peptide can be one known in the art.
In certain embodiments, the Foxp3 peptide is a portion of a Foxp3 protein. In certain embodiments, the Foxp3 peptide is a portion of a human Foxp3 protein. In certain embodiments, the human Foxp3 protein has an amino acid sequence set forth in SEQ ID NO: 1 (Genbank Accession No. ABQ15210.1), which is provided below.
1 mpnprpgkps apslalgpsp gaspswraap kasdllgarg pggtfqgrdl rggahassss 61 lnpmppsqlq lptlplvmva psgarlgplp hlqallqdrp hfmhqlstvd ahartpvlqv 121 hplespamis ltppttatgv fslkarpglp pginvaslew vsrepallct fpnpsaprkd 181 stlsavpqss ypllangvck wpgcekvfee pedflkhcqa dhlldekgra qcllqremvq 241 sleqqlvlek eklsamqahl agkmaltkas svassdkgsc civaagsqgp vvpawsgpre 301 apdslfavrr hlwgshgnst fpeflhnmdy fkfhnmrppf tyatlirwai leapekqrtl 361 neiyhwftrm faffrnhpat wknairhnls lhkcfvrves ekgavwtvde lefrkkrsqr 421 psrcsnptpg p [SEQ ID NO: 1]
In certain embodiments, the Foxp3 peptide is selected from the group consisting of Foxp3-1 having the amnio acid sequence set forth in SEQ ID NO: 2 (which is amino acid sequences 252-260 of SEQ ID NO:1) or a portion thereof, Foxp3-2 having the amnio acid sequence set forth in SEQ ID NO: 3 (which is amino acid sequences 390-398 of SEQ ID NO:1) or a portion thereof, Foxp3-3 having the amnio acid sequence set forth in SEQ ID NO: 4 (which is amino acid sequences 304-312 of SEQ ID NO:1) or a portion thereof, Foxp3-4 having the amnio acid sequence set forth in SEQ ID NO: 5 (which is amino acid sequences 388-396 of SEQ ID NO:1) or a portion thereof, Foxp3-5 having the amnio acid sequence set forth in SEQ ID NO: 6 (which is amino acid sequences 95- 103 of SEQ ID NO:1) or a portion thereof, Foxp3-6 having the amnio acid sequence set forth in SEQ ID NO: 7 (which is amino acid sequences 69-77 of SEQ ID NO:1) or a portion thereof, and Foxp3-7 having the amnio acid sequence set forth in SEQ ID NO: 8 (which is amino acid sequences 344-353 of SEQ ID NO:1) or a portion thereof. The sequences of SEQ ID NOS: 2-8 are provided below.
KLSAMQAHL (SEQ ID NO: 2)
SLHKCFVRV (SEQ ID NO: 3),
SLFAVRRHL (SEQ ID NO: 4)
NLSLHKCFV (SEQ ID NO: 5)
LLQDRPHFM (SEQ ID NO: 6)
LQLPTLPLV (SEQ ID NO: 7)
TLIRWAILEA (SEQ ID NO: 8)
In certain embodiments, the Foxp3 peptide is Foxp3-7. In certain embodiments, the Foxp3 peptide is Foxp3-2. In certain embodiments, the Foxp3 peptide is Foxp3-4. In certain embodiments, the antibody or other antigen-binding protein binds to the C- terminal of the Foxp3 peptide in the Foxp3/MHC complex. In certain embodiments, the antibody or other antigen-binding protein binds to the N-terminal of the Foxp3 peptide in the Foxp3/MHC complex. The epitope mapping data shown in Example 2 below demonstrate that the certain antibodies bind to the C terminal of the amino acid sequence in the MHC molecule.
In certain embodiments, the antibody or other antigen-binding protein binds to Foxp3-7 in conjunction with HLA-A*02:01. Non-limiting examples of scFvs that bind to Foxp3-7 include EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017- 26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, and EXT017-55.
In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to at least one portion of Foxp3-1, Foxp3-2, Foxp3-3, Foxp3-4, Foxp3-5, Foxp3-6, or Foxp3-7. More specifically, in certain embodiments, a presently disclosed antibody or antigen-binding portion thereof binds to at least one portion of Foxp3-7 (SEQ ID NO: 8).
The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT017-17, EXT017-18, EXT017-20, EXT017-27, EXT017-28, EXT017- 32, EXT017-53, and EXT017-54 are shown in Table 1 below. The CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242). The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT017-17, EXT017-18, EXT017-20, EXT017-27, EXT017-28, EXT017-32, EXT017-53, and EXT017-54 are shown in Appendix A. Table 1
Figure imgf000044_0001
The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-29, EXT017-30, EXT017-34, and EXT017-55 are shown in Appendix B. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-29, EXT017-30, EXT017-34, and EXT017-55 are shown in Appendix C.
In certain embodiments, the antibody or other antigen-binding protein binds to Foxp3-2 in conjunction with HLA-A*02:01. Non-limiting examples of scFvs that bind to Foxp3-2 include EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8. The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT019-6, EXT019-9, EXT019-12, EXT019-15, and EXT019-20 are shown in Table 2 below. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT019-6, EXT019-9, EXT019-12, EXT019-15, and EXT019-20 are shown in Appendix D.
Table 2
Figure imgf000045_0001
The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT019-4, EXT019-13, and EXT019-8 are shown in Appendix E. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT019-4, EXT019-13, and EXT019-8 are shown in Appendix D.
In certain embodiments, the antibody or other antigen-binding protein binds to Foxp3-4 in conjunction with HLA-A*02:01. Non-limiting examples of scFvs that bind to Foxp3-4 include EXT018-5, EXT018-2, and EXT018-4. The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT018-5 are shown in Table 3 below. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT018-5 shown in Appendix F.
Table 3
Figure imgf000046_0001
The heavy chain and light chain variable region CDR1, CDR2, and CDR3 sequences of EXT018-2, and EXT018-4 are shown in Appendix G. The full length amino acid sequences and nucleotides encoding thereof, the heavy chain variable region sequences and nucleotides encoding thereof, and the light chain variable region sequences and nucleotides encoding thereof, of EXT018-2, and EXT018-4 are shown in Appendix F.
Given that each of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017- 26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, and EXT017-55can bind to Foxp3-7 in conjunction with HLA- A*02:01, the VH and VL sequences of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017- 25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, and EXT017-55 can be“mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-7 in conjunction with HLA-A*02:01.
Similarly, given that each of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can bind to Foxp3-2 in conjunction with HLA-A*02:01, the VH and VL sequences of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can be“mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3- 2 in conjunction with HLA-A*02:01.
Similarly, given that each of EXT018-5, EXT018-2, and EXT018-4 can bind to Foxp3-4 in conjunction with HLA-A*02:01, the VH and VL sequences of EXT018-5, EXT018-2, and EXT018-4 can be“mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-4 in conjunction with HLA-A*02:01.
Such“mixed and matched” antibodies can be tested using the binding assays known in the art, including for example, ELISAs, Western blots, RIAs, Biacore analysis. Preferably, when VH and VL chains are mixed and matched, a VH sequence from a particular VH/VL pairing is replaced with a structurally similar VH sequence. Likewise, a VL sequence from a particular VH/VL pairing is replaced with a structurally similar VL sequence.
In certain embodiments, a presently disclosed antibody or other antigen-binding protein comprises comprises: (a) the VH of EXT017-5, EXT017-9, EXT017-10,
EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017- 24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in
Appendices A and C, and/or (b) the VL of EXT017-5, EXT017-9, EXT017-10, EXT017- 11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017- 32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Appendices A and C.
In certain embodiments, the antibody or other antigen-binding protein comprises (a) a VH comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107; and/or (b) a VL comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108.
Preferred heavy and light chain combinations include:
(a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94; (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106; or
(h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108.
In certain embodiments, a presently disclosed antibody or other antigen-binding protein comprises: (a) the VH of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 as shown in Appendix D, and/or (b) the VL of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8, as shown in Appendix D.
For example, the antibody or other antigen-binding protein comprises (a) a VH comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 109, 111, 113, 115, and 117; and/or (b) a VL comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 110, 112, 114, 116, and 118.
Preferred heavy and light chain combinations include: (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116; or
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118.
In certain embodiments, a presently disclosed antibody or other antigen-binding protein comprises: (a) the VH of EXT018-5, EXT018-2, and EXT018-4 as shown in Appendix F, and/or (b) the VL of EXT018-5, EXT018-2, and EXT018-4, as shown in Appendicx F.
For example, the antibody or other antigen-binding protein comprises (a) a VH comprising the amino acid sequence set forth in SEQ ID NO: 119; and/or (b) a VL comprising the amino acid sequence set forth in SEQ ID NOS: 120.
In certain embodiments, the presently disclosed antibody or other antigen-binding protein comprises the the heavy chain and light chain CDR1s, CDR2s and CDR3s of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017- 28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B.
Given that each of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017- 26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55can bind to Foxp3-7 in conjunction with HLA- A*02:01 and that antigen-binding specificity is provided primarily by the CDR1, CDR2, and CDR3 regions, the VH CDR1, CDR2, and CDR3 sequences and VL CDR1, CDR2, and CDR3 sequences of each of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017- 25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, or EXT017-55 can be“mixed and matched” (i.e., CDRs from different antibodies can be mixed and match, although each antibody must contain a VH CDR1, CDR2, and CDR3 and a V L CDR1, CDR2, and CDR3) to create other antibodies or other antigen-binding proteins that bind to Foxp3-7 in conjunction with HLA-A*02:01.
Similarly, given that each of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can bind to Foxp3-2 in conjunction with HLA-A*02:01 and that antigen-binding specificity is provided primarily by the CDR1, CDR2, and CDR3 regions, the VH CDR1, CDR2, and CDR3 sequences and VL CDR1, CDR2, and CDR3 sequences of each of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, and EXT019-8 can be“mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3- 2 in conjunction with HLA-A*02:01. Such“mixed and matched” antibodies can be tested using the binding assays described above.
Similarly, given that each of EXT018-5, EXT018-2, and EXT018-4 can bind to Foxp3-4 in conjunction with HLA-A*02:01 and that antigen-binding specificity is provided primarily by the CDR1, CDR2, and CDR3 regions, the VH CDR1, CDR2, and CDR3 sequences and VL CDR1, CDR2, and CDR3 sequences of each of EXT018-5, EXT018-2, and EXT018-4 can be“mixed and matched” to create other antibodies or other antigen-binding proteins that bind to Foxp3-4 in conjunction with HLA-A*02:01. Such“mixed and matched” antibodies can be tested using the binding assays described above.
When VH CDR sequences are mixed and matched, the CDR1, CDR2 and/or CDR3 sequence from a particular VH sequence is replaced with a structurally similar CDR sequence(s). Likewise, when VL CDR sequences are mixed and matched, the CDR1, CDR2 and/or CDR3 sequence from a particular VL sequence preferably is replaced with a structurally similar CDR sequence(s). It will be readily apparent to the ordinarily skilled artisan that novel VH and VL sequences can be created by substituting one or more VH and/or VL CDR region sequences with structurally similar sequences from the CDR sequences of the antibodies or antigen-binding portions thereof disclosed herein.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(a) the VH CDR1 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017- 17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017- 34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(b) the VH CDR2 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017- 17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017- 34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(c) the VH CDR3 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017- 17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017- 34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(d) the VL CDR1 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017- 17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017- 34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B;
(e) the VL CDR2 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017- 17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017- 34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B; and (f) the VL CDR3 of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017- 17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017- 34, EXT017-53, EXT017-54, or EXT017-55, as shown in Table 1 and Appendix B.
For example, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 15, 21, 27, 33, 39, 45, and 51; (b) a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52;
(c) a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, and 53;
(d) a light chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, and 54;
(e) a light chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, and 55; and
(f) a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, and 56.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-17”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-18”. In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-20”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-27”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-28”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-32”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-53”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT017-54”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(a) the VH CDR1 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019- 20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E;
(b) the VH CDR2 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019- 20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E; (c) the VH CDR3 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019- 20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E;
(d) the VL CDR1 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019- 20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E;
(e) the VL CDR2 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019- 20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E; and (f) the VL CDR3 of EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019- 20, EXT019-4, EXT019-13, and EXT019-8, as shown in Table 2 and Appendix E.
For example, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 57, 63, 69, 75, and 81;
(b) a heavy chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 58, 64, 70, 76, and 82;
(c) a heavy chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 59, 65, 71, 77, and 83;
(d) a light chain variable region CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 60, 66, 72, 78, and 84;
(e) a light chain variable region CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 61, 67, 73, 79, and 85; and
(f) a light chain variable region CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 62, 68, 74, 80, and 86.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT019-6”. In certain embodimen, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT019-9”.
In certain embodimen, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT019-12”.
In certain embodimen, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT019-15”.
In certain embodimen, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT019-20”.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises:
(a) the VH CDR1 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(b) the VH CDR2 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(c) the VH CDR3 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(d) the VL CDR1 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G;
(e) the VL CDR2 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G; and
(f) the VL CDR3 of EXT018-5, EXT018-2, and EXT018-4, as shown in Table 3 and Appendix G.
In certain embodiments, a presently disclosed antibody, or antigen-binding portion thereof comprises: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92. The antibody comprising this combination of CDR1, CDR2, and CDR3 is referred to as“EXT018-5”.
The constant region/framework region of the presently disclosed antibodies can be altered, for example, by amino acid substitution, to modify the properties of the antibody (e.g., to increase or decrease one or more of: antigen binding affinity, Fc receptor binding, antibody carbohydrate, for example, glycosylation, fucosylation, etc , the number of cysteine residues, effector cell function, effector cell function,
complement function or introduction of a conjugation site).
In certain embodiments, a presently disclosed antibody is a fully-human antibody. In certain embodiments, a presently disclosed antibody is a fully-human monoclonal antibody (mAb). Fully-human mAbs are preferred for therapeutic use in humans because murine antibodies cause an immunogenicity reaction, known as the HAMA (human anti-mouse antibodies) response (Azinovic I, et al. Survival benefit associated with human anti-mouse antibody (HAMA) in patients with B-cell
malignancies. Cancer Immunol Immunother 2006; 55(12):1451-8; Tjandra JJ, et al. Development of human anti-murine antibody (HAMA) response in patients. Immunol Cell Biol 1990; 68(6):367-76), when administered to humans, causing serious side effects, including anaphylaxis and hypersensitivity reactions. This immunogenicity reaction is triggered by the human immune system recognizing the murine antibodies as foreign because of slightly different amino acid sequences from natural human antibodies. Humanization methods known in the art (Riechmann L, et al. Reshaping human antibodies for therapy. Nature 1988; 332 (6162): 332:323; Queen C, et al. A humanized antibody that binds to the interleukin 2 receptor. Proc Natl Acad Sci USA 1989; 86 (24): 10029-33) can be employed to reduce the immunogenicity of murine- derived antibodies (Gerd R, et al. Serological Analysis of Human Anti-Human Antibody Responses in Colon Cancer Patients Treated with Repeated Doses of Humanized Monoclonal Antibody A33. Cancer Res 2001; 61 , 6851–6859).
The use of phage display libraries has made it possible to select large numbers of antibodies repertoires for unique and rare antibodies against very defined epitopes (for more details on phage display see McCafferty et al., Phage antibodies: filamentous phage displaying antibody variable domains. Nature, 348: 552-554.) The rapid identification of human Fab or scFvs highly specific for tumor antigen-derived peptide-MHC complex molecules has thus become possible. Immuno-toxins, generated by fusing TCR-like Fab specific for melanoma Ag MART-126-35/A2 or gp100280-288/A2 to a truncated form of Pseudomonas endotoxin, have been shown to inhibit human melanoma growth both in vitro and in vivo (Klechevsky E, et al. Antitumor activity of immunotoxins with T-cell receptor-like specificity against human melanoma xenografts. Cancer Res 2008; 68 (15): 6360- 6367). In addition, by engineering full-length monoclonal antibodies (mAbs) using the Fab fragments, it is possible to directly generate a therapeutic human mAbs, bypassing months of time-consuming work, normally needed for developing therapeutic mAbs, e.g., for treating cancers, or immune diseases.
Homologous Antibodies
In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof comprises heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences of the antibodies or antigen- binding portions thereof (e.g., scFvs) described herein (e.g., EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017- 23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019- 6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019- 8, EXT018-5, EXT018-2, or EXT018-4), and wherein the antibodies or antigen-binding portions thereof retain the desired functional properties of the anti-Foxp3 antibodies or antigen-binding portions thereof of the presently disclosed subject matter.
For example, a presently disclosed antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous (e.g., at least about 81% homologous, at least about 82% homologous, at least about 83% homologous, at least about 84% homologous, at least about 85% homologous, at least about 86% homologous, at least about 87%
homologous, at least about 88% homologous, at least about 89% homologous, at least about 90% homologous, at least about 91% homologous, at least about 92%
homologous, at least about 93% homologous, at least about 94% homologous, at least about 95% homologous, at least about 96% homologous, at least about 97%
homologous, at least about 98% homologous, at least about 99% homologous, or about 100% homologous) to the VH sequence of EXT017-5, EXT017-9, EXT017-10, EXT017- 11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017- 32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4 (as shown in Appendices A, C, D, and F), and a light chain variable region comprising an amino acid sequence that is at least 80% homologous (e.g., at least about 81% homologous, at least about 82% homologous, at least about 83% homologous, at least about 84% homologous, at least about 85% homologous, at least about 86% homologous, at least about 87% homologous, at least about 88%
homologous, at least about 89% homologous, at least about 90% homologous, at least about 91% homologous, at least about 92% homologous, at least about 93%
homologous, at least about 94% homologous, at least about 95% homologous, at least about 96% homologous, at least about 97% homologous, at least about 98%
homologous, at least about 99% homologous, or about 100% homologous) to the VL sequence of EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017- 27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4 (as shown in Appendices A,C, D, and F), and the antibody or antigen-binding portion thereof binds to a Foxp3 peptide in conjunction with HLA-A*02:01 with a KD of about 5 x 10-7 M or less.
For example, a presently disclosed antibody or antigen-binding portion thereof comprises:
(a) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOs: 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, and 119;
(b) a light chain variable region comprising an amino acid sequence that is at least about 80% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOs: 94, 96, 98, 100, 102, 104, 106, 108, 110, 112, 114, 116, 118, and 120; and
wherein the antibody or antigen-binding portion thereof binds to a Foxp3 peptide in conjunction with HLA-A*02:01 with a KD of about 5 x 10-7 M or less.
In certain embodiments, the VH and/or VL amino acid sequences can be about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% homologous to the sequences set forth above. An antibody having VH and VL regions having high (i.e., about 80% or greater) homology to the VH and VL regions of the sequences set forth above, can be obtained by mutagenesis (e.g., site-directed or PCR-mediated
mutagenesis), followed by testing of the encoded altered antibody for retained function (i.e., the binding affinity) using the binding assays described herein.
The comparison of sequences and determination of homology between two sequences can be accomplished using a mathematical algorithm and is standard in the art.
As one non-limiting example, the percent homology between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl. Biosci., 4:11-17 (1988)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4. In addition, the percent homology between two amino acid sequences can be determined using the Needleman and Wunsch (J. Mol. Biol.48:444-453 (1970)) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
Additionally or alternatively, the protein sequences of the presently disclosed subject matter can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences. Such searches can be performed using the XBLAST program (version 2.0) of Altschul, et al. (1990) J. Mol. Biol.215:403-10. BLAST protein searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to the antibody molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al., (1997) Nucleic Acids Res.25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. (See www.ncbi.nlm.nih.gov).
Antibodies with Modifications
In certain embodiments, a presently disclosed antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the antibodies or antigen-binding portions thereof (e.g., scFvs) described herein (e.g., EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017- 26, EXT017-27, EXT017-28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4, as shown in Tables 1-3 and Appendices B, E and G), or modifications thereof, and wherein the antibodies or antigen-binding portions thereof retain the desired functional properties of the anti-Foxp3 antibodies or antigen-binding portions thereof of the presently disclosed subject matter.
The presently disclosed subject matter provides an isolated antibody, or antigen- binding portion thereof, comprising a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein:
(a) the heavy chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, and 89, or a conservative modification thereof;
(b) the light chain variable region CDR3 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, and 92, or a modification thereof; and the antibody or antigen- binding portion thereof specifically binds to a Foxp3 peptide bound to a MHC molecule .
In certain embodiments, the heavy chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, and 88, or a modification thereof; and the light chain variable region CDR2 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, and 91, or a modification thereof.
In certain embodiments, the heavy chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, and 87, and a modification thereof; and the light chain variable region CDR1 sequence comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 18, 24, 30, 36, 42, 48, 54, 60, 66, 72, 78, 84, and 90, or a modification thereof. In certain embodiments, the modification(s) do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into the presently antibody or antigen-binding portion by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis.
The modifications can be conservative modifications, non-conservative modifications, or mixtures of conservative and non-conservative modifications.
Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. Exemplary conservative amino acid substitutions are shown in Table 4. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
Table 4
Figure imgf000063_0001
Amino acids may be grouped according to common side-chain properties: ^ hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile;
^ neutral hydrophilic: Cys, Ser, Thr, Asn, Gln;
^ acidic: Asp, Glu;
^ basic: His, Lys, Arg;
^ residues that influence chain orientation: Gly, Pro;
^ aromatic: Trp, Tyr, Phe.
Thus, one or more amino acid residues within a CDR region can be replaced with other amino acid residues from the same group and the altered antibody can be tested for retained function using the functional assays described herein.
Non-conservative substitutions entail exchanging a member of one of these classes for another class.
In certain embodiments, no more than one, no more than two, no more than three, no more than four, no more than five residues within a specified sequence or a CDR region are altered.
Cross-competing Antibodies
The presently disclosed subject matter provides antibodies or antigen-binding portions thereof that cross-compete for binding to a Foxp3 peptide/HLA complex (e.g., a Foxp3 peptide/HLA class I complex, a Foxp3 peptide/HLA-A2 complex, or a Foxp3 peptide/HLA-A*02:01 complex) with any of the anti-Foxp3 antibodies or antigen- binding portions thereof (e.g., scFvs) of the presently disclosed subject matter (e.g., EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017- 28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55, EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, or EXT018-4), and specifically binds to a Foxp3 peptide with a binding affinity (KD) of about 5 x 10-7 M or less, e.g., about 1 x 10-7 M or less, about 5 x 10-8 M or less, about 1 x 10-8 M or less, about 5 x 10-9 M or less, about 1 x 10-9 M or less, about 5 x 10-10 M or less, about 1 x 10-10 M or less, about 5 x 10-11 M or less, or about 1 x 10-11 M or less. The cross-competing antibodies or antigen- binding portions thereof bind to the same epitope region, e.g., same epitope, adjacent epitope, or overlapping as any of the anti-Foxp3 antibodies or antigen-binding portions thereof described herein. In certain embodiments, the cross-competing antibodies or antigen-binding portions thereof bind to the same epitope on the Foxp3 peptide as any of the anti-Foxp3 antibodies or antigen-binding portions thereof described herein.
Such cross-competing antibodies can be identified based on their ability to cross- compete with any one of the presently disclosed anti-Foxp3 antibodies or antigen- binding portions thereof in standard Foxp3 binding assays. For example, Biacore analysis, ELISA assays or flow cytometry can be used to demonstrate cross-competition with the antibodies or antigen-binding portions thereof of the presently disclosed subject matter. The ability of a test antibody to inhibit the binding of, for example, any one of the presently disclosed anti-Foxp3 antibodies or antigen-binding portions thereof to a Foxp3 peptide/MHC (e.g., a Foxp3/HLA complex more specifically, a Foxp3/HLA class I complex, more specifically, a Foxp3/HLA-A2 complex, and more specifically, a Foxp3/HLA-A*02:01 complex) demonstrates that the test antibody can compete with any one of the presently disclosed anti-Foxp3 antibodies or antigen-binding portions thereof for binding to such Foxp3 peptide/MHC complex.
Characterization of Antibody Binding to Antigen
Antibodies of the presently disclosed subject can be tested for binding to a Foxp3 peptide/HLA complex by, for example, standard ELISA. To determine the isotype of purified antibodies, isotype ELISAs can be performed using reagents specific for antibodies of a particular isotype. Anti-Foxp3 human IgGs can be further tested for reactivity with the Foxp3 peptide/MHC complex by Western blotting.
In certain embodiments, KD is measured by a radiolabeled antigen binding assay (RIA). In certain embodiments, an RIA is performed with the Fab version of an antibody of interest and its antigen. For example, solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of (125I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol.293:865- 881(1999)).
In certain embodiments, KD is measured using a BIACORE® surface plasmon resonance assay. For example, an assay using a BIACORE®-2000 or a BIACORE ®- 3000 (BIAcore, Inc., Piscataway, NJ)
Immunoconjugates
The presently disclosed subject provides for an anti-Foxp3 antibody or an antigen-binding portion thereof conjugated to a therapeutic moiety, such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin. Such conjugates are referred to herein as“immunoconjugates”. Immunoconjugates that include one or more cytotoxins are referred to as“immunotoxins.” A cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells. Examples include taxol (such as ricin, diphtheria, gelonin), cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1- dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. Therapeutic agents also include, for example, calecheamicin, aureastatin, antimetabolites (e.g., methotrexate, 6- mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine and vinblastine).
Other examples of therapeutic cytotoxins that can be conjugated to an anti-Foxp3 antibody or an antigen-binding portion thereof disclosed herein include duocarmycins, calicheamicins, maytansines and auristatins, and derivatives thereof. An example of a calicheamicin antibody conjugate is commercially available (Mylotarg™; Wyeth- Ayerst).
Cytoxins can be conjugated to anti-Foxp3 antibody or an antigen-binding portion thereof disclosed herein using linker technology available in the art. Examples of linker types that have been used to conjugate a cytotoxin to an antibody include, but are not limited to, hydrazones, thioethers, esters, disulfides and peptide-containing linkers. A linker can be chosen that is, for example, susceptible to cleavage by low pH within the lysosomal compartment or susceptible to cleavage by proteases, such as proteases preferentially expressed in tumor tissue such as cathepsins (e.g., cathepsins B, C, D). For further discussion of types of cytotoxins, linkers and methods for conjugating therapeutic agents to antibodies, see also Saito, G. et al. (2003) Adv. Drug Deliv. Rev. 55:199-215; Trail, P.A. et al. (2003) Cancer Immunol. Immunother.52:328-337; Payne, G. (2003) Cancer Cell 3:207-212; Allen, T.M. (2002) Nat. Rev. Cancer 2:750-763; Pastan, I. and Kreitman, R. J. (2002) Curr. Opin. Investig. Drugs 3:1089-1091; Senter, P.D. and Springer, C.J. (2001) Adv. Drug Deliv. Rev.53:247-264.
Anti-Foxp3 antibodies of the presently disclosed subject matter also can be conjugated to a radioactive isotope to generate cytotoxic radiopharmaceuticals, also referred to as radioimmunoconjugates. Examples of radioactive isotopes that can be conjugated to antibodies for use diagnostically or therapeutically include, but are not limited to, 90Y, 131I, 225Ac, 213Bi, 223Ra, 177Lu, and 227Th. Method for preparing radioimmunconjugates are established in the art. Examples of radioimmunoconjugates are commercially available, including Zevalin™ (IDEC Pharmaceuticals) and Bexxar™ (Corixa Pharmaceuticals), and similar methods can be used to prepare
radioimmunoconjugates using the antibodies of the invention.
The antibody conjugates of the presently disclosed subject matter can be used to modify a given biological response, and the drug moiety is not to be construed as limited to classical chemical therapeutic agents. For example, the drug moiety may be a protein or polypeptide possessing a desired biological activity. Such proteins may include, for example, an enzymatically active toxin, or active fragment thereof, such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor (TNF) or interferon-γ; or, biological response modifiers such as, for example,
lymphokines, interleukin-1 ("IL-1"), interleukin-2 ("IL-2"), interleukin-6 ("IL-6"), granulocyte macrophage colony stimulating factor ("GM-CSF"), granulocyte colony stimulating factor ("G-CSF"), or other growth factors.
Techniques for conjugating such therapeutic moiety to antibodies are well known, see, e.g., Arnon et al., "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp.243-56 (Alan R. Liss, Inc.1985); Hellstrom et al., "Antibodies For Drug Delivery", in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), pp.623-53 (Marcel Dekker, Inc.1987); Thorpe, "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", in Monoclonal Antibodies '84: Biological And Clinical
Applications, Pinchera et al. (eds.), pp.475-506 (1985); "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), and Thorpe et al., "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", Immunol. Rev., 62:119-58 (1982). Bispecific Molecules
The presently disclosed subject matter provides for bispecific molecules comprising an anti-Foxp3 antibody or an antigen-binding portion thereof disclosed herein. An antibody or an antigen-binding portion thereof of the presently disclosed subject matter, can be derivatized or linked to another functional molecule, e.g., another peptide or protein (e.g., another antibody or ligand for a receptor) to generate a bispecific molecule that binds to at least two different binding sites or target molecules. The antibody of the presently disclosed subject matter can in fact be derivatized or linked to more than one other functional molecule to generate multispecific molecules that bind to more than two different binding sites and/or target molecules; such multispecific molecules are also intended to be encompassed by the term“bispecific molecule” as used herein. To create a bispecific molecule, a presently disclosed anti-Foxp3 antibody or an antigen-binding portion thereof can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, such that a bispecific molecule results.
The presently disclosed subject matter provides bispecific molecules comprising at least one first binding specificity for a first target epitope or antigen and a second binding specificity for a second target epitope or antigen. The second target epitope or antigen can be different from the first epitope or antigen. In certain embodiments, the bispecific molecule is multispecific, the molecule can further include a third binding specificity. Where a first portion of a bispecific antibody binds to an antigen on a tumor cell for example and a second portion of a bispecific antibody recognizes an antigen on the surface of a human immune effector cell, the antibody is capable of recruiting the activity of that effector cell by specifically binding to the effector antigen on the human immune effector cell. In certain embodiments, bispecific antibodies, therefore, are able to form a link between effector cells, for example, T cells and tumor cells, thereby enhancing effector function.
The bispecific molecules of the presently disclosed subject matter can be prepared by conjugating the constituent binding specificities using methods known in the art. For example, each binding specificity of the bispecific molecule can be generated separately and then conjugated to one another. When the binding specificities are proteins or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation. Examples of cross-linking agents include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5, 5'-dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N-succinimidyl-3-(2- pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohaxane-1-carboxylate (sulfo-SMCC) (see e.g., Karpovsky et al. (1984) J. Exp. Med. 160:1686; Liu, MA et al. (1985) Proc. Natl. Acad. Sci. USA 82:8648). Other methods include those described in Paulus (1985) Behring Ins. Mitt. No.78, 118-132; Brennan et al. (1985) Science 229:81-83), and Glennie et al. (1987) J. Immunol.139: 2367-2375). Preferred conjugating agents are SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, IL).
When the binding specificities are antibodies, they can be conjugated via sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains. In one non- limiting embodiment, the hinge region is modified to contain an odd number of sulfhydryl residues, preferably one, prior to conjugation.
Alternatively, both binding specificities can be encoded in the same vector and expressed and assembled in the same host cell. This method is particularly useful where the bispecific molecule is a mAb x mAb, mAb x Fab, Fab x F(ab')2 or ligand x Fab fusion protein.
Binding of the bispecific molecules to their specific targets can be confirmed by, for example, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g., growth inhibition), or Western Blot assay. Each of these assays generally detects the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g., an antibody) specific for the complex of interest. Alternatively, the complexes can be detected using any of a variety of other
immunoassays. For example, the antibody can be radioactively labeled and used in a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of
Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986, which is incorporated by reference herein). The radioactive isotope can be detected by such means as the use of a γ counter or a scintillation counter or by autoradiography.
In certain embodiments, the bispecific antibodies recognize both Foxp3/MHC complex and a cell surface protein on a T cell, a NK cell, a NK T cell, neutrophil, monocyte, or macrophage. Non-limiting examples of cell surface protein include CD3 and CD16. In certain embodiments, the bispecific antibodies recognize both
Foxp3/MHC complex and CD3 on immune T cells as described (Yan, et al., J. Biol. Chem.2010; 285: 19637-19646; Rossi, et al., Proc Natl Aca Sci USA 2006; 103:6841-6) with a human IgG1 Fc. Bispecific antibodies recruit and target cytotoxic T cells to Foxp3/MHC positive cancer cells, while maintaining Fc effector functions and long half life in vivo. Three mechanisms are involved in the specific killing of cancer cells mediated by bispecific antibodies: i) killing by activated T cells; ii) ADCC activity; iii) CDC activity. Other formats of bispecific antibodies can be constructed, such tandem scFv molecules (taFv), diabodies (Db), or single chain diabodies (scDb), and fusion protein with human serum albumin (Ryutaro, et al., J Biol Chem 2011; 286: 1812-1818; Anja, et al., Blood 2000; 95(6): 2098-2103; Weiner, et al., J. Immunology 1994; 152(5): 2385-2392; Dafne, et al., J Biol Chem 2007; 282: 12650-12660), but are devoid of Fc effector functions with distinct pharmacokinetic profiles.
Engineered and Modified Antibodies
An antibody of the presently disclosed subject matter further can be prepared using an antibody or an antigen-binding portion thereof having one or more of the VH and/or VL sequences disclosed herein as starting material to engineer a modified antibody, which modified antibody may have altered properties from the starting antibody. An antibody can be engineered by modifying one or more residues within one or both variable regions (i.e., VH and/or VL), for example within one or more CDR regions and/or within one or more framework regions. Additionally or alternatively, an antibody can be engineered by modifying residues within the constant region(s), for example to alter the effector function(s) of the antibody.
One type of variable region engineering that can be performed is CDR grafting. Antibodies interact with target antigens predominantly through amino acid residues that are located in the six heavy and light chain CDRs. For this reason, the amino acid sequences within CDRs are more diverse between individual antibodies than sequences outside of CDRs. Because CDR sequences are responsible for most antibody-antigen interactions, it is possible to express recombinant antibodies that mimic the properties of specific naturally occurring antibodies by constructing expression vectors that include CDR sequences from the specific naturally occurring antibody grafted onto framework sequences from a different antibody with different properties (see, e.g., Riechmann, L. et al. (1998) Nature 332:323-327; Jones, P. et al. (1986) Nature 321:522-525; Queen, C. et al. (1989) Proc. Natl. Acad. See. U.S.A.86:10029-10033; U.S. Patent No.5,225,539 to Winter, and U.S. Patent Nos.5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al.)
Framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences. For example, germline DNA sequences for human heavy and light chain variable region genes can be found in the IMGT human germline sequence database (available on the Internet at
Figure imgf000071_0001
as well as in Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242; Tomlinson, I. M., et al. (1992) "The Repertoire of Human Germline VH Sequences Reveals about Fifty Groups of VH Segments with Different Hypervariable Loops" J. Mol. Biol.227:776-798; and Cox, J. P. L. et al. (1994) "A Directory of Human Germ-line VH Segments Reveals a Strong Bias in their Usage" Eur. J. Immunol.24:827-836; the contents of each of which are expressly incorporated herein by reference. As another example, the germline DNA sequences for human heavy and light chain variable region genes can be found in the GenBank database.
The VH CDR1, CDR2, and CDR3 sequences, and the VL CDR1, CDR2, and CDR3 sequences, can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the CDR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences. For example, it has been found that in certain instances it is beneficial to mutate residues within the framework regions to maintain or enhance the antigen binding ability of the antibody (see e.g., U.S. Patent Nos.5,530,101; 5,585,089; 5,693,762 and 6,180,370 to Queen et al).
Another type of variable region modification is to mutate amino acid residues within the VH and/or VL CDR1, CDR2 and/or CDR3 regions to thereby improve one or more binding properties (e.g., affinity) of the antibody of interest. Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays. Preferably conservative modifications (as discussed above) are introduced. The mutations may be amino acid substitutions, additions or deletions. For example, no more than one, two, three, four or five residues within a CDR region are altered.
Accordingly, the presently disclosed subject matter provides for isolated anti- Foxp3 monoclonal antibodies or antigen-binding portions thereof comprising a heavy chain variable region comprising: (a) the VH CDR1 sequence of the antibodies and antigen-bindingn portions thereof (e.g., scFvs) disclosed herein (e.g., #9, #11, #17, #18, #20, #21, #26, #27, #28, #32, # 53, #54, #6, #9, #12, #15, or #5), or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g.,
substitution, deletion and/or addition) as compared to the VH CDR1 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein; (b) the VH CDR2 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the VH CDR2 of any one of the antibodies or antigen-binding portions thereof disclosed herein; (c) the VH CDR3 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the VH CDR3 of any one of the antibodies or antigen-binding portions thereof disclosed herein; (d) the VL CDR1 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the VL CDR1 of any one of the antibodies or antigen-binding portions thereof disclosed herein; (e) the VL CDR2 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the VL CDR2 of any one of the antibodies or antigen-binding portions thereof disclosed herein; and (f) the VL CDR3 sequence of any one of the antibodies or antigen-binding portions thereof disclosed herein, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to the VL CDR3 of any one of the antibodies or antigen-binding portions thereof disclosed herein.
For example, the presently disclosed subject matter provides for isolated anti- Foxp3 monoclonal antibodies or antigen-binding portions thereof comprising a heavy chain variable region comprising: (a) a VH CDR1 region comprising the amino acid sequence set forth in SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87; (b) a VH CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88; (c) a VH CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89; (d) a a VL CDR1 region comprising the amino acid sequence set forth in SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90; (e) a VL CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91; and (f) a VL CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92.
Engineered antibodies of the presently disclosed subject matter include those in which modifications are made to framework residues within VH and/or VK, e.g., to improve the properties of the antibody. Typically such framework modifications are made to decrease the immunogenicity of the antibody. For example, one approach is to “backmutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as“deimmunization” and is described in further detail in U.S. Patent Publication No.20030153043 by Carr et al.
In addition or alternative to modifications made within the framework or CDR regions, anti-Foxp3 antibodies or antigen-binding portions thereof of the presently disclosed subject matter may be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity. Furthermore, a presently disclosed anti-Foxp3 antibody may be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody. The hinge region of CH1 may be modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Patent No.5,677,425 by Bodmer et al. The number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody. The Fc hinge region of an antibody may be mutated to decrease the biological half life of the antibody. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding. This approach is described in further detail in U.S. Patent No.6,165,745 by Ward et al. The antibody may be modified to increase its biological half life, e.g., the antibody may be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Patent Nos.5,869,046 and 6,121,022 by Presta et al. Furthermore, the Fc region may be altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody. The Fc region may be modified to increase the ability of the antibody to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase the affinity of the antibody for an Fcγ receptor, e.g., as described in WO 00/42072 by Presta. In certain embodiments, a presently disclosed anti-Foxp3 antibody comprises an afucosylated Fc region. Removal of the fucose residue from the N-glycans of the Fc portion of immunoglobulin G (IgG) can result in a dramatic enhancement of ADCC through improved affinity for Fcγ receptor IIIa (FcγRIIIa).
Additionally or alternatively, the glycosylation of an antibody may be modified. For example, an aglycoslated antibody can be made (i.e., the antibody lacks
glycosylation). Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen, see e.g., U.S. Patent Nos.5,714,350 and 6,350,861. Such carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence. For example, one or more amino acid substitution can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
Additionally or alternatively, an antibody can be made that has an altered type of glycosylation, such as a hypofucosylated antibody having reduced amounts of fucosyl residues or an antibody having increased bisecting GlcNac structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery.
Another modification of the antibodies may be pegylation. An antibody can be pegylated to, for example, increase the biological (e.g., serum) half life of the antibody. To pegylate an antibody, the antibody, or fragment thereof, typically is reacted with polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. The pegylation may be carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term“polyethylene glycol” is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1- C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide. The antibody to be pegylated may be an aglycosylated antibody. Methods for pegylating proteins are known in the art and can be applied to the antibodies disclosed herein, see e.g., EP 0154316 and EP 0401384.
III. Methods of Preparation
1. Identification of Peptides with High Predictive Binding to MHC Molecules
The presently disclosed subject matter provides for a method for the generation of antibodies that specifically bind to MHC-restricted peptides, which, when presented as part of a peptide/MHC complex are able to elicit a specific cytotoxic T-cell response. HLA class I molecules present endogenous derived peptides of about 8-12 amino acids in length to CD8+ cytotoxic T lymphocytes. Peptides to be used in the presently disclosed method are generally about 6-22 amino acids in length, and in some embodiments, between about 9 and 20 amino acids (more specifically, between 8-12 amino acids, e.g., 9 amino acids or 10 amino acids) and comprise an amino acid sequence derived from a protein of interest, for example, human Foxp3 protein having an amino acid sequence set forth in SEQ ID NO: 1 (Genbank Accession No. ABQ15210.1, provided below) or an analog thereof.
1 mpnprpgkps apslalgpsp gaspswraap kasdllgarg pggtfqgrdl rggahassss 61 lnpmppsqlq lptlplvmva psgarlgplp hlqallqdrp hfmhqlstvd ahartpvlqv 121 hplespamis ltppttatgv fslkarpglp pginvaslew vsrepallct fpnpsaprkd 181 stlsavpqss ypllangvck wpgcekvfee pedflkhcqa dhlldekgra qcllqremvq 241 sleqqlvlek eklsamqahl agkmaltkas svassdkgsc civaagsqgp vvpawsgpre 301 apdslfavrr hlwgshgnst fpeflhnmdy fkfhnmrppf tyatlirwai leapekqrtl 361 neiyhwftrm faffrnhpat wknairhnls lhkcfvrves ekgavwtvde lefrkkrsqr 421 psrcsnptpg p [SEQ ID NO: 1]
Peptides suitable for use in generating antibodies in accordance with the presently disclosed method can be determined based on the presence of MHC molecule (e.g., HLA molecule, more specifically, HLA class I molecule, more specifically, HLA-A, more specifically, HLA-A2, and more specifically, HLA-A*02:01) binding motifs and the cleavage sites for proteasomes and immune-proteasomes using computer prediction models known to those of skill in the art. For predicting MHC class I binding sites, such models include, but are not limited to, ProPred1 (described in more detail in Singh and Raghava, Bioinformatics 17(12):1236-12372001), SYFPEITHI (see Schuler et al.
Immunoinformatics Methods in Molecular Biology, vol 409(1): 75-932007), Net MHC (http://www.cbs.dtu.dk/services/NetMHC/), and BIMAS (http://www- bimas.cit.nih.gov/cgi-bin/molbio/ken_parker_comboform) .
HLA-A*02:01 is expressed in 39-46% of all caucasians and therefore, represents a suitable choice of MHC antigen for use in the present method. For identification of one embodiment of a Foxp3 peptide antigen, amino acid sequences and predicted binding of putative Foxp3 epitopes to HLA-A*02:01 molecules were identified using the predictive algorithm of the SYFPEITHI database (http://www.syfpeithi.de/; see Schuler (2007)). For identification of one embodiment of a Foxp3 peptide antigen, amino acid sequences and predicted binding of putative Foxp3 epitopes to HLA-A*02:01 molecules were identified using the predictive algorithm of the BIMAS (http://www- bimas.cit.nih.gov/cgi-bin/molbio/ken_parker_comboform). For identification of one embodiment of a Foxp3 peptide antigen, amino acid sequences and predicted binding of putative Foxp3 epitopes to HLA-A*02:01 molecules were identified using the predictive algorithm of RANKPEP (http://bio.dfci.harvard.edu/Tools/rankpep.html).
Once appropriate peptides are identified, peptide synthesis can be done in accordance with protocols well known to those of ordinary skill in the art. Because of their relatively small size, the peptides of the presently disclosed subject matter can be directly synthesized in solution or on a solid support in accordance with conventional peptide synthesis techniques. Various automatic synthesizers are commercially available and can be used in accordance with known protocols. The synthesis of peptides in solution phase has become a well-established procedure for large-scale production of synthetic peptides and as such is a suitable alternative method for preparing the peptides of the invention. (See e.g., Stewart et al., Tetrahedron Letters Vol.39, pages 1517-1520 1998.)
Each of the peptides used in the protocols described herein was purchased and synthesized by Genemed Synthesis, Inc. (San Antonio, TX). The quality of the peptides was assessed by high-performance liquid chromatography analysis, and the expected molecular weight was observed using matrix-assisted laser desorption mass
spectrometry. Peptides were sterile and 80% to > 90% pure. The peptides were dissolved in DMSO and diluted in saline at 5 mg/mL and stored at -800C.
Subsequent to peptide selection, binding activity of selected peptides is tested using the antigen-processing-deficient T2 cell line, which increases expression of HLA- A when stabilized by a peptide in the antigen-presenting groove. Briefly, T2 cells are pulsed with peptide for a time sufficient to induce HLA-A expression. HLA-A expression of T2 cells is then measured by immunostaining with a fluorescently labeled monoclonal antibody specific for HLA-A (for example, BB7.2) and flow cytometry. Fluorescence index (FI) is calculated as the mean fluorescence intensity (MFI) of HLA- A*02:01 on T2 cells as determined by fluorescence-activated cell-sorting analysis, using the formula FI=(MFI [T2 cells with peptide]/MFI [T2 cells without peptide]−1.
Fully human T-cell receptor (TCR)-like antibodies to Foxp3 were produced using the method disclosed herein. TCR-like anti-Foxp3 antibodies generated by phage display technology are specific for a Foxp3 peptide/HLA complex similar to that which induces HLA-restricted cytotoxic CD8 T-cells.
Once a suitable peptide has been identified, the target antigen to be used for phage display library screening, that is, a peptide/MHC complex (for example,
Foxp3/HLA complex, e.g., Foxp3 peptide/HLA-A*02:01) is prepared by bringing the peptide and the histocompatibility antigen together in solution to form the complex. 2. Selecting A High Affinity scFv Against A Foxp3 Peptide
The next step is the selection of phage that binds to the target antigen of interest with high affinity, from phage in a human phage display library that either does not bind or that binds with lower affinity. This is accomplished by iterative binding of phage to the antigen, which is bound to a solid support, for example, beads or mammalian cells followed by removal of non-bound phage and by elution of specifically bound phage. In certain embodiments, antigens are first biotinylated for immobilization to, for example, streptavidin-conjugated Dynabeads M-280. The phage library is incubated with the cells, beads or other solid support and non binding phage is removed by washing.
Clones that bind are selected and tested.
Once selected, positive scFv clones are tested for their binding to HLA- A2/peptide complexes on live T2 cell surfaces by indirect flow cytometry. Briefly, phage clones are incubated with T2 cells that have been pulsed with a Foxp3 peptide, or an irrelevant peptide (control). The cells are washed and then with a mouse anti-M13 coat protein mAb. Cells are washed again and labeled with a FITC-goat (Fab)2 anti- mouse Ig prior to flow cytometry.
In other embodiments, the anti-Foxp3 antibodies may comprise one or more framework region amino acid substitutions designed to improve protein stability, antibody binding, expression levels or to introduce a site for conjugation of therapeutic agents. These scFv are then used to produce recombinant human monoclonal Igs in accordance with methods known to those of skill in the art.
Methods for reducing the proliferation of leukemia cells is also included, comprising contacting leukemia cells with a presently disclosed Foxp3 antibody. In a related aspect, the presently disclosed antibodies can be used for the prevention or treatment of leukemia. Administration of therapeutic antibodies is known in the art. IV. Chimeric Antigen Receptors
Chimeric antigen receptors (CARs) are engineered receptors, which graft or confer a specificity of interest onto an immune effector cell. CARs can be used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral vectors.
There are three generations of CARs.“First generation” CARs are typically composed of an extracellular antigen binding domain (e.g., a scFv fused to a
transmembrane domain, fused to cytoplasmic/intracellular domain of the T cell receptor chain.“First generation” CARs typically have the intracellular domain from the CD3ξ- chain, which is the primary transmitter of signals from endogenous TCRs.“First generation” CARs can provide de novo antigen recognition and cause activation of both CD4+ and CD8+ T cells through their CD3ζ chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation.“Second generation” CARs add intracellular domains from various co-stimulatory molecules (e.g., CD28, 4- 1BB, ICOS, OX40) to the cytoplasmic tail of the CAR to provide additional signals to the T cell.“Second generation” CARs comprise those that provide both co-stimulation (e.g., CD28 or 4-1BB) and activation (CD3ζ). Preclinical studies have indicated that “Second Generation” CARs can improve the anti-tumor activity of T cells. For example, robust efficacy of“Second Generation” CAR modified T cells was demonstrated in clinical trials targeting the CD19 molecule in patients with chronic lymphoblastic leukemia (CLL) and acute lymphoblastic leukemia (ALL).“Third generation” CARs comprise those that provide multiple co-stimulation (e.g., CD28 and 4-1BB) and activation (CD3ζ).
In accordance with the presently disclosed subject matter, the CARs comprise an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain binds to a Foxp3 peptide bound to an MHC molecule (e.g., a HLA molecule, more specifically, a HLA class I molecule). In certain embodiments, the extracellular antigen-binding domain is a scFv. In certain embodiments, the scFv is a human scFv. Non-limiting example of scFv include
EXT017-5, EXT017-9, EXT017-10, EXT017-11, EXT017-17, EXT017-18, EXT017-20, EXT017-21, EXT017-23, EXT017-24, EXT017-25, EXT017-26, EXT017-27, EXT017- 28, EXT017-29, EXT017-30, EXT017-32, EXT017-34, EXT017-53, EXT017-54, EXT017-55 EXT019-6, EXT019-12, EXT019-9, EXT019-15, EXT019-20, EXT019-4, EXT019-13, EXT019-8, EXT018-5, EXT018-2, and EXT018-4.
In certain embodiments, the extracellular antigen-binding domain is a Fab, which is optionally crosslinked. In a certain embodiments, the extracellular binding domain is a F(ab)2.. In certain embodiments, any of the foregoing molecules may be comprised in a fusion protein with a heterologous sequence to form the extracellular antigen-binding domain.
In certain non-limiting embodiments, an extracellular antigen-binding domain of a presently disclosed CAR can comprise a linker connecting the heavy chain variable region and light chain variable region of the extracellular antigen-binding domain. As used herein, the term“linker” refers to a functional group (e.g., chemical or polypeptide) that covalently attaches two or more polypeptides or nucleic acids so that they are connected to one another. As used herein, a“peptide linker” refers to one or more amino acids used to couple two proteins together (e.g., to couple VH and VL domains). In certian embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO: 135, which is provided below. In certain embodiments, the nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 135 is set forth in SEQ ID NO: 136, which is provided below.
SRGGGGSGGGGSGGGGSLEMA (SEQ ID NO: 135)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGG ATCCCTCGAGATGGCC (SEQ ID NO: 136) In certain embodiments, the extracellular antigen-binding domain is a scFv, which comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, or 119, or an amino acid sequence that is at least 80% homologous to SEQ ID NO: 93, 95, 97, 99, 101, 103, 105, 107, 109, 111, 113, 115, 117, or 119, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 94, 96, 98, 100, 102, 104, 106, and 108,110, 112, 114, 116, 118, or 120, or an amino acid sequence that is at least 80% homologous to SEQ ID NO: 94, 96, 98, 100, 102, 104, 106, and 108,110, 112, 114, 116, 118, or 120, and optionally a linker comprising the amino acid sequence set forth in SEQ ID NO: 135.
In certain embodiments, the extracellular antigen-binding domain is a scFv, which comprises (a) a VH CDR1 region comprising the amino acid sequence set forth in SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g.,
substitution, deletion and/or addition) as compared to SEQ ID NOS: 9, 15, 21, 27, 33, 39, 45, 51, 57, 63, 69, 75, 81, or 87; (b) a VH CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid
modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 10, 16, 22, 28, 34, 40, 46, 52, 58, 64, 70, 76, 82, or 88; (c) a VH CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 11, 17, 23, 29, 35, 41, 47, 53, 59, 65, 71, 77, 83, or 89; (d) a a VL CDR1 region comprising the amino acid sequence set forth in SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 12, 18, 24, 30, 36, 40, 42, 48, 54, 60, 66, 72, 78, 84, or 90; (e) a VL CDR2 region comprising the amino acid sequence set forth in SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 13, 19, 25, 31, 37, 43, 49, 55, 61, 67, 73, 79, 85, or 91; and (f) a VL CDR3 region comprising the amino acid sequence set forth in SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92, or an amino acid sequence having at least one (e.g., no more than one, no more than two, no more than three, no more than four or no more than five) amino acid modification (e.g., substitution, deletion and/or addition) as compared to SEQ ID NOs: 14, 20, 26, 32, 38, 44, 50, 56, 62, 68, 74, 80, 86, or 92, and optionally a linker comprising the amino acid sequence set forth in SEQ ID NO: 135. In certain embodiments, the scFv further comprises a His-tag and a HA-tag. In certain embodiments, the amino acid sequence of the His-tag and HA-tag comprises the amino acid sequence of SEQ ID NO: 141, as provided below. The nucleotide sequence encoding SEQ ID NO: 141 is SEQ ID NO: 142.
TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141]
CTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATAC CCGTACGACGTTCCGGACTACGCTTCT [SEQ ID NO: 142]
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, and 134.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 93 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 93, a VL comprising the amino acid sequence set forth in SEQ ID NO: 94 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 94, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 121.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 95 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 95, a VL comprising the amino acid sequence set forth in SEQ ID NO: 96 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 96, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 122.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 97 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 97, a VL comprising the amino acid sequence set forth in SEQ ID NO: 98 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 98, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 123.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 99 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 99, a VL comprising the amino acid sequence set forth in SEQ ID NO: 100 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 100, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 124.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 101 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 101, a VL comprising the amino acid sequence set forth in SEQ ID NO: 102 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 102, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 125.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 103 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 103, a VL comprising the amino acid sequence set forth in SEQ ID NO: 104 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 104, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 126. In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 105 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 105, a VL comprising the amino acid sequence set forth in SEQ ID NO: 106 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 106, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 127.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 107 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 107, a VL comprising the amino acid sequence set forth in SEQ ID NO: 108 or an amino acid sequence that is at least 80% homolgous to SEQ ID NO: 108, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 128.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 109 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 109, a VL comprising the amino acid sequence set forth in SEQ ID NO: 110 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 110, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 129.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 111 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 111, a VL comprising the amino acid sequence set forth in SEQ ID NO: 112 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 112, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 130.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 113 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 113, a VL comprising the amino acid sequence set forth in SEQ ID NO: 114 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 114, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 131.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 115 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 115, a VL comprising the amino acid sequence set forth in SEQ ID NO: 116 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 116, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 132.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 117 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 117, a VL comprising the amino acid sequence set forth in SEQ ID NO: 118 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 118, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 133.
In certain embodiments, the extracellular antigen-binding domain is a scFv comprising a VH comprising the amino acid sequence set forth in SEQ ID NO: 119 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 119, a VL comprising the amino acid sequence set forth in SEQ ID NO: 120 or an amino acid sequence that is at least about 80% homolgous to SEQ ID NO: 120, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain
embodiments, the extracellular antigen-binding domain is a scFv comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92, a linker comprising the amino acid sequence set forth in SEQ ID NO: 135, and a His-tag and a HA-tag comprising the amino acid sequence set forth in SEQ ID NO: 141. In certain embodiments, the scFv comprises the amino acid sequence set forth in SEQ ID NO: 134.
In addition, the extracellular antigen-binding domain can comprise a leader or a signal peptide that directs the nascent protein into the endoplasmic reticulum. Signal peptide or leader can be essential if the CAR is to be glycosylated and anchored in the cell membrane. The signal sequence or leader can be a peptide sequence (about 5, about 10, about 15, about 20, about 25, or about 30 amino acids long) present at the N-terminus of newly synthesized proteins that directs their entry to the secretory pathway. In non- limiting examples, the signal peptide is covalently joined to the 5’ terminus of the extracellular antigen-binding domain.
In certain non-limiting embodiments, the transmembrane domain of the CAR comprises a hydrophobic alpha helix that spans at least a portion of the membrane.
Different transmembrane domains result in different receptor stability. After antigen recognition, receptors cluster and a signal is transmitted to the cell. In accordance with the presently disclosed subject matter, the transmembrane domain of the CAR can comprise a CD8 polypeptide, a CD28 polypeptide, a CD3ζ polypeptide, a CD4 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a CTLA- 4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
In certain embodiments, the transmembrane domain of a presently disclosed CAR comprises a CD28 polypeptide. In certain embodiments, the transmembrane domain of a presently disclosed CAR comprises a CD8 polypeptide.
In certain non-limiting embodiments, an intracellular domain of the CAR can comprise a CD3zeta (CD3ζ) polypeptide, which can activate or stimulate a cell (e.g., a cell of the lymphoid lineage, e.g., a T cell). CD3ζ comprises 3 ITAMs, and transmits an activation signal to the cell (e.g., a cell of the lymphoid lineage, e.g., a T cell) after antigen is bound. The CD3ζ polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to the sequence having a NCBI Reference No: NP_932170 (SEQ ID No: 137), or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions. In non-limiting
embodiments, the CD3ζ polypeptide can have an amino acid sequence that is a consecutive portion of SEQ ID NO: 137 which is at least 20, or at least 30, or at least 40, or at least 50, and up to 164 amino acids in length. Alternatively or additionally, in non- limiting various embodiments, the CD3ζ polypeptide has an amino acid sequence of amino acids 1 to 164, 1 to 50, 50 to 100, 100 to 150, or 150 to 164 of SEQ ID NO: 137. In certain embodiments, the CD3ζ polypeptide has an amino acid sequence of amino acids 52 to 121 of SEQ ID NO: 137.
SEQ ID NO: 137 is provided below:
1 MKWKALFTAA ILQAQLPITE AQSFGLLDPK LCYLLDGILF IYGVILTALF LRVKFSRSAD 61 APAYQQGQNQ LYNELNLGRR EEYDVLDKRR GRDPEMGGKP QRRKNPQEGL YNELQKDKMA 121 EAYSEIGMKG ERRRGKGHDG LYQGLSTATK DTYDALHMQA LPPR [SEQ ID NO: 137] In certain embodiments, the CD3ζ polypeptide has the amino acid sequence set forth in SEQ ID NO: 138, which is provided below.
RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYS EIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR [SEQ ID NO: 138]
In certain non-limiting embodiments, an intracellular domain of the CAR further comprises at least one co-stimulatory signaling region comprising at least one co- stimulatory molecule, which can provide optimal lymphocyte activation. As used herein, “co-stimulatory molecules” refer to cell surface molecules other than antigen receptors or their ligands that are required for an efficient response of lymphocytes to antigen. The at least one co-stimulatory signaling region can include a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof. The co- stimulatory molecule can bind to a co-stimulatory ligand, which is a protein expressed on cell surface that upon binding to its receptor produces a co-stimulatory response, i.e., an intracellular response that effects the stimulation provided when an antigen binds to its CAR molecule. In certain embodiments, the intracellular domain of the CAR comprises a co-stimulatory signaling region that comprises a CD28 polypeptide. In one non- limiting embodiment, the CAR comprises a CD28 transmembrane domain and a CD28 co-stimulatory signaling domain, where CD28 polypeptide comprised in the
transmembrane domain and the co-stimulatory signaling region has the amino acid sequence set forth in SEQ ID NO: 139, which is provided below.
IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFW VRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 139) In addition, the presently disclosed subject matter provides immunoresponsive cells expressing a presently disclosed CAR. The immunoresponsive cells can be transduced with a presently disclosed CAR such that the cells express the CAR. The presently disclosed subject matter also provides methods of using such cells for the treatment of a tumor or Foxp3-associated pathologic condition. The immunoresponsive cells of the presently disclosed subject matter can be cells of the lymphoid lineage. The lymphoid lineage, comprising B, T and natural killer (NK) cells, provides for the production of antibodies, regulation of the cellular immune system, detection of foreign agents in the blood, detection of cells foreign to the host, and the like. Non-limiting examples of immunoresponsive cells of the lymphoid lineage include T cells, Natural Killer (NK) cells, embryonic stem cells, and pluripotent stem cells (e.g., those from which lymphoid cells may be differentiated).
In certain embodiments, the immunoresponsive cell is a T cell. T cells can be lymphocytes that mature in the thymus and are chiefly responsible for cell-mediated immunity. T cells are involved in the adaptive immune system. T cells of the presently disclosed subject matter can be any type of T cells, including, but not limited to, T helper cells, cytotoxic T cells, memory T cells (including central memory T cells, stem-cell-like memory T cells (or stem-like memory T cells), and two types of effector memory T cells: e.g., TEM cells and TEMRA cells), Regulatory T cells (also known as suppressor T cells), Natural killer T cells, Mucosal associated invariant T cells, and γδ T cells.
Cytotoxic T cells (CTL or killer T cells) are a subset of T lymphocytes capable of inducing the death of infected somatic or tumor cells. In certain embodiments, the CAR- expressing T cells express Foxp3 to achieve and maintain a T regulatory phenotype.
Natural killer (NK) cells can be lymphocytes that are part of cell-mediated immunity and act during the innate immune response. NK cells do not require prior activation in order to perform their cytotoxic effect on target cells.
Genetic modification of immunoresponsive cells (e.g., T cells, NK cells) can be accomplished by transducing a substantially homogeneous cell composition with a recombinant DNA or RNA construct. The vector can be a retroviral vector (e.g., gamma retroviral), which is employed for the introduction of the DNA or RNA construct into the host cell genome. For example, a polynucleotide encoding a presently disclosed CAR can be cloned into a retroviral vector and expression can be driven from its endogenous promoter, from the retroviral long terminal repeat, or from an alternative internal promoter.
Non-viral vectors or RNA may be used as well. Random chromosomal integration, or targeted integration (e.g., using a nuclease, transcription activator-like effector nucleases (TALENs), Zinc-finger nucleases (ZFNs), and/or clustered regularly interspaced short palindromic repeats (CRISPRs), or transgene expression (e.g., using a natural or chemically modified RNA) can be used.
For initial genetic modification of the cells to provide cells expressing a presently disclosed CAR, a retroviral vector is generally employed for transduction, however any other suitable viral vector or non-viral delivery system can be used. For subsequent genetic modification of the cells to provide cells comprising an antigen presenting complex comprising at least two co-stimulatory ligands, retroviral gene transfer
(transduction) likewise proves effective. Combinations of retroviral vector and an appropriate packaging line are also suitable, where the capsid proteins will be functional for infecting human cells. Various amphotropic virus-producing cell lines are known, including, but not limited to, PA12 (Miller, et al. (1985) Mol. Cell. Biol.5:431-437); PA317 (Miller, et al. (1986) Mol. Cell. Biol.6:2895-2902); and CRIP (Danos, et al. (1988) Proc. Natl. Acad. Sci. USA 85:6460-6464). Non -amphotropic particles are suitable too, e.g., particles pseudotyped with VSVG, RD114 or GALV envelope and any other known in the art.
Possible methods of transduction also include direct co-culture of the cells with producer cells, e.g., by the method of Bregni, et al. (1992) Blood 80:1418-1422, or culturing with viral supernatant alone or concentrated vector stocks with or without appropriate growth factors and polycations, e.g., by the method of Xu, et al. (1994) Exp. Hemat.22:223-230; and Hughes, et al. (1992) J. Clin. Invest.89:1817.
Non-viral approaches can also be employed for the expression of a protein in cell. For example, a nucleic acid molecule can be introduced into a cell by administering the nucleic acid in the presence of lipofection (Feigner et al., Proc. Nat!. Acad. Sci. U.S.A. 84:7413, 1987; Ono et al., Neuroscience Letters 17:259, 1990; Brigham et al., Am. J. Med. Sci.298:278, 1989; Staubinger et al., Methods in Enzymology 101:512, 1983), asialoorosomucoid-polylysine conjugation (Wu et al., Journal of Biological Chemistry 263:14621 , 1988; Wu et al., Journal of Biological Chemistry 264:16985, 1989), or by micro-injection under surgical conditions (Wolff et al., Science 247:1465, 1990). Other non-viral means for gene transfer include transfection in vitro using calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes can also be potentially beneficial for delivery of DNA into a cell. Transplantation of normal genes into the affected tissues of a subject can also be accomplished by transferring a normal nucleic acid into a cultivatable cell type ex vivo (e.g., an autologous or heterologous primary cell or progeny thereof), after which the cell (or its descendants) are injected into a targeted tissue or are injected systemically. Recombinant receptors can also be derived or obtained using transposases or targeted nucleases (e.g. Zinc finger nucleases,
meganucleases, or TALE nucleases). Transient expression may be obtained by RNA electroporation.
cDNA expression for use in polynucleotide therapy methods can be directed from any suitable promoter (e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metallothionein promoters), and regulated by any appropriate mammalian regulatory element or intron (e.g., the elongation factor 1α enhancer/promoter/intron structure). For example, if desired, enhancers known to preferentially direct gene expression in specific cell types can be used to direct the expression of a nucleic acid. The enhancers used can include, without limitation, those that are characterized as tissue- or cell-specific enhancers. Alternatively, if a genomic clone is used as a therapeutic construct, regulation can be mediated by the cognate regulatory sequences or, if desired, by regulatory sequences derived from a heterologous source, including any of the promoters or regulatory elements described above.
The resulting cells can be grown under conditions similar to those for unmodified cells, whereby the modified cells can be expanded and used for a variety of purposes. V. Pharmaceutical Compositions and Methods of Use
Antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins (including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter can be used to kill Foxp3- expressing cells. Antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins (including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter can be used to induce an immune response in a subject. Furthermore, antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins ( including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter can be used to selectively inhibit (e.g., inactivate, inhibit the proflieration of or kill) certain T cells, e.g., CD4+ T cells, CD127low T cells, CD25high T cells, Foxp3 high T cells, and combinations thereof, e.g., regulatory T (Treg) cells. Foxp3 has been identified as a key player in Treg function, and is the most definitive marker of CD4+CD25+ Treg cells. The presently disclosed antibodies and antigen binding proteins specifically target Treg cells and selectively inhibit Treg cells. In certain embodiments, the methods comprise administering a presently disclosed antibody or antigen binding protein to a subject. Antibodies and antigen binding proteins of the presently disclosed subject matter can reduce number of T cells (e.g., Tregs), deplete T cells (e.g., Tregs), inhibit immunosuppressive activity of T cells (e.g., Tregs), block T cells (e.g., Tregs) trafficking into lymph nodes or tumors, inhibit (inactivat and/or kill T cells (e.g., Tregs); and/or induce death of cancer cells.
Additionally, a presently disclosed antibody (including a bispecific antibody and an engineered antibody disclosed herein) or a composition comprising thereof, antigen binding protein (including CAR) or a composition comprising thereof, or immunoconjugate or a composition comprising thereof can be used to treat cancer. Most tumor-associated antigens are self-proteins, which elicit weak natural or induced T cell responses after immunotherapy. Treg cells have been shown to be able to recognize tumor-associated self-antigens and control T cell responses against various cancer antigens. In certain embodiments, the method comprise administering a presently disclosed antibody (including a bispecific antibody and an engineered antibody disclosed herein) or a composition comprising thereof, antigen binding protein (including CAR) or a composition comprising thereof, or immunoconjugate or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject. In certain embodiments, the cancer cell expresses Foxp3. In certain
embodiments, a presently disclosed antibody (including a bispecific antibody and an engineered antibody disclosed herein) or a composition comprising thereof, antigen binding protein (including CAR) or a composition comprising thereof, or
immunoconjugate or a composition comprising thereof is administered to the subject in an amount sufficient to prevent, inhibit, or reduce the progression of the cancer or tumor. Progression includes, e.g., the growth, invasiveness, metastases and/or recurrence of the cancer or tumor. Amounts effective for this use will depend upon the severity of the disease and the general state of the patient’s own immune system. Dosing schedules will also vary with the disease state and status of the patient, and will typically range from a single bolus dosage or continuous infusion to multiple administrations per day (e.g., every 4-6 hours), or as indicated by the treating physician and the patient’s condition.
The identification of medical conditions treatable by the antibodies (including bispecific antibodies and engineered antibodies disclosed herein) and compositions comprising thereof, antigen binding proteins (including CARs) and compositions comprising thereof, and immunoconjugates and compositions comprising thereof of the presently disclosed subject matter is well within the ability and knowledge of one skilled in the art. A clinician skilled in the art can readily determine, for example, by the use of clinical tests, physical examination and medical/family history, if an individual is a candidate for such treatment.
Non-limiting examples of cancers include various solid tumors, including, but not limited to, melanoma, ovarian cancer, breast cancer, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, and sarcoma. Anticancer immunotherapies can be improved by concomitant Treg blockade. In certain embodiments, the cancer subject receives or has received one or more anticancer immunotherapy. Non-limiting examples of anticancer immunotherapy include antibody therapy, cellular therapy (T cells, NK cells, etc.), CAR therapy, bone marrow
transplantation and donor leukocyte infusions, immune T cell regulatory therapies (immune checkpoint therapy, e.g., anti-PD-1 antibodies, anti-PD-L1 antibodies, anti- LAG3 antibodies, anti-CTLA-4 antibodies, and anti-CD47 antibodies), and vaccination- based drugs and variants thereof. In certain embodiments, the method comprises administering a presently disclosed Foxp3 antibody (including bispecific antibody and engineered antibody) or a composition comprising thereof, antigen binding protein (including a CAR) or a composition comprising thereof, or an immunoconjugate or a composition comprising thereof in combination with one or more other agents, including, but not limited to, anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-LAG3 antibodies, anti-CTLA-4 antibodies, and anti-CD47 antibodies. For example, an embodiment of the presently disclosed subject matter provides a method of treating a medical condition by administering a presently disclosed antibody or antigen binding protein with an antineoplastic agent. Treg blockade may also benefit the therapeutic effects of a wide variety of other cancer therapies, including, but not limited to, chemotherapy, targeted therapy (e.g., a tyrosine kinase inhibitor), hormonal therapy, radiation therapy, surgery, hyperthermia, topical therapy, light-activated therapy, and therapies where an activated immune system may be needed to enhance killing, to reduce residual tumor or leukemia cells, or to act synergistically or additively with such therapies. The antibody can be chemically or biosynthetically linked to one or more of the antineoplastic agents to make an antibody drug conjugate as well.
Any suitable method or route can be used to administer a presently disclosed antibody or antigen binding protein (e.g., a CAR), and optionally, to co-administer antineoplastic agents and/or antagonists of other receptors. Routes of administration include, for example, intravenous, intraperitoneal, intra arterial, subcutaneous, intrathecal, topical, or intramuscular administration. Co administered agents may be given by these routes and also orally. It should be emphasized, however, that the presently disclosed subject matter is not limited to any particular method or route of administration. It is noted that a presently disclosed antibody (including bispecific antibody and engineered antibody) or antigen binding protein (including a CAR) can be administered as a conjugate, which binds specifically to the receptor and delivers a toxic, lethal payload following ligand-toxin internalization.
It is understood that antibodies (including bispecific antibodies and engineered antibodies), antigen binding proteins (including CARs) or immunoconjugates of the presently disclosed subject matter can be administered in the form of a composition, e.g., a pharmaceutical composition comprising a pharmaceutically acceptable carrier.
Suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the binding proteins. The compositions of the injection may, as is well known in the art, be formulated so as to provide quick, sustained or delayed release of the active ingredient after administration to the mammal.
Other aspects of the presently disclosed subject matter include without limitation, the use of antibodies and nucleic acids that encode them as research tools for the detection of Foxp3 in cells and tissues. The presently disclosed subject matter provides methods for detecting Foxp3 in a whole cell or tissue. In certain embodiments, the method comprises (a) contacting a cell or tissue with a presently disclosed antibody or antigen-binding portion thereof comprising a detectable label; and (b) determining the amount of the labeled antibody or antigen-binding portion thereof bound to the cell or tissue by measuring the amount of detectable label associated with the cell or tissue, wherein the amount of bound antibody or antigen-binding portion thereof indicates the amount of Foxp3 in the cell or tissue.
Pharmaceutical compositions comprising the disclosed antibodies and nucleic acids are encompassed by the presently disclosed subject matter. Vectors comprising the nucleic acids of the presently disclosed subject matter for antibody-based treatment by vectored immunotherapy are also contemplated by the presently disclosed subject matter. Vectors include expression vectors which enable the expression and secretion of antibodies, as well as vectors which are directed to cell surface expression of the antigen- binding proteins, such as chimeric antigen receptors. Cells comprising the nucleic acids, for example cells that have been transfected with the vectors of the presently disclosed subject matter are also encompassed by the disclosure.
For use in diagnostic and research applications, kits are also provided that contain a presently disclosed anti-Foxp3 antibody or nucleic acids of the presently disclosed subject matter, assay reagents, buffers, and the like.
VI. Kits
The presently disclosed subject matter provides kits for the treatment or prevention of cancer. In certain embodiments, the kit comprises a therapeutic composition containing an effective amount of a presently disclosed antibody (including a bispecific antibody or an engineered antibody), antigen binding protein (including a CAR), or an immunoconjugate in unit dosage form. In certain embodiments, the kit comprises a sterile container which contains a therapeutic or prophylactic vaccine; such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art. Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
If desired, a presently disclosed antibody (including a bispecific antibody or an engineered antibody), antigen binding protein (including a CAR), or an
immunoconjugate is provided together with instructions for administering the cell to a subject having or at risk of developing a cancer. The instructions will generally include information about the use of the composition for the treatment or prevention of cancer. In other embodiments, the instructions include at least one of the following: description of the therapeutic agent; dosage schedule and administration for treatment or prevention of cancer or symptoms thereof; precautions; warnings; indications; counter-indications; over-dosage information; adverse reactions; animal pharmacology; clinical studies; and/or references. The instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
VII. Methods
1. Flow Cytometry Analysis.
For cell surface staining, cells were incubated with appropriate mAbs for 30 minutes on ice, washed, and incubated with secondary antibody reagents when necessary. For #32-BiTE staining, human T cells or cancer cells were incubated with different concentrations of #32- BiTE or control BiTE for 30 minutes on ice, washed, and incubated with secondary mAb against His-Tag. Flow cytometry data were collected on a FACS Calibur (Becton Dickinson) or LSRFortessa (BD Biosciences) and analyzed with FlowJo V8.7.1 and 9.4.8 software.
2. Selection and Characterization of scFv Specific for Foxp3 Peptide/HLA-A*02:01 Complexes.
Well established phage display libraries and screening methods known to those of skill in the art were used to select scFv fragments highly specific for a Foxp3
peptide/HLA-A2 complex. In certain embodiments, a human scFv antibody phage display library was used for the selection of mAb clones. In order to reduce the conformational change of MHC1 complex introduces by immobilizing onto plastic surfaces, a solution panning method was used in place of conventional plate panning. In brief, biotinylated antigens were first mixed with the human scFv phage library, then the antigen-scFv antibody complexes were pulled down by streptavidin-conjugated
Dynabeads M-280 through a magnetic rack.
Bound clones were then eluted and were used to infect E. Coli XL1-Blue. The scFv phage clones expressed in the bacteria were purified (Yasmina, et al., Protein Science 2008; 17(8): 1326-1335; Roberts et al., Blood 2002: 99 (10): 3748-3755).
Panning was performed for 3-4 cycles to enrich scFv phage clones binding to HLA- A*02:01/Foxp3 complex specifically. Positive clones were determined by standard ELISA method against biotinylated single chain HLA-A*02:01/Foxp3 peptide complexes. Positive clones were further tested for their binding to HLA-A2/peptide complexes on live cell surfaces by flow cytometry, using a TAP-deficient, HLA- A*02:01+ cell line, T2. T2 cells were pulsed with peptides (50 μg/ml) in the serum-free RPMI1640 medium, in the presence of 20 μg/ml β2 M overnight. The cells were washed, and the staining was performed as follows.
The cells were first stained with purified scFv phage clones, and followed by staining with a mouse anti-M13 mAb, and finally the goat F(ab)2 anti-mouse Ig's conjugate to FITC. Each step of the staining was done between 30-60 minutes on ice and the cells were washed twice between each step of the staining.
3. Engineering Full Length mAb Using the Selected ScFv Fragments.
Phage display technology allows for the rapid selection and production of antigen-specific scFv and Fab fragments, which are useful in and of themselves, or which can be further developed to provide complete antibodies, antigen-binding proteins or antigen-binding portions thereof. Complete mAbs with Fc domains have a number of advantages over the scFv and Fab antibodies. First, only full length Abs exert immunological function such as CDC and ADCC mediated via Fc domain. Second, bivalent mAbs offer stronger antigen-binding affinity than monomeric Fab Abs. Third, plasma half-life and renal clearance will be different with the Fab and bivalent mAb. The particular features and advantages of each can be matched to the planned effector strategy. Fourth, bivalent mAb may be internalized at different rates than scFv and Fab, altering immune function or carrier function. Alpha emitters, for example, do not need to be internalized to kill the targets, but many drugs and toxins will benefit from internalization of the immune complex. In certain embodiments, therefore, once scFv clones specific for Foxp3/HLA-A2 were obtained from phage display libraries, a full length IgG mAb using the scFv fragments was produced.
Full-length human IgG1 of the selected phage clones were produced in HEK293 and Chinese hamster ovary (CHO) cell lines, as described (Caron et al., J Exp Med 176:1191-1195.1992). In brief, antibody variable regions were sub-cloned into mammalian expression vectors, with matching human lambda or kappa light chain constant region and human IgG1 subclass Fc. Molecular weight of the purified full length IgG antibodies were measured under both reducing and non-reducing conditions by electrophoresis.
4. Engineering Chimeric Antigen Receptors and Immune Effector Cells.
Nucleic acids that encode antibodies and antigen-binding proteins identified herein can be used engineer recombinant immune effector cells. Methods and vectors to generate genetically modified T-cells, for example, are known in the art (See Brentjens et al., Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias in Blood
118(18):4817-4828, November 2011).
5. Characterization of the Full-Length Human IgG1 for the Foxp3/A0201 Complex.
Initially, specificities of the fully human IgG1 mAbs for the Foxp3
peptide/A0201 complex were determined by staining T2 cells pulsed with or without a Foxp3 peptide (e.g., Foxp3-7), or irrelevant EW or RHAMM-R3 control peptides, followed by secondary goat F(ab)2 anti-human IgG mAb conjugate to PE or FITC, using indirect or direct staining. The fluorescence intensity was measured by flow cytometry. The same method was used to determine the binding of the mAbs to fresh tumor cells and cell lines.
Exemplary Embodiments
1. An isolated antibody, or an antigen-binding portion thereof, which binds to a Foxp3 peptide bound to a human major histocompatibility complex (MHC) molecule. 2. The antibody or antigen-binding portion thereof of embodiment 1, wherein the human MHC molecule is a human leukocyte antigen (HLA) molecule.
3. The antibody or antigen-binding portion thereof of embodiment 2, wherein the HLA molecule is a HLA class I molecule.
4. The antibody or antigen-binding portion thereof of embodiment 3, wherein the HLA class I molecule is HLA-A.
5. The antibody or antigen-binding portion thereof of embodiment 4, wherein the HLA-A is HLA-A2.
6. The antibody or antigen-binding portion thereof of embodiment 5, wherein the HLA-A2 is HLA-A*02:01.
7. The antibody or antigen-binding portion thereof of any one of embodiments 1-6, wherein the Foxp3 peptide is a portion of a human Foxp3 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1.
8. The antibody or antigen-binding portion thereof of any one of embodiments 1-7, wherein the Foxp3 peptide has a length of 8-12 amino acids.
9. The antibody or antigen-binding portion thereof of embodiment 8, wherein the Foxp3 peptide has a length of 9 amino acids.
10. The antibody or antigen-binding portion thereof of embodiment 8, wherein the Foxp3 peptide has a length of 10 amino acids.
11. The antibody or antigen-binding portion thereof of any one of embodiments 1-10, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof , Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof. 12. The antibody or antigen-binding portion thereof of embodiment 11, wherein the Foxp3 peptide is Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8. 13. The antibody or antigen-binding portion thereof of any one of embodiments 1-8, and 10-12, comprising a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 11 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 14 or a modification thereof;
(b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 17 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino an acid sequence set forth in SEQ ID NO: 20 or a modification thereof;
(c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 23 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 26 or a modification thereof;
(d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 29 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 32 or a modification thereof;
(e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 35 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 38 or a modification thereof;
(f) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 41 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 44 or a modification thereof;
(g) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 47 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 50 or a modification thereof; and (h) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 53 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 56 or a modification thereof.
14. The antibody or antigen-binding portion thereof of any one of embodiments 1-8 and 10-13, comprising a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 10 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 13 or a modification thereof;
(b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 16 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 19 or a modification thereof;
(c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 22 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 25 or a modification thereof;
(d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 28 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 31 or a modification thereof;
(e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 34 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 37 or a modification thereof;
(f) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 40 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 43 or a modification thereof;
(g) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 46 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 49 or a modification thereof; and
(h) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 52 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 55 or a modification thereof.
15. The antibody or antigen-binding portion thereof of of any one of embodiments 1- 8 and 10-14, comprising a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 9 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 12 or a modification thereof;
(b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 15 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 18 or a modification thereof;
(c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 21 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 24 or a modification thereof; and
(d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 27 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 30 or a modification thereof;
(e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 33 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 36 or a modification thereof;
(f) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 39 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 42 or a modification thereof; (g) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 45 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 48 or a modification thereof; and
(h) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 51 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 54 or a modification thereof.
16. The antibody or antigen-binding portion thereof of any one of embodiments 1-8 and 10-15, comprising:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26;
(d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50; or
(h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56.
17. The antibody or antigen-binding portion thereof of embodiment 16, comprising: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44. 18. The antibody or antigen-binding portion thereof of any one of embodiments 1-8, and 10-16, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107.
19. The antibody or antigen-binding portion thereof of embodiment 18, comprising a heavy chain variable region that comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107.
20. The antibody or antigen-binding portion thereof of any one of embodiments 1-8, and 10-16, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108.
21. The antibody or antigen-binding portion thereof of embodiment 20, comprising a light chain variable region that comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108. 22. The antibody or antigen-binding portion thereof of any one of embodiments 18- 21, comprising:
(a) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 94;
(b) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 106; or (h) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 108.
23. The antibody or antigen-binding portion thereof of embodiment 22, comprising:
(a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106; or
(h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108.
24. The antibody or antigen-binding portion thereof of embodiment 23, comprising: a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104.
25. The antibody or antigen-binding portion thereof of embodiment 11, wherein the Foxp3 peptide is Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3. 26. The antibody or antigen-binding portion thereof of embodiment 25, comprising a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 59 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 62 or a modification thereof;
(b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 65 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 68 or a modification thereof;
(c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 74 or a modification thereof;
(d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 77 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 80 or a modification thereof; and
(e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 83 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 86 or a modification thereof.
27. The antibody or antigen-binding portion thereof of embodiments 25 or 26, comprising a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 58 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 61 or a modification thereof;
(b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 64 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 67 or a modification thereof;
(c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 70 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 73 or a modification thereof;
(d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 76 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 79 or a modification thereof; and
(e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 82 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 85 or a modification thereof.
28. The antibody or antigen-binding portion thereof of embodiment 25, 26 or 27, comprising a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 57 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 60 or a modification thereof;
(b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 63 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 66 or a modification thereof;
(c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 69 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof;
(d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 75 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 78 or a modification thereof; and (e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 81 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 84 or a modification thereof.
29. The antibody or antigen-binding portion thereof of any one of embodiments 25- 28, comprising:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74;
(d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80; or
(e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86.
30. The antibody or antigen-binding portion thereof of any one of embodiments 25- 29, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 109, 111, 113, 115, and 117.
31. The antibody or antigen-binding portion thereof of embodiment 30, comprising a heavy chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 109, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 115, or SEQ ID NO: 117. 32. The antibody or antigen-binding portion thereof of any one of embodiments 25- 31, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 110, 112, 114, 116, and 118.
33. The antibody or antigen-binding portion thereof of embodiment 32, comprising a light chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 114, SEQ ID NO: 116, or SEQ ID NO: 118. 34. The antibody or antigen-binding portion thereof of any one of embodiments 30- 33, comprising:
(a) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 110; (b) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence s that is at least about 80% homologous the amino acid sequence et forth in SEQ ID NO: 112;
(c) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 114;
(d) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 116; or
(e) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 118.
35. The antibody or antigen-binding portion thereof of embodiment 34, comprising:
(a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116; or
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118. 36. The antibody or antigen-binding portion thereof of embodiment 11, wherein the Foxp3 peptide is Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5. 37. The antibody or antigen-binding portion thereof of embodiment 36, comprising a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 89 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 92 or a modification thereof.
38. The antibody or antigen-binding portion thereof of embodiment 36 or 37, comprising a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 88 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 91 or a modification thereof.
39. The antibody or antigen-binding portion thereof of embodiment 36, 37 or 38, comprising a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 87 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 90 or a modification thereof.
40. The antibody or antigen-binding portion thereof of any one of embodiments 36- 39, comprising a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92.
41. The antibody or antigen-binding portion thereof of any one of embodiments 36- 40, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 119. 42. The antibody or antigen-binding portion thereof of embodiment 41, comprising a heavy chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 119. 43. The antibody or antigen-binding portion thereof of any one of embodiments 36- 42, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 120. 44. The antibody or antigen-binding portion thereof of embodiment 43, comprising a light chain variable region that comprises an amino acid sequence set forth in SEQ ID NO: 120.
45. The antibody or antigen-binding portion thereof of any one of embodiments 41- 44, comprising a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous the amino acid sequence set forth in SEQ ID NO: 120.
46. The antibody or antigen-binding portion thereof of embodiment 45, comprising a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120.
47. The antibody or antigen-binding portion thereof of any one of embodiments 13- 15, 26-28 and 37-39, wherein the modification is selected from deletions, insertions, substitutions, and combinations thereof.
48. The antibody or antigen-binding portion thereof of any one of embodiments 13- 15, 26-28 and 37-39, wherein the modification thereof consists of no more than 2, no more than 3, no more than 4, or no more than 5 modifications.
49. The antibody or antigen-binding portion thereof of any one of embodiments 1-48, which binds to the N-terminal of the Foxp3 peptide that is bound to the human MHC molecule.
50. The antibody or antigen-binding portion thereof of any one of embodiments 1-48, which binds to the C-terminal of the Foxp3 peptide that is bound to the human MHC molecule.
51. The antibody or antigen-binding portion thereof of any one of embodiments 1-50, which binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 1 x 10-7 M or less.
52. An isolated antibody, or an antigen-binding portion thereof, which cross- competes for binding to a Foxp3 peptide bound to a human MHC molecule with a reference antibody or antigen-binding portion comprising: (a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26;
(d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32; (e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50;
(h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56; (i) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(j) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(k) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74;
(l) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80; (m) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86; or
(n) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92, and
wherein the cross-competing antibody or antigen-binding portion thereof specifically binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 5 x 10-7 M or less.
53. An isolated antibody, or an antigen-binding portion thereof, which binds to the same epitope on a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26;
(d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50;
(h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56;
(i) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(j) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(k) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74;
(l) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80;
(m) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86; or
(n) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92.
54. An isolated antibody, or an antigen-binding portion thereof, which cross- competes for binding to a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106;
(h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108;
(i) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110; (j) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(k) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(l) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116;
(m) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118; or
(n) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120, and
wherein the cross-competing antibody or antigen-binding portion thereof specifically binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 5 x 10-7 M or less.
55. An isolated antibody, or an antigen-binding portion thereof, which binds to the same epitope on a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100; (e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106;
(h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108;
(i) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(j) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(k) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(l) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116;
(m) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118; or
(n) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120.
56. The antibody or antigen-binding portion thereof of any one of embodiments 52- 55, wherein the human MHC molecule is a HLA molecule. 57. The antibody or antigen-binding portion thereof of embodiment 56, wherein the HLA molecule is a HLA class I molecule.
58. The antibody or antigen-binding portion thereof of embodiment 57, wherein the HLA class I molecule is HLA-A.
59. The antibody or antigen-binding portion thereof of embodiment 58, wherein the HLA-A is HLA-A2.
60. The antibody or antigen-binding portion thereof of embodiment 59, wherein the HLA-A2 is HLA-A*02:01.
61. The antibody or antigen-binding portion thereof of any one of embodiments 52- 60, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof ; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof..
62. The antibody or antigen-binding portion thereof of embodiment 61, wherein the Foxp3 peptide is Foxp3-7 or a portion thereof.
63. The antibody or antigen-binding portion thereof of any one of embodiments 52- 62, wherein the reference antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104.
64. The antibody or antigen-binding portion thereof of embodiment 61, wherein the Foxp3 peptide is Foxp3-2 or a portion thereof.
65. The antibody or antigen-binding portion thereof of embodiment 61, wherein the Foxp3 peptide is Foxp3-4 or a portion thereof.
66. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, wherein the antibody comprises a human variable region framework region.
67. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, which is a fully human antibody or an antigen-binding portion thereof. 68. The antibody or antigen-binding portion thereof of any one of embodiments 1-66, which is a chimeric antibody or an antigen-binding portion thereof.
69. The antibody or antigen-binding portion thereof of any one of embodiments 1-66, which is a humanized antibody or an antigen-binding portion thereof.
70. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, wherein the antigen-binding portion of the antibody is an Fab, Fab', F(ab')2, Fv or single chain Fv (scFv).
71. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, which is of an IgG1, IgG2, IgG3, or IgG4 isotype.
72. The antibody or antigen-binding portion thereof of embodiment 71, which is of an IgG1 isotype.
73. The antibody or antigen-binding portion thereof of any one of the preceding embodiments, comprising one or more post-translational modifications.
74. The antibody or antigen-binding portion thereof of embodiment 73, wherein the one or more post-translational modifications comprise afucosylation.
75. The antibody or antigen-binding portion thereof of embodiment 74, comprising an afucosylated Fc region.
76. A composition comprising the antibody or antigen-binding portion thereof of any one of the preceding embodiments, and a pharmaceutically acceptable carrier.
77. An immunoconjugate comprising the antibody or antigen-binding portion thereof of any one of embodiments 1-75 linked to a therapeutic agent.
78. The immunoconjugate of embodiment 77, wherein said therapeutic agent is a drug, cytotoxin, or a radioactive isotope.
79. A composition comprising the immunoconjugate of embodiment 77 or 78 and a pharmaceutically acceptable carrier.
80. A bispecific molecule comprising the antibody or antigen-binding portion thereof of any one of embodiments 1-75, linked to a second functional moiety.
81. The bispecific molecule of embodiment 80, wherein the second functional moiety has a different binding specificity than said antibody or antigen binding portion thereof. 82. The bispecific molecule of embodiment 80 or 81, which recognizes a Foxp3 peptide bound to the MHC molecule and a cell surface protein.
83. The bispecific molecule of embodiment 82, wherein the cell surface protein is CD3 or CD16. 84. A composition comprising the bispecific molecule of any one of embodiments 80-83 and a pharmaceutically acceptable carrier.
85. An isolated nucleic acid that encodes an antibody or antigen-binding portion thereof of any one of embodiments 1-75.
86. An expression vector comprising the nucleic acid molecule of embodiment 85. 87. A host cell comprising the expression vector of embodiment 86.
88. A method for detecting Foxp3 in a whole cell or tissue, comprising:
(a) contacting a cell or tissue with an antibody or an antigen-binding portion thereof that binds to a Foxp3 peptide that is bound to a human MHC molecule, wherein the antibody or antigen-binding portion thereof comprises a detectable label; and
(b) determining the amount of the labeled antibody or antigen-binding portion thereof bound to the cell or tissue by measuring the amount of detectable label associated with the cell or tissue, wherein the amount of bound antibody or antigen-binding portion thereof indicates the amount of Foxp3 in the cell or tissue.
89. The method of embodiment 88, wherein the human MHC molecule is a HLA molecule.
90. The method of embodiment 89, wherein the HLA molecule is a HLA class I molecule.
91. The method of embodiment 90, wherein the HLA class I molecule is HLA-A. 92. The method of embodiment 91, wherein the HLA-A is HLA-A2.
93. The method of embodiment 92, wherein the HLA-A2 is HLA-A*02:01.
94. The method of any one of embodiments 88-93, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof ; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
95. The method of embodiment 94, wherein the Foxp3 peptide is Foxp3-7 or a portion thereof . 96. The method of embodiment 94, wherein the Foxp3 peptide is Foxp3-2 or a portion thereof.
97. The method of embodiment 94, wherein the Foxp3 peptide is Foxp3-4 or a portion thereof.
98. The method of any one of embodiments 88-97, wherein the antibody or antigen- binding portion thereof is the antibody or antigen-binding portion thereof of any one of embodiments 1-75.
99. A chimeric antigen receptor (CAR) specific for a Foxp3 peptide bound to a human MHC molecule.
100. The CAR of embodiment 99, wherein the human MHC molecule is a HLA molecule.
101. The CAR of embodiment 100, wherein the HLA molecule is a HLA class I molecule.
102. The CAR of embodiment 101, wherein the HLA class I molecule is HLA-A. 103. The CAR of embodiment 102, wherein the HLA-A is HLA-A2.
104. The CAR of embodiment 103, wherein the HLA-A2 is HLA-A*02:01.
105. The CAR of any one of embodiments 99-104, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
106. The CAR of embodiment 105, wherein the Foxp3 peptide is Foxp3-7 or a portion thereof.
107. The CAR of embodiment 105, wherein the Foxp3 peptide is Foxp3-2 or a portion thereof.
108. The CAR of embodiment 105, wherein the Foxp3 peptide is Foxp3-4 or a portion thereof. 109. The CAR of any one of embodiments 99-108, wherein the CAR comprises an antigen-binding portion comprising a heavy chain variable region and a light chain variable region.
110. The CAR of embodiment 109, wherein the CAR comprises a linker between the heavy chain variable region and the light chain variable region.
111. The CAR of embodiment 110, wherein the linker comprises the amino acid sequence set forth in SEQ ID NO: 135.
112. The CAR of any one of embodiments 99-111, wherein the CAR comprises the antigen-binding portion of any one of embodiments 1-75.
113. The CAR of any one of embodiments 109-112, wherein the antigen-binding portion comprises a single-chain variable fragment (scFv).
114. The CAR of embodiment 113, wherein the scFv is a human scFv.
115. The CAR of embodiment 114, wherein the human scFv comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, and 134.
116. The CAR of embodiment 115, wherein the human scFv comprises the amino acid sequence set forth in SEQ ID NO: 126.
117. The CAR of any one of embodiments 109-112, wherein the antigen-binding portion comprises a Fab, which is optionally crosslinked.
118. The CAR of any one of embodiments 109-112, wherein the antigen-binding portion comprises a F(ab)2.
119. An isolated nucleic acid encoding the CAR of any one of embodiments 99-118. 120. A vector comprising the isolated nucleic acid of embodiment 119.
121. A host cell comprising the nucleic acid of embodiment 119.
122. The host cell of embodiment 121, wherein the host cell is a T cell.
123. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3- expressing cell with the antibody antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof.
124. Use of the antibody or antigen-binding portion thereof of any one of
embodiments 1-75 or a composition comprising thereof to kill a Foxp3-expressing cell. 125. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in killing a Foxp3-expressing cell. 126. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3- expressing cell with the CAR of any one of embodiments 99-118 or a composition comprising thereof.
127. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof to kill a Foxp3-expressing cell.
128. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in killing a Foxp3-expressing cell.
129. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3- expressing cell with the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof.
130. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to kill a Foxp3-expressing cell.
131. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in killing a Foxp3-expressing cell.
132. A method of killing a Foxp3-expressing cell, comprising contacting a Foxp3- expressing cell with the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof.
133. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to kill a Foxp3-expressing cell.
134. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in killing a Foxp3-expressing cell.
135. The method of any one of embodiments 123, 126, 129, and 132, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
136. The use of any one of embodiments 124, 127, 130, and 133, wherein the Foxp3- expressing cell is a T cell selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
137. The antibody of embodiment 125, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
138. The bispecific antibody of embodiment 131, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4+ T cells, CD25high T cells,
CD127low T cells, Foxp3high T cells, and combinations thereof. 139. The immunoconjugate of embodiment 134, wherein the Foxp3-expressing cell is a T cell is selected from the group consisting of CD4+ T cells, CD25high T cells,
CD127low T cells, Foxp3high T cells, and combinations thereof.
140. A method of inducing an immune response in a subject, comprising
administering the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to the subject.
141. Use of the antibody or antigen-binding portion thereof of any one of
embodiments 1-75 or a composition comprising thereof to induce an immune response in a subject.
142. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in inducing an immune response.
143. A method of inducing an immune response in a subject, comprising
administering the CAR of any one of embodiments 99-118 or a composition comprising thereof to the subject.
144. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof to induce an immune response in a subject.
145. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in inducing an immune response.
146. A method of inducing an immune response in a subject, comprising
administering the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to the subject.
147. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to induce an immune response in a subject.
148. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in inducing an immune response.
149. A method of inducing an immune response in a subject, comprising
administering the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to the subject.
150. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to induce an immune response in a subject.
151. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in inducing an immune response. 152. A method of selectively inhibiting a T cell in a subject, comprising administering the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to the subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
153. Use of the antibody or antigen-binding portion thereof of any one of
embodiments 1-75 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
154. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in selective inhibition of a T cell, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
155. A method of selectively inhibiting a T cell in a subject, comprising administering the CAR of any one of embodiments 99-118 or a composition comprising thereof to the subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
156. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
157. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in selective inhibition of a T cell that is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
158. A method of selectively inhibiting a T cell in a subject, comprising administering the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to the subject.
159. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof. 160. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in selective inhibition of a T cell that is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof .
161. A method of selectively inhibiting a T cell in a subject, comprising administering the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to the subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
162. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to selectively inhibit a T cell in a subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
163. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in selective inhibition of a T cell that is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
164. The method of any one of embodiments 152, 155, 158, and 161, wherein the subject suffers from cancer.
165. The use of any one of embodiments 153, 154, 159, and 162, wherein the subject suffers from cancer.
166. The antibody or antigen-binding portion there of embodiment 154, wherein the subject suffers from cancer.
167. The CAR of embodiment 157, wherein the subject suffers from cancer.
168. The bispecific antibody of embodiment 160, wherein the subject suffers from cancer.
169. The immunoconjugate of embodiment 163, wherein the subject suffers from cancer.
170. The method of any one of embodiments 152, 155, 158, and 161, comprising one or more of the followings:
(i) reducing number of a T cell,
(ii) depleting the T cell,
(iii) inhibiting immunosuppressive activity of the T cell, and
(iv) blocking the T cell trafficking into lymph nodes. 171. The method of any one of embodiments 152, 155, 158, 161 and 170, wherein the T cell is a regulatory T cell.
172. The use of any one of embodiments 153, 156, 159, and 162, comprising one or more of the followings:
(i) reducing number of the T cell,
(ii) depleting the T cell,
(iii) inhibiting immunosuppressive activity of the T cell, and
(iv) blocking the T cell trafficking into lymph nodes.
173. The use of any one of embodiments 153, 156, 159, 162, and 172, wherein the T cell is a regulatory T cell.
174. The antibody or antigen-binding portion there of embodiment 154, which
(i) reduces number of the T cell,
(ii) depletes the T cell,
(iii) inhibits immunosuppressive activity of the T cell, and/or
(iv) blocks regulatory T cells trafficking into lymph nodes.
175. The antibody or antigen-binding portion there of embodiment 154 or 173, wherein the T cell is a regulatory T cell.
176. The CAR of embodiment 157, which
(i) reduces number of the T cell,
(ii) depletes the T cell,
(iii) inhibitsing immunosuppressive activity of the T cell, and/or
(iv) blocking the T cell trafficking into lymph nodes.
177. The CAR of embodiment 157 or 176. wherein the T cell is a regulatory T cell. 178. The bispecific antibody of embodiment 160, which
(i) reduces number of the T cell,
(ii) depletes the T cell,
(iii) inhibits immunosuppressive activity of the T cell, and/or
(iv) blocks the T cell trafficking into lymph nodes.
179. The bispecific antibody of embodiment 160 or 178, wherein the T cell is a regulatory T cell.
180. The immunoconjugate of embodiment 163, which
(i) reduces number of the T cell,
(ii) depletes the T cell, (iii) inhibits immunosuppressive activity of the T cell, and/or
(iv) blocks the T cell trafficking into lymph nodes.
181. The immunoconjugate of embodiment 163 or 179, wherein the T cell is a regulatory T cell.
182. A method of treating cancer, comprising administering an effective amount of the antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject.
183. A method of treating cancer, comprising administering an effective amount of the CAR of any one of embodiments 99-118 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject. 184. A method of treating cancer, comprising administering an effective amount of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject.
185. A method of treating cancer, comprising administering an effective amount of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof to a subject suffering from cancer, thereby inducing death of a cancer cell in the subject. 186. A method of treating cancer, comprising administering an effective amount of the antibody or antigen-binding portion thereof of any one of embodiments 1-75, the CAR of any one of embodiments 99-118, the bispecific antibody of any one of embodiments 80- 83, the immunoconjugate of embodiment 77 or 78, or a composition comprising thereof to a subject suffering from cancer, thereby inhibiting a T cell in the subject.
187. The method of embodiment 186, wherein the T cell that is inhibitied is a T regulatory cell.
188. The method of embodiment 186 or 187, wherein the T cell that is inhibitied is a CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cell, or a T cell exhibiting two or more of said markers.
189. The method of any one of embodiments 182-189, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
190. The method of any one of embodiments 182-189, wherein the subject is a human. 191. The method of any one of embodiments 182-190, wherein the subject receives an anticancer immunotherapy.
192. The method of any one of embodiments 182-191, wherein the cancer cell and/or the T cell expresses Foxp3.
193. Use of the antibody or antigen-binding portion thereof of any one of
embodiments 1-75 or a composition comprising thereof for treating cancer.
194. Use of the CAR of any one of embodiments 99-118 or a composition comprising thereof for treating cancer.
195. Use of the bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for treating cancer.
196. Use of the immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for treating cancer.
197. The use of any one of embodiments 193-195, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
198. The use of any one of embodiments 193-197, wherein the subject is a human. 199. The use of any one of embodiments 193-198, wherein the subject receives an anticancer immunotherapy.
200. The use of any one of embodiments 193-199, wherein the cancer cell expresses Foxp3.
201. The antibody or antigen-binding portion thereof of any one of embodiments 1-75 or a composition comprising thereof for use in treating cancer in a subject.
202. The antibody or antigen-binding portion thereof of embodiment 188, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
203. The antibody or antigen-binding portion thereof of embodiment 201 or 202, wherein the subject is a human.
204. The antibody or antigen-binding portion thereof of any one of embodiments 201- 203, wherein the subject receives an anticancer immunotherapy.
205. The antibody or antigen-binding portion thereof of any one of embodiments 198- 201, wherein the cancer cell expresses Foxp3. 206. The CAR of any one of embodiments 99-118 or a composition comprising thereof for use in treating cancer in a subject.
207. The CAR of embodiment 206, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
208. The CAR of embodiment 206 or 207, wherein the subject is a human.
209. The CAR of any one of embodiments 206-208, wherein the subject receives an anticancer immunotherapy.
210. The CAR of any one of embodiments 206-209, wherein the cancer cell expresses Foxp3.
211. The bispecific antibody of any one of embodiments 80-83 or a composition comprising thereof for use in treating cancer in a subject.
212. The bispecific antibody of embodiment 211, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
213. The bispecific antibody of embodiment 211 or 212, wherein the subject is a human.
214. The bispecific antibody of any one of embodiments 211-213, wherein the subject receives an anticancer immunotherapy.
215. The bispecific antibody of any one of embodiments 211-214, wherein the cancer cell expresses Foxp3.
216. The immunoconjugate of embodiment 77 or 78 or a composition comprising thereof for use in treating cancer in a subject.
217. The immunoconjugate of embodiment 216, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
218. The immunoconjugate of embodiment 216 or 217, wherein the subject is a human.
219. The immunoconjugate of any one of embodiments 216-218, wherein the subject receives an anticancer immunotherapy. 220. The immunoconjugate of any one of embodiments 216-219, wherein the cancer cell expresses Foxp3.
221. A kit for treating cancer, comprising the antibody or antigen-binding portion thereof of any one of embodiments 1-75.
222. A kit for treating cancer, comprising the CAR of any one of embodiments 99- 118.
223. A kit for treating cancer, comprising the bispecific antibody of any one of embodiments 80-83.
224. A kit for treating cancer, comprising the immunoconjugate of embodiment 77 or 78.
225. The kit of any one of embodiments 221-224, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
EXAMPLES
The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the antibodies, bispecific antibodies, compositions comprising thereof, screening, and therapeutic methods of the presently disclosed subject matter, and are not intended to limit the scope of what the inventors regard as their presently disclosed subject matter. It is understood that various other embodiments may be practiced, given the general description provided above.
Example 1– TCR-mimic Monoclonal Antibodies Specific for Fox3p-derived Epitopes Introduction
Effector T cell checkpoint blockade therapy has emerged as an effective therapy for several cancers by activating dormant or exhausted T cells to kill cancer cells in patients. Regulatory T cells (Tregs) expressing CD4, CD25 and Foxp3 are found abundantly in tumor tissues and are considered powerful inhibitors of anti-tumor immunity and a critical barrier to successful immunotherapy. Decreased ratios of CD8+ T cells to Tregs in tumor-infiltrating lymphocytes (TILs) is an indicator of poor prognosis in various human cancers. Depletion of Tregs has been shown to enhance spontaneous and vaccine-induced anti-tumor immune responses in animal models and in cancer patients in some cases. These studies demonstrate a prominent tumor-promoting role of Tregs in cancer and provide an opportunity for cancer immunotherapy in which modulation of Treg function could activate effector T cells to kill cancer cells.
Although depletion of Tregs in patients with cancer has recieved intense interest, effective applications have been hampered because Tregs do not express a specific cell surface molecule which can be targeted by a mAb nor a selectively druggable
intracytoplasmic pathway. Various strategies have been attempted for depletion or interference with Treg function, which typically have focused on targeting CD25 (the IL- 2 receptor) using mAbs specific for CD25 (Daclizumab) and Dennileukin difitox, a fusion protein of IL-2 and diphtheria toxin. In addition, elimination of Tregs by a mAb to glucorticoid-induced TNF-related protein (GITR) and suppression of Treg function by use of anti-CTLA4 antibodies, disruption of tumor homing by T-regs, or modulation of T cell plasticity, have also been attempted. Clinical studies with various cancers, in which Daclizumab and Dennileukin difitox were combined with vaccines, have demonstrated conflicting results. These data could be best explained because CD25 and GITR are both expressed not only in Tregs, but also in activated CD4 and CD8 effector T cells. A potential benefit of Treg depletion by targeting these molecules could be lost by concurrently elimination of activated effector lymphocytes. Therefore, there is no additional clinical evidence supports the broader applicability of these approaches. A recent in vitro study showed that a mAb specific for C-C chemokine receptor-4 (CCR4) could selectively deplete effector Tregs expressing a higher level of Foxp3 resulting in augmentation of CD8 T cell response specific for the NY-ESO-1 peptide. A
defucosylated, humanized anti-CCR4 mAb, Mogamulizumab, has been in clinical trials for various cancers. While the results await more studies, there are some data that showed complex results8-10. In addition to Tregs, CCR4 is known to be expressed on activated T cells, T helper 2, NK cells, macrophages and dendritic cells and the effects of the mAb could be complicated. Cyclophosamide has been shown to selectively suppress Tregs but the mechanisms are unknown. Cyclophosamide is well- known for its cytotoxicity to tumor cells and therefore, the clinical effects are difficult to attribute to only Treg depletion. Clearly, there is a great need for more specific approaches targeting Tregs and eliminating their suppressive function.
Foxp3 has been identified as a key player in Treg function, and is the most definitive marker of CD4+CD25+ Tregs. It is required for Treg cell lineage
differentiation, maintenance and importantly suppressive function. Apart from naturally occurring Tregs that arise in the thymus, inducible Treg cells have been identified, with predominance in infection and cancer. Interestingly, in addition to the critical role of Foxp3 in Tregs, many cancer cells also express Foxp3. Foxp3-expressing pancreatic carcinoma cells and cutaneous T cell lymphoma cells have been shown to suppress T cell proliferation. These studies suggest that cancer cells may share suppressive effects with Tregs, and that mimicking Treg function may represent a new mechanism of immune evasion in cancer.
As such, there are no selective drugs that can deplete Tregs. Foxp3 would be an ideal target except that it is no druggable by small molecules and it is an intracellular protein so antibody therapy is not feasible. Theoretically, peptides from Foxp3 protein that are degraded and processed for cell surface presentation can serve as a target of a TCR recognition. In a melanoma mouse model, Nair et al vaccinated mice with dendritic cells (DCs) electroporated with Foxp3-encoding mRNA. The vaccination elicited Foxp3-specific CTL response leading to preferential depletion of Foxp3+ Tregs in tumors. Simultaneously vaccinate mice with well-defined TRP2 melanoma antigen (Ag) and Foxp3 enhanced the vaccine-induced protection against highly metastatic B6/F10.9 melanoma. Although no Foxp3-derived epitopes were identified in this study, it demonstrated the possibility of using T cell approach to target Foxp3 protein.
Encouragingly, a recent in vitro human study has shown the results of identifying Foxp3- derived epitopes by human CD8 T cells in the context of HLA-A0201 molecule. Thus, a TCR-mimic mAb specific for Foxp3-derived epitopes should be able to specifically and directly deplete both Tregs and tumor cells expressing Foxp3 with double sword effects. Using a TCRm mAb, it was demonstrated that a TCRm mAb specific for human Foxp3, #32, can specifically binds and kill Foxp3-expressing Tregs and tumor cells. The depletion of Tregs should greatly unleash anti-tumor immunity by removing
immunosuppression caused by both Tregs and tumor cells.
Methods and Materials
1. Peptide Synthesis
All peptides were purchased and synthesized by Genemed Synthesis, Inc. (San Antonio, TX). Peptides were sterile and 80% to > 90% pure. The peptides were dissolved in DMSO and diluted in saline at 5 mg/mL and stored at -80°C. Control peptides used for HLA-A*02:01: Ewing sarcoma-derived peptide EW (QLQNPSYDK [SEQ ID NO:140]). Biotinylated single chain Foxp3p/HLA-A0201 complexes were synthesized by refolding the peptides with recombinant HLA-A*02 and beta2 microglobulin (β2M) at Eureka Therapeutics Inc. (Berkely, CA).
2. Cytokines, antibodies and cell lines
Human granulocyte-macrophage colony-stimulating factor (GM-CSF), interleukin (IL)-1β, IL-4, IL-6, IL-15, tumor necrosis factor (TNF)-α and prostaglandin E2 (PGE2) were purchased from R&D Systems (Minneapolis, MN). Beta 2- microglobulin (β2-m) and human IFN- γ were purchased from Sigma (St. Louis, MO). Cell isolation kits for CD14 and CD3 were purchased from Miltenyi Biotec. (Bergisch Gladbach, Germany). Human IL-2 and TGF-β were purchased from R&D Systems. Human Treg isolation kit was purchased from Stem cell Technology (Canada). Foxp-3+ and HLA- A*0201+ cutaneous T lymphoma cell lines MAC-1 and MAC-2A were kindly provided by Dr. Mad H. Anderson, at University of Denmark. TAP-deficient T2 cells, T leukemia cell line JURKAT, and tumor cells were HLA typed by the Laboratory of Cellular Immunology at Memorial Sloan-Kettering Cancer Center. The cell lines were cultured in RPMI 1640 supplemented with 5% to 10% FCS, penicillin, streptomycin, 2 mmol/l glutamine, and 2-mercaptoethanol at 37 C/5% CO2. Cells were checked regularly for mycoplasma. Cell identities were confirmed by phenotype or genotype.
Foxp3-#32 Fc-enhanced human IgG1, mouse IgG1, or BiTE formats and their respect controls were produced by Eureka Therapeutics Inc. APC conjugation to mouse IgG1 form of #32 and its control was done by using lightening-link APC antibody labeling kit according to the instructions of the manufacturer (Novus Biologicals). Mabs against human HLA A*02 (clone BB7.2), its isotype control mouse IgG2b (clone MPC- 11), human CD3 (clone HIT3A and OKT3), CD4 (clone RPA-T4), CD8 (clone RPA- T8). CD19 (clone HIB19), CD25 (clone 2A3), CD33 (clone WM53), CD45RA (clone HI100), mouse anti-His tag mAb (clone F24-796) conjugated to FITC or PE, were purchased from BD Biosciences, (San Diego, CA). Mabs specific for human Foxp3 clone PCH101, its isotype control rat IgG2a kappa, clone 236A/E7 and its isotype control mouse IgG1 kappa, CD4 (clone OKT4), CD14 (clone 61D3), CD127 (clone HIL-7R-M21), were purchased from eBioscience. Fixation and permeabilization kit for intracellular staining was also purchased from eBioscience. Luciferase substrate luciferine was purchased from Promega (Madison, MI).
3. In vitro stimulation and human T-cell cultures While many sequences can be predicted by the algorithms, these models do not predict binding to MHC when tested on live cells in 30% of cases, so in vitro testing is necessary. In addition, even if binding is demonstrated, a cytotoxic T cell response may not occur, requiring additional in vitro study.
After informed consent on Memorial Sloan-Kettering Cancer Center Institutional Review Board approved protocols, peripheral blood mononuclear cells (PBMC) from HLA-A*24:02 healthy donors were obtained by Ficoll density centrifugation. CD14+ monocytes were isolated by positive selection using mAb to human CD14 coupled with magnetic beads and were used for the first stimulation of T cells. The CD14- fraction of PBMC was used for isolation of CD3, by negative immunomagnetic cell separation using a pan T cell isolation kit. The purity of the cells was always more than 98%. T cells were stimulated for 7 days in the presence of RPMI 1640 supplemented with 5% autologous plasma (AP), 20 ug/mL synthetic peptides, 2 ug/mL β2-m, and 5-10 ng/mL IL-15. Monocyte-derived dendritic cells (DCs) were generated from CD14+ cells, by culturing the cells in RPMI 1640 medium supplemented with 1% AP, 500 units/mL recombinant IL-4, and 1,000 units/mL GM-CSF. On days 2 and 4 of incubation, fresh medium with IL-4 and GM-CSF was either added or replaced half of the culture medium. On day 5, 20 ug/mL class II peptide was added to the immature DCs. On day 6, maturation cytokine cocktail was added (IL-4, GM-CSF, 500 IU/mL IL-1, 1,000 IU/mL IL-6, 10 ng/ml TNF-α, and 1 ug/mL PGE-2). On day 7 or 8, T cells were re- stimulated with mature DCs at a 30:1, T:APC ratio, with IL-15. T cells were stimulated 3 to 5 times in the same manner, using either autologous DCs or CD14+ cells as antigen- presenting cells (APCs). A week after final stimulation, the peptide-specific T cell response was examined by IFN-γ enzyme-linked immunospot (ELISPOT) assay.
4. IFN-γ ELISPOT assay measuing peptide-specific T cell response
HA-Multiscreen plates (Millipore) were coated with 100 uL of mouse anti-human IFN-γ antibody (10 µg/mL; clone 1-D1K; Mabtech) in PBS, incubated overnight at 4°C, washed with PBS to remove unbound antibody, and blocked with RPMI 1640/10% autologous plasma (AP) for 2 h at 37°C. CD3+ T cells were plated with either autologous CD14+ (10:1 E: APC ratio) or autologous DCs (30:1 E: APC ratio). Various test peptides were added to the wells at 20 µg/mL. Negative control wells contained APCs and T cells without peptides or with irrelevant peptides. Positive control wells contained T cells plus APCs plus 20 ug/ml phytohemagglutinin (PHA, Sigma). All conditions were done in triplicates. Microtiter plates were incubated for 20 h at 37°C and then extensively washed with PBS/ 0.05% Tween and 100 µl/well biotinylated detection antibody against human IFN-γ (2 µg/mL; clone 7-B6-1; Mabtech) was added. Plates were incubated for an additional 2 h at 37°C and spot development was done as described (12, 13). Spot numbers were automatically determined with the use of a computer-assisted video image analyzer with KS ELISPOT 4.0 software (Carl Zeiss Vision).
5. 51Chromium release assay.
The presence of specific CTLs was measured in a standard chromium release assay as described (12, 13). Briefly, target cells alone, or pulsed with 50 µg/mL of synthetic peptides for 2 hours (in some cases for over night) at 37°C, are labeled with 50 uCi/million cells of Na 51
2 CrO4 (NEN Life Science Products, Inc.). After extensive washing, target cells are incubated with T cells at various E: T ratios. All conditions were done in triplicates. Plates were incubated for 4-5 hrs at 37°C in 5% CO2.
Supernatant fluids were harvested and radioactivity was measured in a gamma counter. Percentage specific lysis was determined from the following formula: [(experimental release - spontaneous release) / (maximum release– spontaneous release)] x 100%. Maximum release was determined by lysis of radiolabeled targets in 1% SDS12,13.
6. Treg generation.
CD4+ T cells or CD4+CD25+ T cells were purified from PBMCs by FACS sorting, and were stimulated with allo-PBMCs as stimulator/ feeder cells at ratios of effector: stimulator (E:S) 10-20:1, in the presence of recombinant human IL-1 (100 unit) and TGF-β (10ng/ml) for a week and the same stimulation was repeated in a weekly basis to maintain the Treg cells. The phenotype of Treg was determined by surface staining of the cells with mAbs to CD4, CD25+ and intracellular staining with foxp3. In certain embodiments, the mAb #32 (EXT017-32) was conjugated to APC and the specific recognition of the Treg cells was determined by binding of the mAb to the CD4+CD25+Foxp3+ cell population.
7. Phage screening, selection and characterization of scFv specific for Foxp3 derived epitopes
A human ScFv antibody phage display library (7 x 1010 clones) was used for the selection of mAb clones as described previously18. In brief, biotinylated irrelevant peptide/HLA-A0201 complexes were used to remove any clones that potentially bind to HLA-A0201. Remaining clones were screened for the Foxp3p/HLA-A0201 complex.
The selected clones were enriched by 3-4 rounds of panning processes. Positive clones were determined by standard ELISA method against biotinylated single chain
Foxp3/HLA-A*0201 complexes.
The positive scFv clones were further tested for their binding to HLA-A2/peptide complexes on live cell surfaces by indirect flow cytometry on: (i) a TAP deficient HLA- A*02:01+ cell line, T2, that are are defective in presentation of endogenous HLA- associated peptides. T2 cells were pulsed with Foxp3 peptides or irrelevant peptide; (ii) Foxp3+ HLA-A*02:01+cell lines such as MAC-1, MAC-2A and control cell lines Jurkat (HLA-A02-),, without pulsing with the peptide. The latter determine the recognition and binding affinity of the scFv to the naturally processed Foxp3-7p/A2 complex on tumor cells.
A total of 21 phage clones for Foxp3-7, 8 phage clones for Foxp3-2 and 3 phage clones for Foxp3-4 were screened for their ability to produce mAb specific for their respective Foxp3 peptide/A2 complex. The recognition of the Foxp3/A2 complex on live cells was measured by the binding of the phage scFv to T2 cells pulsed with the Foxp3 peptides and the other HLA-A2-binding peptides (50 ug/ml) in the serum-free
RPMI1640 medium, in the presence of 20 ug/ml β2M overnight. These include: T2 cells alone; T2 cells pulsed with Foxp3-7, -2 or-3 peptides; T2 cells pulsed with HLA-A2- binding irrelevant EW or RHAMM 3(R3) peptide. The cells in the above groups were washed, then stained with 3 steps:
Step 1: Phage staining: T2 cell suspensions (10 µl) were incubated with puried scFv phage clones, 90 µl, on ice, 60 minutes, followed by a wash.
Step 2: Mouse mAb against M13 coat protein (1 mg/ml) at 1:100 dilution, on ice, 30 minutes, then washed.
Step 3: Goat (Fab)2 anti-mouse Ig conjugated to FITC or PE (1:100 dilution), on ice, 30 minutes, then wash.
The cells were washed twice between each step of the staining. Controls for flow cytometry included: Unstained cells and cells stained with only goat anti-mouse Ig
(Fab)/FITC or PE.
8. Construction, expression and purification of Foxp3-BiTE
Foxp3-#32 BiTE was engineered as previously described19. N-terminal end of mAb#32 scFv was linked to the C-terminal end of an anti-human CD3ε scFv of a mouse monoclonal antibody by a flexible linker. The DNA fragments encoding for the scFv of two mAbs were synthesized by GeneArt (InVitrogen) and subcloned into Eureka’s mammalian expression vector pGSN-Hyg using standard DNA technology. A hexhistamine (His) tag was inserted downstream of the #32 BiTE at the C-terminal end for the detection and purification of the BiTE.
Chinese hamster ovary (CHO) cells were transfected with the Foxp3-BiTE expression vector and stable expression was achieved by standard drug selection with methionine sulfoximine (MSX), a glutamine synthetase (GS)-based method. CHO cell supernatants containing secreted Foxp3-BiTE molecules were collected. Foxp3-#32BiTE was purified using HisTrap HP column (GE healthcare) by FPLC AKTA system. Briefly, CHO cell culture was clarified and loaded onto the column with low imidazole concentration (20 mM), and then an isocratic high imidazole concentration elution buffer (500 mM) was used to elute the bound Foxp3-BiTE protein. A negative control BiTE antibody, was constructed from an irrelevant human IgG1 antibody (Cat#ET901, Eureka Therapeutics,) replacing Fox3-#32 scFv.
9. Treg generation, phenotypic analysis and Foxp3-#32 mAb binding
CD4+ T cells were purified from PBMCs of healthy HLA-A*0201 positive
donors by FACS sorting, and were stimulated with allo-PBMCs (HLA-A*0201 negative) as stimulator/ feeder cells at ratios of effector: stimulator (E:S) 1:5-10, or with tumor
cells in the presence of recombinant human IL-2 (100 unit) and TGF- ^ (10ng/ml) for one to two weeks and the same stimulation was repeated to maintain the Treg cells15-17. The phenotype of Tregs was determined by surface staining of the cells with mAbs to CD4,
CD25+, CD127, Foxp3 mAb #32 conjugated to APC, for 30 minutes on ice, washed.
Foxp3 expression was measured by intracellular protein staining using mAb to human
Foxp3 and Cytofix/CytoPerm kit (eBiosciences), according to the instructions of the
manufacture. Analysis was done by flow cytometry on a Beckman Dickinson Fortesa.
10. SvFv bi-specific antibody (BsAb) constructs mediated T cell cytotoxicity against and Treg cells in the context of HLA-A*0201
Two methods were used to measure the killing of Tregs by Foxp3 #32 BiTE. Since
natural Tregs only represent a few percentage of CD4+T cells, and therefore, in order to obtain sufficient readout on Treg killing, in vitro-generated Tregs were used as targets and the killing of Tregs was determined by reduction of Treg population by flow
cytometry. In brief, purified CD3 T cells by negative selection from HLA-A*02:01
negative donor (effectors) were incubated with Treg cells from HLA-A*02:01+ donor at an E: T ratio 5:1, in the presence or absence of specific BsAb (also referred to as “BiTE”) construct(1ug/ml) (e.g., BsAb-#32) or its control BsAb overnight. The cells were washed and stained with mAbs to CD4, CD25, foxp3 and HLA-A02. HLA-A2+ cells were gated (Tregs as target) andthe killing of Tregs was determined by the reduction of percentage of CD4+CD25+Foxp3+ cells in the HLA-A*0201+ cells, compared to control cultures with effectors alone or with effectors plus control BiTE. In addition, Treg-like T lymphoma cell lines MAC-1 and MAC-2A (Foxp3+/HLAA*0201+) were used as targets in ADCC assay by a standard 51Cr-release assay..
11. Antibody-dependent cellular cytotoxicity (ADCC)
Target cells used for ADCC were T2 cells pulsed with or without Foxp3-TLI peptide or EW control peptide, and Foxp3+ MAC-1 and MAC2A cell lines without peptide pulsing (see llist in above“Cytokines, antibodies and cell lines” section). The Foxp3 #32 Fc-enhanced IgG1or its isotype control, at various concentrations were incubated with target cells and fresh PBMCs at different effector: target (E:T) ratio for 4- 5 hrs. Cytotoxicity was measured by standard 51Cr-release assay.
Results
The present study targets Foxp3 positive cells selectively by use of a T cell receptor mimic (TCRm) mAb, named mAb #32, which recognizes a human Foxp3- derived CD8 T cell epitope, presented by HLA-A*0201 molecules on the cell surface. The results show that mAb #32 specifically bound to CD4+CD25highCD127lowFoxp3+ Treg cells from HLA-A*0201 positive donors, and tumor cell lines co-expressing Foxp3 and HLA-A*0201. Both afucosylated Fc enhanced human IgG1 and bispecific T cell engager formats of the Foxp3 mAb are able to kill in vitro generated Treg clones from HLA-A0201+ donos and“Treg-like” cutaneous lymphoma cells (HLA-A*02:01+) that have a high level expression of CD4, CD25 and Fox3+. This TCRm mAb may allow another approach to immunotherapy of human cancers or for other settings in which selective immune-stimulation is warranted. In addition, Fox3- targeting antibodies could be a novel approach in cancer immunotherapy by overcoming immunosuppresion caused by T-regs and tumor cells expressing Foxp3.
1. Selection of Foxp3-derived epitopes in the context of HLA-A*0201
Unlike other well-defined epitopes derived from tumor antigens such as WT1, there has been little information on the epitopes derived from Foxp-3 that induces T cell responses.. Therefore, the immunogenic epitopes that can generate cytotoxic CD8 T cells against Foxp3 were first identified. The entire human Foxp3 protein sequence was screened using three computer-based predictive algorithms BIMAS (http://www- bimas.cit.nih.gov/cgi-bin/molbio/ken_parker_comboform), SYFPEITHI
(http://www.syfpeithi.de/) and RANKPEP
(http://bio.dfci.harvard.edu/Tools/rankpep.html). The potential epitopes derived from human Foxp3 for CD8 T cells in the context of HLA-A*02:01 molecule (Foxp3-1 having an amino acid sequence set forth in SEQ ID NO:2, Foxp3-2 having an amino acid sequence set forth in SEQ ID NO:3, Foxp3-3 having an amino acid sequence set forth in SEQ ID NO:4, Foxp3-4 having an amino acid sequence set forth in SEQ ID NO:5, Foxp3-5 having an amino acid sequence set forth in SEQ ID NO:6, Foxp3-6 having an amino acid sequence set forth in SEQ ID NO:7, and Foxp3-7 having an amino acid sequence set forth in SEQ ID NO: 8) were selected to test if these peptides are able to induce specific CD8 T cell response from HLA-A*02:01+ donors. Importantly, all the selected HLA-A*0201-binding peptides were predicted to be cleaved at C-terminal, suggesting a higher probability of being processed by proteosomes.
2. Peptide-specific T cell response in the context of HLA-A*02:01 molecule While many sequences can be predicted by the algorithms, these models do not predict binding to MHC when tested on live cells in some cases, so in vitro testing is necessary. In addition, even if binding is demonstrated, a cytotoxic T cell response may not occur, requiring additional in vitro study. A number of Foxp-3-derived peptides were selected to test if they were able to stimulate CD8 T cell response from HLA- HLA-A*0201+ donors. After testing T cell responses from multiple donors with multiple peptides derived from human Foxp3, Foxp3-7 (amino acid sequence set forth in SEQ ID NO: 8) was selected for further study. Interestingly, this peptide has also been shown to induce strong peptide-specific CD8 T cellresponse which recognizes Foxp3+/HLA- A*0201+ cutaneous T lymphoma cells14.
CD3 T cells from multiple donors were stimulated with Foxp3-derived peptides for 3-5 rounds and the peptide-specific T cell response was measured by IFN-γ elispot assay and 51Cr-release assays. All the peptides, except for Foxp3-3 peptide, induced peptide-specific T cell response in multiple HAL-A*02:01+ donors.
T cells stimulated with Foxp3-1 to 6 peptides elicited peptide-specific response against only the stimulating peptides, but not other peptides, nor the controls including CD14+ antigen-presenting cells (APCs) or APCs pulsed with irrelevant peptide EW without Peptides (Figures1A-1D and Figure 2A). Peptide-specific T cell response was reproducible in multiple HLA-A2+ donors (Figures 2A-2C) and no cross-reactivity among the peptides were ever detected, as another example shown in Figure 2B.
To test if the peptide-induced T cells can recognize naturally processed Foxp3 epitopes, T cell lymphoma cell lines MAC-1 and MAC2A that are Foxp3 and HLA- A*02:01+ (Figure.3) (14) and Foxp3+ HLA-A*02:01- cell line Jurkat (Figure 7C) were used as targets. T cells stimulated with Foxp3-4, -6 or -7 peptides were able to recognize MAC-1 and MAC-2A cell lines but not Jurkat. T cells stimulated with Foxp3-6 and -7 peptides also recognized the Foxp3+ CD4+CD25 Treg cells, generated from a HLA- A*02:01+ donor, by stimulating the purified CD4+ cells with anti-CD3 mAb, IL-2 and TGF-β.
Peptide-specific T cell cytotoxicity of Foxp3-derived peptides Foxp3-1, -2, -4, -5, -6 and-7 was also studied. CD3 T cells from a HLA-A*02:01+ donor were stimulated with Foxp3-derived peptides Foxp3-1, -2, -4, -5, -6 or-7 and the cytotoxicity against the stimulating peptides on T2 cells was measured by 51Cr-release assay. As shown in Figures 4A-4F and Figures 5C and 5D, all tested Foxp3-derived peptides showed peptide-specific T cell cytotoxicity.
Additional experiments on Foxp3-7 (also denoted as TLI peptide or Foxp3-TLI peptide) shows that after four rounds of stimulation, T cells only recognize autologous CD14+ monocytes pulsed with TLI peptide, but not CD14+APC alone or pulsed with an irrelevant HLA-A*0201-binding peptide EW, by IFN- ^ elispot assay (FIGURE 5A). Importantly, T cell response was also observed against HLA-A*0201+Foxp3+ cutaneous T lymphoma cell lines MAC-1 and MAC-2A, but not the Foxp3+HLA-A* 0201-T leukemia cell line Jurkat, suggesting that TLI-stimulated T cells could recognize the naturally processed Foxp3 TLI epitope presented by HLA-A*0201 molecule (Figure 5B). Consistent with the results of IFN- ^ secretion, TLI peptide-stimulated T cells killed T2 pulsed with the TLI peptide and unpulsed MAC-1 and MAC-2A cells, but not HLA- A*0201-negtaive, Foxp3+ cell line HL-60 (Figure 5C and 5D). The above data demonstrated the identification of the Foxp3-derived epitopes in the context of HLA-A2 molecule and the generation of CTL responses against Foxp3 in both peptide-pulsed T2 cells and also T lymphoma cell lines expressing Foxp3/HLA-A2. This demonstrated that the native peptides are processed and presented in HLA on the cell surface for recognition by the T cell TCR. Based on these data, the Foxp3-7, Fox3-4 and Fox3-2 epitopes were selected to generate TCR-mimic monoclonal antibodies (mAbs) in the context of HLA-A*02:01 molecule.
3. Generation of TCR-mimic mAbs for the Foxp3 peptides in the context of HLA-A*02:01 molecule using phage display technology
A total of 21 phage clones for Foxp3-7, 8 phage clones for Foxp3-2 (Figure 6I) and 3 phage clones for Foxp3-4 (Figure 6J) were screened for their ability to produce mAb specific for their respective Foxp3 peptide/A2 complex. Figures 6A-6H show the binding data of phage scFv clones to Fox3-7. Figure 6I shows the binding data of phage scFv clones to Fox3-2. Figure 6J shows the binding data of phage scFv clones to Fox3- 4.
In particular, for Foxp3-7, by confirming that Foxp3-TLI peptide is able to induce epitope-specific T cell response which recognizes tumor cells expressing Foxp3 protein, a TCRm mAb specific for the TLI/HLA-A*0201 complex was generated, by using phage display technology as previously described18. In brief, single phage clones specific for the TLIp/A2 complex selected by screening of a phage library were further validated by ELISA. The selected clones were tested for their binding to live cells using T2 cells. Any clones that showed binding to T2 cells without the TLI peptide or with HLA-A*0201-binding irrelevant peptides were removed. After 5 rounds of screening, based on binding specificity to T2 cells pulsed with TLI peptide and live cells that express foxp3 and HLA-A*0201, eight scFv clones were selected for engineering into either full-length human IgG1 or bispecific T cell-engager mAb (T-BiTE) for further characterization.
For Foxp3-7: Clone #32, 17, 28, 54, 18, 53, 27, 20
4. Characterization of BsAbs specific for Foxp3-7 /HLA-A*02:01 complex
Mab killing functions can be enhanced in multiple ways. As a strategy to bring T cell cytotoxicity to the targets, eight bi-specific T cell engager constructs of the mAbs specific for the Foxp3-7 peptide/HLA-A2 complex were generated. The binding of the 8 BsAb (also referred to as“BiTE”) constructs specific for the Foxp3-7/HLA-A2 complex was tested on T2 cells pulsed with or without Foxp3-7 or irrelevant peptide and also on unpulsed T lymphoma cells MAC-1, MAC-2A and Jurkat cells.
As shown in Figures 7A-7C, all the BsAb constructs #17, 18, 20, 27, 28, 32, 53, and 54 bound very well to T2 cells pulsed with Foxp3-7 peptide, but not the T2 cells alone or with control peptide. However, BsAb #32 bound to both MAC-1 and MAC-2A cells, demonstrating it had the sufficient avidity to recognize the naturally processed epitope (Figures7A and 7B). #32 BiTE also bound to CD3+T cell line Jurkat , demonstrating the binding to CD3 with anti-CD3 arm of the BiTEs (Figure 7C). All the BsAb constructs bound to CD3+T cell line Jurkat, demonstrating the binding of the anti- CD3 arm of the BsAbs.
The specificity of the Foxp3-#32 mAb was further analyzed by use of binding of Foxp3-#32 BiTE to T2 cells containing analog TLI peptides. TLI peptide was substituted with alanine at position1, 2, 3, 4, 5, 7 and 8, or with glycine at position 10. Position 6 was already alanine and it was left intact. The mutant peptides were loaded onto T2 cells and tested for Foxp3-Bite binding. Alanine or glycine substitution at position 2, 8, 9 or 10 reduced the binding of foxp3-bite, as compared to the native TLI peptide (Figure 8A). The loss of the binding at position 2 and 9 could be due to the reduction of the peptide binding affinity to the HLA-A*02 molecule, as both peptides showed reduced binding in T2 stabilization assays (Figure 8B). No significant reduction of mutant peptides TLI-A8 and G10 in HLA-A2 stabilization, suggesting amino acids at these positions could be specifically recognized by the mAb. These results further demonstrated the specificity of the foxp3-BiTE against the TLI peptide/HLA-A*0201 complex and that binding to the HLA-A*0201 molecule alone was not sufficient.
5. Recognition of Foxp3-#32 mAb of human Tregs and tumor cells expressing Foxp3 and HLA-A*0201.
Although the Foxp3 mAb has demonstrated excellent specificity of binding to T2 cells pulsed with TLI peptide, it is crucial to test if the TLI epitope is processed and presented by HLA-A*0201 molecule in naturally occurring Tregs and induciable Tregs. A comparison was done on Foxp3 #32 mAb binding to Trges from HLA-A*0201 positive or negative PBMCs from healthy donors. CD4+ T cells were gated on CD25 high and CD127low population, a characteristics of natural Tregs. Mab-#32 mAb showed a significant shift on this population compared to its isotype control in HLA-A*0201+ donor (Figure 9A). In contrast, mAb-#32 did not bind to either CD4+CD25lowCD127high, or CD8+CD25highCD127high population (Figures 9B and 9C, respectively). Mab-#32 did not bind to the same CD4+CD25highCD127low Treg population in a HLA-A*0201 negative donor (Figure 9D).
Next, to test if the #32 mAb also recognize inducible Tregs, Treg cell lines were generated by stimulating purified CD4+T cells from a HLA-A0201+ donors with either allo-PBMCs (HLA-A*0201 negative) or tumor cells MAC-2A in the presence of IL-2 and TGF-β15-17. A typical staining pattern is shown in Figures 10A-10B. As shown in Figures 10A-10B, EXT017-32 specifically bound to HLA-A*02:01+ Treg cells. Tregs were generated by stimulating CD4+T cells from a HLA-A*0201 positive donor with either HLA-A*0201 negative allo-PBMC (Figure 10A) or MAC-2A tumor cells (Figure 10B). Foxp3 #32 mAb bound strongly to CD4+CD25+T cells compare to the single CD4+ T cell population (upper right), and that mAb- #32 only bound to CD4+CD25+Foxp3+ population but not CD4+CD25+Foxp3 negative population (lower left panel). The results were similar between Tregs generated by either allo-PBMC (Figure 10A) or MAC-2A cell stimulation (Figure 10B). These results demonstrated that Foxp3-#32 mAb is able to specifically recognize Tregs expressing Foxp3 epitope in the context of HLA-A*0201 molecule.
It has been shown that may types of human cancer cells express Foxp3, which is associated with poor prognosis and distant metastasis. Therefor, the Foxp3 mAb could also directly attack tumor cells, expressing Foxp3.
6. Mab-#32 BiTE-mediated T cell cytotoxicity against Foxp3+ Tregs and tumor cells in the context of HLA-A*0201
Experiments were done to test whether mAb-#32 BiTE was able to mediate T cell killing against Foxp3 TLI epitope in the context of HLA-A*0201 molecule. PBMCs were used as effectors and the cytotoxicity was measured by standard 51Cr-release assay, in the presence or absence of the #32 BsAb and isotype-derived control BsAb. T2 cells were pulsed with TLI or control HLA-A0*201-binding peptide CT, and PBMCs were used as effectors, in the presence or absence of the mAb#32- BiTE or isotype-derived control BiTE. Mab-#32 BiTE mediated a specific and strong killing activity against T2 cells pulsed with TLI peptide, but not T2 cells alone or pulsed with control peptide (Figure 11A). Similarly, PBMCs in the presence of mAb-#32-BiTE showed dose- dependent killing against Treg-like T lymphoma cell lines MAC-1 and MAC2A cells at the indicated concentrations (Figures 11C and 11D), but not Foxp3+/ HLA-A*0201 negative cell line HL-60 (Figure 11B) or Jurkat cells (Figure 11E). Both MAC-1 and MAC-2A cell lines do not express CD3, and T cell cytotoxicity against these cell lines are not mediated by scFv arm of anti-CD3 mAb. These data demonstrated that mAb-#32 BiTE is able to kill the tumor cells expressing Foxp3 and HLA-A0*201, and
demonstrated the specificity of killing for the cells expressing Foxp3. Since Treg population in healthy PBMCs might be too low to measure the cytotoxicity mediated by the bite, Treg clones were generated from HLA-A0201+ donor by allo-stimulation, followed by limiting dilution. Two different T reg clones were incubated with PBMCs from HLA-A*02-negative donor, in the presence or absence of Foxp3-BiTE or control bite for overnight. Then the percentage of Foxp3+ cells in HLA- A*0201 + T cells population (only from Treg clones) was measured by flow cytometry. Reduction of the HLA-A*02+Foxp3+ cells indicates the Foxp3-BiTE-mediated T cell killing. Figures.12A-12B show the results from two Treg clones respectively. Flow cytometer data shown in Figures 12A-12B was summarized as a bar graph in Figure 12C to show the reduction of percent Treg cells. In clone 3, the percentage of HLA- A*02+Foxp3+ T cells decreased about more than 60% in the presence of #32-BiTE (3.45%), compared to controls with only effectors (PBMC: 9.88%) or effectors with control BiTE (9.11%). The similar results were obtained from the other Treg clone.
These results demonstrated that the #32-BiTE is able to recognize and mediates T cell cytotoxicity against Tregs in the context of HLA-A*0201 molecule.
7. Binding affinity of the EXT017 antibodies to Foxp3 peptide/HLA-A*02:01 complex The 8 EXT017-BsAbs were evaluated for binding affinity to EXT017 peptide/HLA-A*02:01 complex using biolayer interferometry (BLI), and the results are shown in Table 5.
Table 5
Figure imgf000155_0001
The binding affinity of the EXT017-32-hIgG1 and mIgG1 to EXT017 peptide/HLA-A*02:01 complex was measured using surface plasmon resonance (SPR), and the results are shown in Table 6. Table 6
Figure imgf000156_0001
Discussion
Development of therapeutic strategies to deplete or interfere with the function of Tregs, without compromising anti-tumor immunity has been challenging, because there is no Treg-specific surface marker. One of the obstacle for specific depletion of Tregs is that both Tregs and effector T cells exhibit an activated phenotype, especially in expression patterns of cell surface molecules; both are high in CD25, cytotoxic T lymphocyte-associated antigens (CTLA)-4, OX40 and glucocorticoid-induced tumor necrosis factor receptor-related protein (GITR) expression. Depletion of Tregs alone or in combination of vaccination by anti-CD25 mAb has been shown to contribute to improved anti-tumor immune response in various animal models. However, clinically, targeting CD25 by using dacizumab (anti-CD25 mAb) or Denileukin diftitox, a recombinant protein composed of IL-2 and the active domain of diphtheria toxin, has shown less promising outcome. Although Tregs express CTLA-4, results from clinical studies suggest that the effects of anti-CTLA-4 treatment is due to increased activation of effector T cells, or there is a Treg-depletion effect early after initial administration which permits the optimal induction of effector cell responses. Most recently, Sakaguchi group has shown that C-C chemokine receptor 4 (CCR4) is predominantly expressed in effector Tregs (eTregs; CD45RA-Foxp3hi CD4+) in TILs in melanoma patients. In vitro depletion of this population using anti-CCR4 mAb enhanced T cell responses when stimulated with NY-ESO-1 peptides. When the mAb was administered to a patient with T cell leukemia-lymphoma, the eTreg fraction is reduced and NY-ESO-1-specific CD8 T cell response is augmented. CCR-4 is the cognate receptor for CC chemokines CCL17 and CCl22, and is expressed on functionally distinct subsets of immune cells. In addition to Tregs, it is also expressed in activated T cells, Th2 cells, platelets, NK cells, macrophages and dendritic cells (DCs). Similarly, targeting GITR using cognate ligand or agonistic mAb has been shown to be effective in anti-tumor response in murine models. However, the clinical efficacy of such strategy remains to be investigated in human trials. Foxp3 is a transcription factor in the forkhead/winged-helix family and is predominantly found in CD4+CD25+ Treg cells, consisting of 2% to 5% of the total CD4+ T cell population, but significantly enriched in the tumor mass, peripheral blood or ascites in cancer patients. Tumor cells not only recruit Tregs to tumor sites but also play a crucial role in the conversion of naïve and or effector T cells into Tregs by providing antigenic stimulation and cytokines directly or indirectly through tumor-infiltrating lymphocytes (TILs). In TILs, the ratio of effector T cells to Tregs determines disease outcome. There exists a strong correlation between tumor progress and Tregs, with increased numbers or frequency of Tregs associated with poor prognosis in a variety of cancers, including ovarian, breast, non-small cell lung, hepatocellular, renal cell, pancreatic and gastric carcinomas1-7. Although the precise mechanisms of Treg-mediated immune suppression is not fully understood, Tregs can act in part by secreting immunosuppressive cytokines and suppressing the activation and proliferation of T cells in a cell contact-dependent mechanism. In Tregs, the most important function of Foxp3 is that its ectopic expression in normal T cells can convert them to Treg-like cells functionally and phenotypically. Therefore, Foxp3 has been considered to be a master regulatory gene for lineage-commitment and developmental differentiation of Tregs.
Interestingly, immunosuppressive function of Foxp3 is not only limited in Tregs. Hinz et al have reported that Foxp3 expression was detected in majority of pancreatic cancer patients. Ectopic expression of Foxp3 in pancreatic adenocarcinoma cells induced complete inhibition of T cell proliferation in vitro, and this effect was partially abrogated by silencing Foxp3 gene expression using siRNA. The authors suggested that pancreatic cancer cells expressing Foxp3 mimic Treg function, which may represent a new mechanism of immune evasion in cancer patients. Immune suppressive function of Foxp3 has also been suggested in adult T leukemia (ATL) patients who are characterized by constitutive expression of CD4 and CD25 in leukemic cells and marked immune- deficient state. Subsequently, there have been numerous reports that many types of cancer cells express Foxp3, further support the important role of Foxp3 in tumor suppressive microenvironment.
Foxp3 has long been considered the most definitive marker for Tregs, and is an attractive target. However, there are no drugs or mAbs that inhibit Foxp3, because the protein is intracellular, inaccessible to traditional antibody therapy. While it is intracellular, certain proteasome-processed FOXp3 peptides can be expressed on the cell surface when presented by MHC class I molecules, to be recognized by CD8 T cells. Indeed, Anderson group has demonstrated that Foxp3-specific cytotoxic CD8 T cells are present in human PBMCs, especially in cancer patients. Such CTLs are able to recognize Tregs and kill malignant Treg-like cutaneous T lymphoma cells in a HLA-A*0201- restricted manner. The study has thus demonstrated the possibility of targeting intracellular Foxp3 by an approach of using peptide-specific CTLs. A novel approach in the instant application has been taken to develop a T cell receptor mimic mAb (TCRm), specific for the Foxp3 peptide in the context of HLA-A*02:01. A number of peptides were identified from Fopx3 protein that could induce specific CD8 T cell response in the context of HLA-A*0201 molecule. Because Foxp3 is a member of the large forkhead protein family, to avoid potential off targets, the peptide TLI was selected for mAb engineering, which has a minimal homology with other Foxp family members, such as Foxp1, 2 and 4. The mAb was successfully generated and is able to specifically bind to and kill Foxp3 positive cancer cell lines and Treg cells.
It is known that activated conventional T cells can transiently express Foxp3. However, activated CD4+CD25+T cells and Tregs, can be distinguished by the expression of CD127, the alpha chain of IL-7 receptor. Tregs express low CD127 but activated T cells express high CD127. The TCRm Foxp3-#32 only bound to CD127 low CD25 high, Foxp3 high population of CD4+ T cells in HLA-A*0201+ healthy donors. When in vitro-induced Tregs were tested, the Foxp3 mAb only bound to CD4+CD25hi population but not to CD25lo/negative population. In general, TCRm mAb recognizes a low density peptide/HLA complex, and low expression of either targeted proteins or HLA would be difficult for such a mAb to have effective recognition. Therefore, a Foxp3 TCRm mAb would only bind to the cells highly expressing Foxp3. In addition, in tumor microenvironment, T cells are profoundly in an inactivated state and
CD25hiFoxp3hiCD4 T cells are most likely Tregs. This opens a therapeutic window of designing an effective combination therapies by depleting Treg first using the Foxp3-#32 mAb, followed by strategies that expand effector T cells or augment their effector activity, using approaches such as vaccination or check point blockade. Such strategy could avoid cocominatant depletion of Tregs and activated T cells, whereby achieving selective and more effective therapeutic outcome. Example 2-Peptide Epitope Mapping for Foxp3-7 Top Phage Clones Epitope mapping of the 8 EXT017 antibodies agasint Foxp3-7 peptide was performed to determine the epitope necessary for antibody binding. Briefly, mutant EXT017 peptides were generated with alanine substitutions at positions 1-9 and these were individually pulsed onto the surface of T2 cells. Peptide-loaded T2 cells were stained with EXT017-phage and binding was measured by flow cytometry. Table 7 lists the mutant EXT017 amino acid sequences used in the experiment. Table 8 summarizes the Mean Fluorescence Intensity (MFI) values of EXT017-phage FACS staining towards T2 cells loaded with the panel of alanine mutants shown in Table 7. As shown in Table 8, EXT017-mut2 was for anchor position. The histograms of the 8 EXT017-phage binding to T2 cells loaded with the panel of alanine mutants are shown in Figures 13A- 13H.
Table 7
Figure imgf000159_0001
Positions affecting antibody binding (binding MFI <20% of the wildtype peptide) are marked with *.
Example 3– CAR T cell Targeting Foxp3
Adoptive transfer of CAR T cells has emerged as an effective therapy for B-cell ALL and other hematopoietic cancers. However, greater potency and mechanisms to defeat the immunosuppressive tumor microenvironment are still needed for many cancer types. One approach is to overcome tumor resistance by modifying CAR T cells to constitutively express a therapeutic TCRm CAR that can kill Treg cells, preferentially in the vicinity of the antigen directed CAR T cells. A T-cell receptor-mimic (TCRm) CAR that is reactive to a peptide fragment of Foxp3 is generated, that can kill Foxp3 expressed on the surface of the Treg cells and tumor cells in the context of HLA-A*02:01. T cells are modified to express this Foxp3-targeted CAR.
Generation of retroviral constructs and transduction
A presently disclosed Foxp3 scFv sequence is used to generate a second generation CAR targeting Foxp3. The variable heavy and light chains (connected with a (Gly4Ser)3 linker) and a c-myc tag are added to allow detect CAR expression by flow cytometry. The CAR is optimized to include a spacer domain upstream of the CD28 transmembrane domain if required. This is cloned into the SFG retroviral vector containing the CD28 and CD3 zeta or 4-1BB or other similar signaling CAR forms that are well known in the art, e.g., Park (2016). Stable 293 viral producing cell lines are generated, and used to transduce primary human T cells as described previously (Rafiq (2017)). Following transduction, CAR expression is verified by flow cytometry, staining for the c-myc tag incorporated into the Foxp3-CAR. Retroviral transduction of primary human T cells has been previously described (Koneru (2015)).
Characterizing the specificity and activity of the Foxp3 CAR in vitro and in vivo.
The ability of the Foxp3-CAR to redirect T cell function is analyzed in vitro by detecting the Foxp3-specific cytotoxicity, cytokine secretion and proliferative function of PR20-transduced T cells, as previously described (Rafiq (2017)). Specific cytotoxicity is measured using a standard 51Chromium release assay against Tregs from HLA-A0201+ donors or Foxp3+HLA-A*0201 positive or negative tumor cell lines. Specific cytokine secretion is measured by collecting supernatant from 24 hr cocultures of Foxp3T cells and Foxp3+ or Foxp3- cells. The presence of cytokines is analyzed using Luminex technology. The ability of the foxp3 CAR to stimulate T cell proliferation is analyzed by coculturing transduced T cells with Foxp3+ tumor cells and monitoring T cell expansion with flow cytometry using enumeration beads. T cells transduced to express a CAR targeted to an irrelevant antigen will be used as a control, as published previously (Rafiq (2017)).
Characterizing the anti-tumor efficacy of the foxp3 CAR in vivo.
The ability of Foxp3-CAR T cells to eradicate Foxp3+ tumor in vivo is assessed using preclinical xenogeneic murine models. SCID-Beige or NSG mice is inoculated (either systemically for hematological malignancies, or intraperitoneally for solid tumors) with tumor cells modified to express FireFly Luciferace (FFLuc) to allow bioluminescent imaging (Rafiq (2017)). Mice are subsequently treated with systemic infusion of foxp3- or control CAR T cells (expressing a CAR targeted to an irrelevant antigen). Disease progression is monitored both clinically and with bioluminescent imaging as described previously (Rafiq (2017)). Persistence of CAR T cells is determined by collecting peripheral blood from treated mice and flow cytometry to detect CAR+ T cells. CAR function over time is determined by detection of cytokines in the serum of treated mice using Luminex technology.
Various patents and publications are cited herein, the contents of which are hereby incorporated by reference in their entireties.
REFERENCES 1. Wolf AM, Wolf D, Steurer M et al. Increase of regulatory T cells in the
peripheral blood of cancer patients. Clin. Cancer. Res.9: 606, 2003.
2. Liyanage UK, Moore TT, Joo HG et al. Prevalence of regulatory T cells is
increased in peripheral blood and tumor microenvironment of patients with pancreas or breast adenocarcinoma. J. Immunol.169: 2756, 2002.
3. Curiel TJ, Coukos G, Zou L et al. Specific recruitment of regulatory T cells in ovarian carcinoma fosters immune privilege and predicts reduced survival. Nat. Med.10: 942, 2004.
4. Baumgartner J, Wilson C, Palmer B et al. Melanoma induces immunosuppression by up-regulating Foxp3+ regulatory T cells. J. Surg. Res.141: 72, 2007.
5. Dannull J. Su Z, Rizzieri D et al. Enhancement of vaccine-mediated antitumor immunity in cancer patients after depletion of regulator T cells.
J. Clin. Invest.115 (12): 3623
6. Bos PD, Plitas G. Rudra D et al. Transient regulatory T cell ablation deters
oncogene-driven breast cancer and enhances radiotherapy. J Exp. Med.210 (11): 2435, 2013.
7. Nair S, Boczkowski, Fassnacht M et al. Vaccination against the forkhead family transcription factor Foxp3 enhances tumor immunity. Cancer Res.67 (1): 371, 2007.
8. Sugiyama D, Nishikawa H, Maeda Y et al. Anti-CCR4 mAb selectively depletes effector-type Foxp3+CD4+ regulator T cells, evoking antitumor immune responses in humans. PNAS.110 (44): 17945, 2013.
9. Rech AJ, Mick R, Martin S et al. CD25 blockade depletes and selectively
reprogram regulatory T cells in concert with immunotherapy in cancer patients. Sci. Transl. Med.4 (134): 134rd62, 2012.
10. Litzinger MT, Fermando R, Curiel TJ et al. IL-2 immunotoxin denileukin diftitox reduces regulator T cells and enhances vaccine-mediated T-cell immunity. Blood 110 (9): 3192-201.2007.
11. Heid JB, Schmidt A, Oberle N et al. Foxp3+CD25-tumor cells with regulatory function in sezary syndrome. J. Invest. Dermatol.129: 2875-2885, 2009.
12. Rena May, Tao Dao, Javier Pinilla-Ibarz et al. CD4+ peptide epitopes from the WT1 oncoprotein stimulate CD4+ and CD8+ T cells that recognize and kill human malignant mesothelioma tumor cells. Clin. Cancer Res.13: 4547-4555, 2007. 13. Tao Dao, Tatyana Koronsvit, Victoria Zakhaleva et al. Identification of a human cyclin D1-derived peptide that induces human cytotoxic CD4 T cells. Plos One 4 (8): e6730, 2009.
14. Larsen SK, Munir S, Woetmann A et al. Functional characterization of Foxp3- specific spontaneous immune responses. Leukemia 27: 2332-2340, 2013.
15. Lu L, Zhou X, Wang J etal. Characterization of protective human
CD4+CD25+Foxp3+ regulatory T cells generated with IL-2, TGF-b and retinoic acid. PLoSONE5(12): e15150. doi:10.1371/journal.pone.0015150, 2010.
16. Godfrey WR, Ge YG, Spoden DJ et al. In vitro-expanded human CD4+CD25+ regulatory T cells can markedly inhibit allogenic dendritic cell-stimulated MLR cultures. Blood 104: 453-461, 2004. 17. Levings MK, Sangregorio R, Sartirana C et al. Human CD4+CD25+ T suppressor cells clones produce transforming growth factor b, but not interleukin 10, and are distinct from type 1 T regulator cells. J Exp Med.196 (10): 1335-1346, 2002. 18. Tao Dao, Su Yan, Nicholas Veomett, Dmitry Pankov, Liang Zhou, Tatyana
Krontsvit, Andrew Scott, Joseph Witten, Peter Maslak, Emily Casey, Taochao Tan, Hong Liu, Victoria Zakhaleva, Michael Curcio, Ekaterina Doubrovina, Richard R. O’Reilly, Cheng Liu and David A. Scheinberg. Targeting the intracellular WT1 oncogene product with a therapeutic human antibody. Sci Transl Med.5 (176) 176ra33, 2013.
19. Tao Dao, Dmitry Pankov, Andrew Scott, Tatyana Korontsvit, Victoriya
Zakhaleva, Yiyang Xu, Jingyi Xiang, Su Yan, Manuel Direito de Morais
Guerreiro, Nicholas Veomett, Leonid Dubrovsky, Michael Curcio, Ekaterina Doubrovina, Vladimir Ponomarev, Cheng Liu, Richard J O’Reilly & David A Scheinberg. Therapeutic bispecific T-cell engager antibody targeting the intracellular oncoprotein WT1. Nat. Bio. Tech. doi:10.1038/nbt.3349, 2015.
20. Koneru M, Purdon TJ, Spriggs D, Koneru S, Brentjens RJ. IL-12 secreting
tumor-targeted chimeric antigen receptor T cells eradicate ovarian tumors.
Oncoimmunology 2015; 4: e994446.
21. Rafiq S, Purdon TJ, Daniyan AF et al. Optimized T-cell receptor-mimic chimeric antigen receptor T cells directed toward the intracellular Wilms tumor 1 antigen. Leukemia, doi: 10.1038/leu.2016.373.2017.
22. Park JH, Geyer MB, Brentjens RJ. Blood.2016 Jun 30;127(26):3312-20. doi:
10.1182/blood-2016-02-629063.
Appendix A Linker (underlined)
His tag + HA tag (italicized) #17
Lv(lamda)
DNA sequence
cagtctgtgttgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggt
AA sequence
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLG [SEQ ID NO: 94] Hv
DNA sequence
gaagtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaagg cttctggagacaccttcagcaggtatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggaaggatcatccctatctttggtacaccaaactacgcacagaagttccagggcagagtcacgattacc gcggacgaattcacgagcacagcctacatggagctgagcagcctgagatctgaggacaccgccatgtatta ctgtgcgcgctctatctaccgttactctgaatacgatcattggggtcaaggtactctggtgaccgtctcctca AA sequence
EVQLVQSGAEVKKPGSSVKVSCKASGDTFSRYAISWVRQAPGQGLE WMGRIIPIFGTPNYAQKFQGRVTITADEFTSTAYMELSSLRSEDTAM YYCARSIYRYSEYDHWGQGTLVTVSS [SEQ ID NO: 93] Full-length AA sequence
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQ SGAEVKKPGSSVKVSCKASGDTFSRYAISWVRQAPGQGLEWMGRII PIFGTPNYAQKFQGRVTITADEFTSTAYMELSSLRSEDTAMYYCARS IYRYSEYDHWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS
[SEQ ID NO: 121] Full-length DNA sequence
cagtctgtgttgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcgg cggcggcggctctggtggtggtggatccctcgagatggccgaagtgcagctggtgcagtctggggctgag gtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggagacaccttcagcaggtatgctatc agctgggtgcgacaggcccctggacaagggcttgagtggatgggaaggatcatccctatctttggtacacc aaactacgcacagaagttccagggcagagtcacgattaccgcggacgaattcacgagcacagcctacatg gagctgagcagcctgagatctgaggacaccgccatgtattactgtgcgcgctctatctaccgttactctgaata cgatcattggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcacc atcaccatggcgcatacccgtacgacgttccggactacgcttct #18
Lv(lamda)
DNA sequence
caggctgtgctgactcagccaccctcagcgtctgggacccgcgggcagagggtcaccatctcttgttctgga agcagctccaacatcggaagtaatactgtaaactggtaccagcagctcccaggaacggcccccaaactcct catctatagtaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcacctcagcc tccctggccatcagtgggctccagtctgaagatgaggctgattattactgtgcagcatgggatgacagcctga atggtcagggggtcttcggaactgggaccaaggtcaccgtcctaggt
AA sequence
QAVLTQPPSASGTRGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKL LIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDD SLNGQGVFGTGTKVTVLG [SEQ ID NO: 96] Hv
DNA sequence
gaggtccagctggtgcagtctggggctgaggtgaagaagcctgggacctcagtgaaggtttcctgcaagg catctggatacaccttcagcaactactatatacactgggtgcgacaggcccctggacaagggcttgagtgga tgggagcgatcaaccctagtgttggtaccacaacctacgcacagaactttcagggcagagtcaccatgacc agtgacacgtccacgagcacagtctacatggagttgagcagcctgacatctgaggacacggccgtgtatta ctgtgcgcgcgactggtggggtcagatgatgtacgatggttggggtcaaggtactctggtgaccgtctcctc a
AA sequence
EVQLVQSGAEVKKPGTSVKVSCKASGYTFSNYYIHWVRQAPGQGL EWMGAINPSVGTTTYAQNFQGRVTMTSDTSTSTVYMELSSLTSEDT AVYYCARDWWGQMMYDGWGQGTLVTVSS [SEQ ID NO: 95] Full-length AA sequence
QAVLTQPPSASGTRGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKL LIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDD SLNGQGVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQ SGAEVKKPGTSVKVSCKASGYTFSNYYIHWVRQAPGQGLEWMGAI NPSVGTTTYAQNFQGRVTMTSDTSTSTVYMELSSLTSEDTAVYYCA RDWWGQMMYDGWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVP DYAS [SEQ ID NO: 122] Full-length DNA sequence
CAGGCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCGCGG GCAGAGGGTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGG AAGTAATActgtaaactggtaccagcagctcccaggaacggcccccaaactcctcatctatagtaat aatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatc agtgggctccagtctgaagatgaggctgattattactgtgcagcatgggatgacagcctgaatggtcagggg gtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcggcggcggcggctc tggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggctgaggtgaagaagcct gggacctcagtgaaggtttcctgcaaggcatctggatacaccttcagcaactactatatacactgggtgcgac aggcccctggacaagggcttgagtggatgggagcgatcaaccctagtgttggtaccacaacctacgcaca gaactttcagggcagagtcaccatgaccagtgacacgtccacgagcacagtctacatggagttgagcagcc tgacatctgaggacacggccgtgtattactgtgcgcgcgactggtggggtcagatgatgtacgatggttggg gtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcaccatcaccatgg cgcatacccgtacgacgttccggactacgcttct #20
Lv(lamda)
DNA sequence
cagtctgtcgtgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctgg aagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttcggtgttcggcggagggaccaagctgaccgtcctaggt
AA sequence
QSVVTQPPSVSAAPGQKVTISCSGSSSNIGAGYDVHWYQQLPGTAP KLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSY DSSLSGSVFGGGTKLTVLG [SEQ ID NO: 98] Hv
DNA sequence
gaggtccagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaagg cttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggagggatcatccctatctttggtacagcaaactacgcacagaagttccagggcagagtcacgattacc gcggacgaatccacgagcacagcctacatggagctgagcagcctgagatctgaggacacggccgtgtatt actgtgcgcgctactcttacaaatacggtgaactggatacttggggtcaaggtactctggtgaccgtctcctca AA sequence
EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLE WMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAV YYCARYSYKYGELDTWGQGTLVTVSS [SEQ ID NO:97] Full-length AA sequence
QSVVTQPPSVSAAPGQKVTISCSGSSSNIGAGYDVHWYQQLPGTAP KLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSY DSSLSGSVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAEVQLV QSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGI IPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR YSYKYGELDTWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS
[SEQ ID NO: 123] Full-length DNA sequence
cagtctgtcgtgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctgg aagcagctccaacatcggggcaggttatgatgtacactggtaccagcagcttccaggaacagcccccaaac tcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggcacctc agcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcag cctgagtggttcggtgttcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcg gcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggctga ggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagcagctatgctat cagctgggtgcgacaggcccctggacaagggcttgagtggatgggagggatcatccctatctttggtacag caaactacgcacagaagttccagggcagagtcacgattaccgcggacgaatccacgagcacagcctacat ggagctgagcagcctgagatctgaggacacggccgtgtattactgtgcgcgctactcttacaaatacggtga actggatacttggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatc accatcaccatggcgcatacccgtacgacgttccggactacgcttct #27
Lv(lamda)
DNA sequence
caggctgtgctgactcagccaccctcggtgtcagtggccccaggaaagacggccagacttacctgtgggg gaaacaacattggaagtgaaagtgtacattggtaccagcagaagccaggccaggcccctttactggtcgtct atgatgatgacgaccggccctccgggatccctgagcgattctctggctccaactctgggaacacggccacc ctgaccatcagcagggtcgaggccggcgatgaggccgactattactgtcaggtgtgggatcgaagtagtga tcattggtttttcggcggagggaccaagctgaccgtcctaggt
AA sequence
QAVLTQPPSVSVAPGKTARLTCGGNNIGSESVHWYQQKPGQAPLLV VYDDDDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDR SSDHWFFGGGTKLTVLG[SEQ ID NO: 100] Hv
DNA sequence
caggtgcagctggtgcaatctggggctgaggtgaagaagcctggggcctctgtgaaggtttcctgcaaggc atctggatacaccttcaccaattactatattcactgggtgcgacaggcccccggacaagggcttgagtggatg ggaataatcagacctagtggtggtatcacaaactacgcacagaagttccagggcagggtcagcatgaccag ggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggacactgccgtgtattact gtgcgcgctcttgggactacttcgcttctaacgatttctggggtcaaggtactctggtgaccgtctcctca AA sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGL EWMGIIRPSGGITNYAQKFQGRVSMTRDTSTSTVYMELSSLRSEDTA VYYCARSWDYFASNDFWGQGTLVTVSS [SEQ ID NO: 99] Full-length AA sequence
QAVLTQPPSVSVAPGKTARLTCGGNNIGSESVHWYQQKPGQAPLLV VYDDDDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDR SSDHWFFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLVQS GAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGLEWMGIIR PSGGITNYAQKFQGRVSMTRDTSTSTVYMELSSLRSEDTAVYYCAR SWDYFASNDFWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS
[SEQ ID NO: 124] Full-length DNA sequence
caggctgtgctgactcagccaccctcggtgtcagtggccccaggaaagacggccagacttacctgtgggg gaaacaacattggaagtgaaagtgtacattggtaccagcagaagccaggccaggcccctttactggtcgtct atgatgatgacgaccggccctccgggatccctgagcgattctctggctccaactctgggaacacggccacc ctgaccatcagcagggtcgaggccggcgatgaggccgactattactgtcaggtgtgggatcgaagtagtga tcattggtttttcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcggcgg cggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcaatctggggctgaggtgaag aagcctggggcctctgtgaaggtttcctgcaaggcatctggatacaccttcaccaattactatattcactgggt gcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggtatcacaaactac gcacagaagttccagggcagggtcagcatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacactgccgtgtattactgtgcgcgctcttgggactacttcgcttctaacgatttc tggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcaccatcacc atggcgcatacccgtacgacgttccggactacgcttct #28
Lv(lamda)
DNA sequence
cagtctgtgctgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtgcactggtaccagcagcttccaggaacagcccccaaa ctcctcatctatggtaacagcgatcggccctccggggtccctgaccgattctctggctccaagtctggcacct cagcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagca gcctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggt
tctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcc AA sequence QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSDRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLG [SEQ ID NO: 102] Hv
DNA sequence
cagatgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaagg cttctggaggcaccttcagcacctacgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggagggatcatccctatatttgggacagcaaactacgcacagaagttccagggcagggtcacgattac cgcggacaaatccacgagcacagcctacatggaggtgaggaacctgagatctgaggacacggccgtgtat tactgtgcgcgcgctgaatacgtttacggtgaatacgatcagtggggtcaaggtactctggtgaccgtctcct ca AA sequence
QMQLVQSGAEVKKPGSSVKVSCKASGGTFSTYAISWVRQAPGQGL EWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMEVRNLRSEDTA VYYCARAEYVYGEYDQWGQGTLVTVSS [SEQ ID NO: 101] Full-length AA sequence
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPK LLIYGNSDRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYD SSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQMQLVQ SGAEVKKPGSSVKVSCKASGGTFSTYAISWVRQAPGQGLEWMGGII PIFGTANYAQKFQGRVTITADKSTSTAYMEVRNLRSEDTAVYYCAR AEYVYGEYDQWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYA
S [SEQ ID NO:125] Full-length DNA sequence
cagtctgtgctgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcactgg gagcagctccaacatcggggcaggttatgatgtgcactggtaccagcagcttccaggaacagcccccaaa ctcctcatctatggtaacagcgatcggccctccggggtccctgaccgattctctggctccaagtctggcacct cagcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagca gcctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcg gcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctggggctga ggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagcacctacgctat cagctgggtgcgacaggcccctggacaagggcttgagtggatgggagggatcatccctatatttgggaca gcaaactacgcacagaagttccagggcagggtcacgattaccgcggacaaatccacgagcacagcctaca tggaggtgaggaacctgagatctgaggacacggccgtgtattactgtgcgcgcgctgaatacgtttacggtg aatacgatcagtggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccat caccatcaccatggcgcatacccgtacgacgttccggactacgcttct #32 Lv(lamda)
DNA sequence
cagtctgtgttgactcagccaccctcagtgtcagtggccccaggaaagacggccaggattacctgtggggg aaacaacattggaagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctgtgctggtcatct attatgatagcgaccggccctcagggatccctgagcgattctctggctccaactctgggaacacggccaccc tgaccatcagcagggtcgaagccggggatgaggccgactattactgtcaggtgtgggatagtagtagtgat cattatgtcttcggaactgggaccaaggtcaccgtcctaggt
AA sequence
QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVI YYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSS DHYVFGTGTKVTVLG [SEQ ID NO: 104] Hv
DNA sequence
gaggtgcagctggtggagtccgggggaggcgtggtccagcctgggaggtccctgagactctcctgtgcag cctctgggttcaccttcaataatcatgctatgcactgggtccgccaggctccaggcaaggggctggagtggg tggcagttatatcatttgatggagacgataaattctacgcagactccgtgaagggccgattcaccatctccaga gacaattccaggaacacactgtttctgcaaatgaacaacctgagacctgaggacacggctgtgtattactgtt cgagagatccatatcactttgcctcggggagttattcctactttgactactggggccagggaaccctggtcac cgtctcctca AA sequence
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNHAMHWVRQAPGKGL EWVAVISFDGDDKFYADSVKGRFTISRDNSRNTLFLQMNNLRPEDT AVYYCSRDPYHFASGSYSYFDYWGQGTLVTVSS [SEQ ID NO: 103] Full-length AA sequence
QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVI YYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSS DHYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVESGG GVVQPGRSLRLSCAASGFTFNNHAMHWVRQAPGKGLEWVAVISFD GDDKFYADSVKGRFTISRDNSRNTLFLQMNNLRPEDTAVYYCSRDP YHFASGSYSYFDYWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPD YAS [SEQ ID NO: 126] Full-length DNA sequence
cagtctgtgttgactcagccaccctcagtgtcagtggccccaggaaagacggccaggattacctgtggggg aaacaacattggaagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctgtgctggtcatct attatgatagcgaccggccctcagggatccctgagcgattctctggctccaactctgggaacacggccaccc tgaccatcagcagggtcgaagccggggatgaggccgactattactgtcaggtgtgggatagtagtagtgat cattatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcggcggcggc ggctctggtggtggtggatccctcgagatggccgaggtgcagctggtggagtccgggggaggcgtggtcc agcctgggaggtccctgagactctcctgtgcagcctctgggttcaccttcaataatcatgctatgcactgggtc cgccaggctccaggcaaggggctggagtgggtggcagttatatcatttgatggagacgataaattctacgca gactccgtgaagggccgattcaccatctccagagacaattccaggaacacactgtttctgcaaatgaacaac ctgagacctgaggacacggctgtgtattactgttcgagagatccatatcactttgcctcggggagttattcctac tttgactactggggccagggaaccctggtcaccgtctcctcaactagtggccaggccggccagcaccatc accatcaccatggcgcatacccgtacgacgttccggactacgcttct #53
Lv(lamda)
DNA sequence
aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtgaccatctcctgcacccgca gcagtggcagcattgccagccactatgtgcagtggtaccagcagcgcccgggcagttcccccaccactgtg atctatgagaataaccaaagaccctctggggtccctgatcggttctctggctccatcgacagttcctccaactc tgcctccctcaccatctctggactgaagactgaggacgaggctgactactactgtcaatcttatgatcgcagc aatcatgtggtattcggcggagggaccaagctgaccgtcctaggt
AA sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASHYVQWYQQRPGSSPTT VIYENNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYD RSNHVVFGGGTKLTVLG [SEQ ID NO: 106] Hv
DNA sequence
caggtgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaagg catctggatacaccttcaccaactactatatccactgggtgcgacaggcccctggagaagggcttgagtgga tgggaataatcagacctagtggcggtaacacaaactacgcacagaagttccagggcagagtcaccatgacc agggacacgtccacgcgcacggtctatatggagttgagtagcctgagatctgaggacacggccgtgtatta ctgtgcgcgctcttggaactctcgtgacgttgattcttggggtcaaggtactctggtgaccgtctcctca AA sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGEGL EWMGIIRPSGGNTNYAQKFQGRVTMTRDTSTRTVYMELSSLRSEDT AVYYCARSWNSRDVDSWGQGTLVTVSS [SEQ ID NO: 105] Full-length AA sequence
NFMLTQPHSVSESPGKTVTISCTRSSGSIASHYVQWYQQRPGSSPTT VIYENNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYD RSNHVVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLVQS GAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGEGLEWMGIIRP SGGNTNYAQKFQGRVTMTRDTSTRTVYMELSSLRSEDTAVYYCAR SWNSRDVDSWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS
[SEQ ID NO: 127] Full-length DNA sequence
aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtgaccatctcctgcacccgca gcagtggcagcattgccagccactatgtgcagtggtaccagcagcgcccgggcagttcccccaccactgtg atctatgagaataaccaaagaccctctggggtccctgatcggttctctggctccatcgacagttcctccaactc tgcctccctcaccatctctggactgaagactgaggacgaggctgactactactgtcaatcttatgatcgcagc aatcatgtggtattcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcgg cggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcagtctggggctgaggtg aagaagcctggggcctcagtgaaggtctcctgcaaggcatctggatacaccttcaccaactactatatccact gggtgcgacaggcccctggagaagggcttgagtggatgggaataatcagacctagtggcggtaacacaaa ctacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgcgcacggtctatatggag ttgagtagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttggaactctcgtgacgttgattc ttggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatcaccatcac catggcgcatacccgtacgacgttccggactacgcttct #54
Lv(lamda)
DNA sequence
caggctgtgctgactcagccaccctcgctgtctggaggccccaggcagagggtcaccatctcctgttctgga agcacctccaacatcggaaaaaatggtgtgagctggtaccagcagctcccaggaaaggctcccaaactcct catctataatgatcatctgttgtcctcaggggtctctgaccgcttttctggctccaagtctggcacgtcagcctcc ctggccatcagtggactccagtctgacgatgaagctgattattactgtgcgacatgggacgacactttggatct tccgctattcggcggagggaccaaggtcaccgtcctaggt
AA sequence
QAVLTQPPSLSGGPRQRVTISCSGSTSNIGKNGVSWYQQLPGKAPKL LIYNDHLLSSGVSDRFSGSKSGTSASLAISGLQSDDEADYYCATWDD TLDLPLFGGGTKVTVLG [SEQ ID NO: 108] Hv
DNA sequence
cagatgcagctggtgcagtctggggctgaggtggagaagcctggggcctcagtgaagctctcctgcaagg cttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggagggatcatccctatctttggtacagcaaactacgcacagaagttccagggcagagtcacgattacc gcggacgaatccacgagcacagcctacatggagctgagcagcctgagatctgaggacacggccgtgtatt actgtgcgcgcccgtcttactactctatcaaatctgcttgggatcattggggtcaaggtactctggtgaccgtct cctca
AA sequence
QMQLVQSGAEVEKPGASVKLSCKASGGTFSSYAISWVRQAPGQGLE WMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAV YYCARPSYYSIKSAWDHWGQGTLVTVSS [SEQ ID NO: 107] Full-length AA sequence
QAVLTQPPSLSGGPRQRVTISCSGSTSNIGKNGVSWYQQLPGKAPKL LIYNDHLLSSGVSDRFSGSKSGTSASLAISGLQSDDEADYYCATWDD TLDLPLFGGGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQMQLVQS GAEVEKPGASVKLSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPI FGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARPS YYSIKSAWDHWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 128] Full-length DNA sequence
Caggctgtgctgactcagccaccctcgctgtctggaggccccaggcagagggtcaccatctcctgttctgg aagcacctccaacatcggaaaaaatggtgtgagctggtaccagcagctcccaggaaaggctcccaaactc ctcatctataatgatcatctgttgtcctcaggggtctctgaccgcttttctggctccaagtctggcacgtcagcct ccctggccatcagtggactccagtctgacgatgaagctgattattactgtgcgacatgggacgacactttgga tcttccgctattcggcggagggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcggcggcg gcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctggggctgaggtgga gaagcctggggcctcagtgaagctctcctgcaaggcttctggaggcaccttcagcagctatgctatcagctg ggtgcgacaggcccctggacaagggcttgagtggatgggagggatcatccctatctttggtacagcaaact acgcacagaagttccagggcagagtcacgattaccgcggacgaatccacgagcacagcctacatggagct gagcagcctgagatctgaggacacggccgtgtattactgtgcgcgcccgtcttactactctatcaaatctgctt gggatcattggggtcaaggtactctggtgaccgtctcctcaactagtggccaggccggccagcaccatca ccatcaccatggcgcatacccgtacgacgttccggactacgcttc
Appendix B
Figure imgf000174_0001
Appendix C
Linker (underlined)
His tag + HA tag (italicized)
#5
DNA Sequence:
caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacacccatgtggtattcggcggagggaccaagctgaccgtcctaggtt ctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaagtgcagctggtgcagtc tggggctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacaccttcaccaactactatatacac tgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaacctacccacaga acttccagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgagga cacggccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggccagggaaccctggtcaccgtct cctcaactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct Amino Acid Sequence:
QSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNTHVVFGGGTKL TVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGASVKISCKASRYT FTNYYIHWVRQAPGQGLEWMGIINPSGGSTTYPQNFQGRLTMTRDTSTSTVYME LSSLRSEDTAMYYCARGWSGYDPGDFWGQGTLVTVSSTSGQAGQHHHHHHGA YPYDVPDYAS
Light chain DNA Sequence:
caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacacccatgtggtattcggcggagggaccaagctgaccgtcctaggt Light Chain Amino Acid Sequence:
QSALTQPPSASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNTHVVFGGGTKL TVLG
Heavy Chain DNA Sequence:
gaagtgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacac cttcaccaactactatatacactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaacctacccacagaacttccagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggcca gggaaccctggtcaccgtctcctca
Heavy Chain Amino Acid Sequience:
EVQLVQSGAEVKKPGASVKISCKASRYTFTNYYIHWVRQAPGQGLEWMGIINPS GGSTTYPQNFQGRLTMTRDTSTSTVYMELSSLRSEDTAMYYCARGWSGYDPGD FWGQGTLVTVSS #9
DNA Sequence:
caatctgccctgactcagcctgcctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacaatgtggtattcggcggagggaccaagctgaccgtcctaggttctag aggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggg gctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacaccttcaccaactactatatacactggg tgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaacctacccacagaacttc cagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggacacg gccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggccagggaaccctggtcaccgtctcctca actagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct
Amino Acid Sequence:
QSALTQPASASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNNVVFGGGTKLT VLG SRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGASVKISCKASRYTFTNY YIHWVRQAPGQGLEWMGIINPSGGSTTYPQNFQGRLTMTRDTSTSTVYMELSSL RSEDTAMYYCARGWSGYDPGDFWGQGTLVTVSSTSGQAGQHHHHHHGAYPYD VPDYAS
Light Chain DNA Sequence:
caatctgccctgactcagcctgcctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtggttataactatgtctcctggtaccaacagcacccaggcaaagcccccaaactcatgatttatgaggtcagtaagcggc cctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatg aggctgattattactgcagctcatatgcaggcagcaacaatgtggtattcggcggagggaccaagctgaccgtcctaggt Light Chain Amino Acid Sequence:
QSALTQPASASGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVS KRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYAGSNNVVFGGGTKLT VLG
Heavy Chain DNA Sequence:
gaggtccagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaaatttcctgcaaggcatctagatacac cttcaccaactactatatacactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaacctacccacagaacttccagggcagactcaccatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccatgtattactgtgcgagaggttggagtggctacgatccaggggacttctggggcca gggaaccctggtcaccgtctcctca
Heavy Chain Amino Acid Sequence:
EVQLVQSGAEVKKPGASVKISCKASRYTFTNYYIHWVRQAPGQGLEWMGIINPS GGSTTYPQNFQGRLTMTRDTSTSTVYMELSSLRSEDTAMYYCARGWSGYDPGD FWGQGTLVTVSS
#10
DNA Sequence:
caggctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttctggaggcagctccaa catcggagttaatcctgtaaactggtaccagcaactcccaggaacggcccccaaactcctcatctttgctaattatcagcggccct caggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtggactccagtctgatgatgagg ctcattattattgttcgacatgggatgacagcctgaatgcttggctgttcggcggagggaccaagctgaccgtcctaggttctaga ggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtgcagctggtgcagtctgga gcagaggtgaaaaagccgggggactctctgaggatctcctgtcagggttctggatacagctttaccagttactacatcagctgg gtgcgccagatgcccgggaaaggcctggagtggatggggaacattgatcctagtgactcttacaccaactacagcccgtccttc caaggccacgtcaccatgtcagttgacaagtccatcagcactgcctacctgcagtggagcagcctgaaggcctcggacatcgc catatattactgtgtgagacatgggtttagcaactcgcctagattgtggttcgacacctggggccagggaaccctggtcaccgtct cctcaactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct Amino Acid Sequence:
QAVLTQPPSASGTPGQRVTISCSGGSSNIGVNPVNWYQQLPGTAPKLLIFANYQR PSGVPDRFSGSKSGTSASLAISGLQSDDEAHYYCSTWDDSLNAWLFGGGTKLTV LGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGDSLRISCQGSGYSFTSY YISWVRQMPGKGLEWMGNIDPSDSYTNYSPSFQGHVTMSVDKSISTAYLQWSS LKASDIAIYYCVRHGFSNSPRLWFDTWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS
Light Chain DNA Sequence:
caggctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttctggaggcagctccaa catcggagttaatcctgtaaactggtaccagcaactcccaggaacggcccccaaactcctcatctttgctaattatcagcggccct caggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtggactccagtctgatgatgagg ctcattattattgttcgacatgggatgacagcctgaatgcttggctgttcggcggagggaccaagctgaccgtcctaggt
Light Chain Amino Acid Sequence:
QAVLTQPPSASGTPGQRVTISCSGGSSNIGVNPVNWYQQLPGTAPKLLIFANYQR PSGVPDRFSGSKSGTSASLAISGLQSDDEAHYYCSTWDDSLNAWLFGGGTKLTV LG
Heavy Chain DNA Sequence:
gaggtgcagctggtgcagtctggagcagaggtgaaaaagccgggggactctctgaggatctcctgtcagggttctggatacag ctttaccagttactacatcagctgggtgcgccagatgcccgggaaaggcctggagtggatggggaacattgatcctagtgactc ttacaccaactacagcccgtccttccaaggccacgtcaccatgtcagttgacaagtccatcagcactgcctacctgcagtggagc agcctgaaggcctcggacatcgccatatattactgtgtgagacatgggtttagcaactcgcctagattgtggttcgacacctggg gccagggaaccctggtcaccgtctcctca
Heavy Chain Amino Acid Sequence:
EVQLVQSGAEVKKPGDSLRISCQGSGYSFTSYYISWVRQMPGKGLEWMGNIDPS DSYTNYSPSFQGHVTMSVDKSISTAYLQWSSLKASDIAIYYCVRHGFSNSPRLWF DTWGQGTLVTVSS
#11
DNA Sequence:
aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtaaccatctcctgcacccgcagcagtggcagc attgccagcaactatgtgcagtggtaccagcagcgcccgggcagtgcccccaccactgtgatctatgaggataaccaaagacc ctctggggtccctgatcggttctctggctccatcgacagctcctccaactctgcctccctcaccatctctggactgaagactgagg acgaggctgattactactgtcagtcttatgataccaacaattatggggttatattcggcggagggaccaagctgaccgtcctaggt tctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagt ctggggctgaggtgaagaagcctggggcctcagtgaaggtttcctgcaagacatctggatacaccttcaacaactactatatgc actgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaaactacgcaca gaagttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgag gacactgccgtgtattactgtgcgcgctctttcgacaaacaggacatcgattactggggtcaaggtactctggtgaccgtctcctc aactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct Amino Acid Sequence:
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQR PSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDTNNYGVIFGGGTKLTV LGSRGGGGSGGGGSGGGGSLEMAQMQLVQSGAEVKKPGASVKVSCKTSGYTF NNYYMHWVRQAPGQGLEWMGIINPSGGSTNYAQKFQGRVTMTRDTSTSTVYM ELSSLRSEDTAVYYCARSFDKQDIDYWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS
Light Chain DNA Sequence:
aattttatgctgactcagccccactctgtgtcggagtctccggggaagacggtaaccatctcctgcacccgcagcagtggcagc attgccagcaactatgtgcagtggtaccagcagcgcccgggcagtgcccccaccactgtgatctatgaggataaccaaagacc ctctggggtccctgatcggttctctggctccatcgacagctcctccaactctgcctccctcaccatctctggactgaagactgagg acgaggctgattactactgtcagtcttatgataccaacaattatggggttatattcggcggagggaccaagctgaccgtcctaggt Light Chain Amino Acid Sequence:
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSAPTTVIYEDNQR PSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDTNNYGVIFGGGTKLTV LG
Heavy Chain DNA Sequence:
cagatgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaggtttcctgcaagacatctggatacac cttcaacaactactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaaactacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacactgccgtgtattactgtgcgcgctctttcgacaaacaggacatcgattactggggtcaaggta ctctggtgaccgtctcctca
Heavy Chain Amino Acid Sequence:
QMQLVQSGAEVKKPGASVKVSCKTSGYTFNNYYMHWVRQAPGQGLEWMGIIN PSGGSTNYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSFDKQDID YWGQGTLVTVSS
#21
DNA Sequence:
tcctatgagctgactcagccaccctcggtgtcagtggccccaggacagacggccagcatgacctgtgggggaaacaacattg gaagtaaaagtgtgcactggtaccagcagaagccaagccaggcccctgtgatggtcgtccatgatgatagcgagcggccctc agggatccctgagcgaatctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatga ggccgactattactgtcaggtgtgggatagtagtagtgatcatgtgatattcggcggagggaccaagctgaccgtcctaggttct agaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcaatctg gggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatattcactg ggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggtatcacaaactacgcacagaag ttccagggcagggtcagcatgaccagagacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggaca cggccgtgtattactgtgcgcgctcttggatgtctgactcttactacgatggttggggtcaaggtactctggtgaccgtctcctcaa ctagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct
Amino Acid Sequence:
SYELTQPPSVSVAPGQTASMTCGGNNIGSKSVHWYQQKPSQAPVMVVHDDSER PSGIPERISGSKSGNTATLTISRVEAGDEADYYCQVWDSSSDHVIFGGGTKLTVL GSRGGGGSGGGGSGGGGSLEMAQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYYIHWVRQAPGQGLEWMGIIRPSGGITNYAQKFQGRVSMTRDTSTSTVYMEL SSLRSEDTAVYYCARSWMSDSYYDGWGQGTLVTVSSTSGQAGQHHHHHHGAY PYDVPDYAS
Light Chain DNA Sequence:
tcctatgagctgactcagccaccctcggtgtcagtggccccaggacagacggccagcatgacctgtgggggaaacaacattg gaagtaaaagtgtgcactggtaccagcagaagccaagccaggcccctgtgatggtcgtccatgatgatagcgagcggccctc agggatccctgagcgaatctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatga ggccgactattactgtcaggtgtgggatagtagtagtgatcatgtgatattcggcggagggaccaagctgaccgtcctaggt Light Chain Amino Acid Sequence:
SYELTQPPSVSVAPGQTASMTCGGNNIGSKSVHWYQQKPSQAPVMVVHDDSER PSGIPERISGSKSGNTATLTISRVEAGDEADYYCQVWDSSSDHVIFGGGTKLTVL G
Heavy Chain DNA Sequence:
caggtgcagctggtgcaatctggggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtgg tatcacaaactacgcacagaagttccagggcagggtcagcatgaccagagacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttggatgtctgactcttactacgatggttggggtcaag gtactctggtgaccgtctcctca
Heavy Chain Amino Acid Sequence:
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGLEWMGIIRP SGGITNYAQKFQGRVSMTRDTSTSTVYMELSSLRSEDTAVYYCARSWMSDSYY DGWGQGTLVTVSS
#23
DNA Sequence:
tcctatgagctgactcagccaccctcggtgtcagtggctccaggacagacggcctggattacctgtgggggaaacaacattgg aagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctatactggtcgtctatgatgatagcgaccggccctcag ggatccctgagagagtctctggctccaactctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgagg ccgactattactgtcaggtgtgggatagtagtagtgatcgttgggtgttcggcggagggaccaagctgaccgtcctaggttctag aggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctgga gctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggcttctggttacacctttaccaactatggtatcagctggg tgcgacaggcccctggacaagggcttgagtggatgggatggatcagcccttacaatggtaacacaaactacgcacagaagct ccagggcagagtcaccatgaccacagacacatccacgagcacagcctacatggagctgaggaacctgagatctgacgacac tgccgtgtattactgtgcgcgctactgggactctggttacgcttacgatgaatggggtcaaggtactctggtgaccgtctcctcaa ctagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct
Amino Acid Sequence:
SYELTQPPSVSVAPGQTAWITCGGNNIGSKSVHWYQQKPGQAPILVVYDDSDRP SGIPERVSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDRWVFGGGTKLTVL GSRGGGGSGGGGSGGGGSLEMAQMQLVQSGAEVKKPGASVKVSCKASGYTFT NYGISWVRQAPGQGLEWMGWISPYNGNTNYAQKLQGRVTMTTDTSTSTAYME LRNLRSDDTAVYYCARYWDSGYAYDEWGQGTLVTVSSTSGQAGQHHHHHHGA YPYDVPDYAS
Light Chain DNA Sequence:
tcctatgagctgactcagccaccctcggtgtcagtggctccaggacagacggcctggattacctgtgggggaaacaacattgg aagtaaaagtgtgcactggtaccagcagaagccaggccaggcccctatactggtcgtctatgatgatagcgaccggccctcag ggatccctgagagagtctctggctccaactctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgagg ccgactattactgtcaggtgtgggatagtagtagtgatcgttgggtgttcggcggagggaccaagctgaccgtcctaggt Light Chain Amino Acid Sequence:
SYELTQPPSVSVAPGQTAWITCGGNNIGSKSVHWYQQKPGQAPILVVYDDSDRP SGIPERVSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDRWVFGGGTKLTVL G Heavy Chain DNA Sequence:
cagatgcagctggtgcagtctggagctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaaggcttctggttacac ctttaccaactatggtatcagctgggtgcgacaggcccctggacaagggcttgagtggatgggatggatcagcccttacaatgg taacacaaactacgcacagaagctccagggcagagtcaccatgaccacagacacatccacgagcacagcctacatggagct gaggaacctgagatctgacgacactgccgtgtattactgtgcgcgctactgggactctggttacgcttacgatgaatggggtcaa ggtactctggtgaccgtctcctca
Heavy Chain Amino Acid Sequence:
QMQLVQSGAEVKKPGASVKVSCKASGYTFTNYGISWVRQAPGQGLEWMGWIS PYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCARYWDSGY AYDEWGQGTLVTVSS #24
DNA Sequence:
caggctgtgctgactcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacaataataagcgaccct ccggtcttcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgag gccgattattactgcggaacatgggatagcagcctgaatgccgtggtattcggcggagggacccagctcaccgttttaagttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcagtctgg ggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatattcactgg gtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggtatcacaaactacgcacagaagtt ccagggcagggtcaccatgaccagagacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggacac ggccgtgtattactgtgcgcgctcttggtctaacaaactgtcttggtacaacgatggttggggtcaaggtactctggtgaccgtctc ctcaactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct Amino Acid Sequence:
QAVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKR PSGLPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLNAVVFGGGTQLTV LSSRGGGGSGGGGSGGGGSLEMAQVQLVQSGAEVKKPGASVKVSCKASGYTFT NYYIHWVRQAPGQGLEWMGIIRPSGGITNYAQKFQGRVTMTRDTSTSTVYMEL SSLRSEDTAVYYCARSWSNKLSWYNDGWGQGTLVTVSSTSGQAGQHHHHHHG AYPYDVPDYAS
Light Chain DNA Sequence:
caggctgtgctgactcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacaataataagcgaccct ccggtcttcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgag gccgattattactgcggaacatgggatagcagcctgaatgccgtggtattcggcggagggacccagctcaccgttttaagt Light Chain Amino Acid Sequence:
QAVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKR PSGLPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLNAVVFGGGTQLTV LS
Heavy Chain DNA Sequence:
caggtgcagctggtgcagtctggggctgaggtgaagaagccgggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtgg tatcacaaactacgcacagaagttccagggcagggtcaccatgaccagagacacgtccacgagcacagtctacatggagctg agcagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttggtctaacaaactgtcttggtacaacgatggttggg gtcaaggtactctggtgaccgtctcctca
Heavy Chain Amino Acid Sequence:
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQAPGQGLEWMGIIRP SGGITNYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARSWSNKLSW YNDGWGQGTLVTVSS
#25
DNA Sequence:
cagtctgtgttgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagttcctcccaggaacagcccccaaacttctcatttatgacaataatcagcgaccctc aggcattcctgaccgattctctggcttcaagtctggcacgtcagccaccctggacatcaccggactccagactggggacgagg ccgattattactgcggaacatgggataacagcctgagtgctgcagtgttcggcagagggaccaagctgaccgtcctaggttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccagatgcagctggtgcagtctgg gactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatatgcactg ggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtggtagcacaacctacgcacagaag ttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctatatggagctgagcgacctgggatctgaggaca cggccgtgtattactgtgcgcgctcttggtctaaaactgaaggttctgatcgttggggtcaaggtactctggtgaccgtctcctcaa ctagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct Amino Acid Sequence:
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQFLPGTAPKLLIYDNNQR PSGIPDRFSGFKSGTSATLDITGLQTGDEADYYCGTWDNSLSAAVFGRGTKLTVL G SRGGGGSGGGGSGGGGSLEMAQMQLVQSGTEVKRAGASVKVSCKASGYTFTN YYMHWVRQAPGQGLEWMGIINPSGGSTTYAQKFQGRVTMTRDTSTSTVYMEL SDLGSEDTAVYYCARSWSKTEGSDRWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS Light Chain DNA Sequence:
cagtctgtgttgacgcagccgccctcagtgtctgcggccccaggacagaaggtcaccatctcctgctctggaagcagctccaa cattgggaataattatgtatcctggtaccagttcctcccaggaacagcccccaaacttctcatttatgacaataatcagcgaccctc aggcattcctgaccgattctctggcttcaagtctggcacgtcagccaccctggacatcaccggactccagactggggacgagg ccgattattactgcggaacatgggataacagcctgagtgctgcagtgttcggcagagggaccaagctgaccgtcctaggt Light Chain Amino Acid Sequence:
QSVLTQPPSVSAAPGQKVTISCSGSSSNIGNNYVSWYQFLPGTAPKLLIYDNNQR PSGIPDRFSGFKSGTSATLDITGLQTGDEADYYCGTWDNSLSAAVFGRGTKLTVL G
Heavy Chain DNA Sequence:
cagatgcagctggtgcagtctgggactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatatgcactgggtgcgacaggcccctggacaagggcttgagtggatgggaataatcaaccctagtggtgg tagcacaacctacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgagcacagtctatatggagctg agcgacctgggatctgaggacacggccgtgtattactgtgcgcgctcttggtctaaaactgaaggttctgatcgttggggtcaag gtactctggtgaccgtctcctca Heavy Chain Amino Acid Sequence:
QMQLVQSGTEVKRAGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGIIN PSGGSTTYAQKFQGRVTMTRDTSTSTVYMELSDLGSEDTAVYYCARSWSKTEG SDRWGQGTLVTVSS #26
DNA Sequence:
tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatcacctgtgggggaaccgacatca gacgtaaaactgtccactggtaccagcagaagccaggcctggcccctgtgctggtcctctatgatgatagcgaccggccctca gggatccctgagcgattctctggctccaactctggtaacacggccaccctgaccatcagcagggtcgaaggcggggatgagg ccgactattactgtcaggtgtgggataacgataatgatcattatgtctttggacctgggaccaaggtcaccgtcctaggttctagag gtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggc tgaggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcatctggatacaccttcaccaactactatatccactgggtg cgacagacccctggagaagggcttgagtggatgggaataatcagacctagtggcggtaacacaaactacgcacagaagttcc agggcagagtcaccatgaccagggacacgtccacgcgcacggtctatatggagttgagtagcctgagatctgaggacacggc cgtgtattactgtgcgcgctcttgggacactttctctgatgaatggggtcaaggtactctggtgaccgtctcctcaactagtggcca ggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct
Amino Acid Sequence:
SYVLTQPPSVSVAPGQTARITCGGTDIRRKTVHWYQQKPGLAPVLVLYDDSDRP SGIPERFSGSNSGNTATLTISRVEGGDEADYYCQVWDNDNDHYVFGPGTKVTVL GSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGASVKVSCKASGYTFT NYYIHWVRQTPGEGLEWMGIIRPSGGNTNYAQKFQGRVTMTRDTSTRTVYMEL SSLRSEDTAVYYCARSWDTFSDEWGQGTLVTVSSTSGQAGQHHHHHHGAYPYD VPDYAS
Light Chain DNA Sequence:
tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatcacctgtgggggaaccgacatca gacgtaaaactgtccactggtaccagcagaagccaggcctggcccctgtgctggtcctctatgatgatagcgaccggccctca gggatccctgagcgattctctggctccaactctggtaacacggccaccctgaccatcagcagggtcgaaggcggggatgagg ccgactattactgtcaggtgtgggataacgataatgatcattatgtctttggacctgggaccaaggtcaccgtcctaggt
Light Chain Amino Acid Sequence:
SYVLTQPPSVSVAPGQTARITCGGTDIRRKTVHWYQQKPGLAPVLVLYDDSDRP SGIPERFSGSNSGNTATLTISRVEGGDEADYYCQVWDNDNDHYVFGPGTKVTVL G Heavy Chain DNA Sequence:
gaggtccagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcatctggataca ccttcaccaactactatatccactgggtgcgacagacccctggagaagggcttgagtggatgggaataatcagacctagtggcg gtaacacaaactacgcacagaagttccagggcagagtcaccatgaccagggacacgtccacgcgcacggtctatatggagtt gagtagcctgagatctgaggacacggccgtgtattactgtgcgcgctcttgggacactttctctgatgaatggggtcaaggtact ctggtgaccgtctcctca Heavy Chain Amino Acid Sequence:
EVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYIHWVRQTPGEGLEWMGIIRPS GGNTNYAQKFQGRVTMTRDTSTRTVYMELSSLRSEDTAVYYCARSWDTFSDE WGQGTLVTVSS
#29
DNA Sequence:
cagtctgtgttgacgcagccgccctcagtgtctgcggccccaagacagaaggtcaccatctcctgctctggaagcagctccaac attgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacgataataagcgaccctc agggattcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgagg ccgattattactgcggaacatgggatagcagcctgagtgctgtggtattcggcggagggaccaagctgaccgtcctaggttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcagtctgg gactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacaccttcaccaactactatatgcactg ggtgcgacaggcccctggacaagggctggaatggatgggaataatcaaccctagtattggtagcacaaactacgcacagaag ttccagggcagagtcaccatgaccagagacacgtccacgagcacagtcttcatggaactgagcagcctcagatctgacgacac ggccgtgtattactgtgcgcgctctttcggtgactctgacggtgctgattcttggggtcaaggtactctggtgaccgtctcctcaac tagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct
Amino Acid Sequence:
QSVLTQPPSVSAAPRQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDDNKR PSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVL GSRGGGGSGGGGSGGGGSLEMA QVQLVQSGTEVKRAGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGIIN PSIGSTNYAQKFQGRVTMTRDTSTSTVFMELSSLRSDDTAVYYCARSFGDSDGA DSWGQGTLVTVSS TSGQAGQHHHHHHGAYPYDVPDYAS
Light Chain DNA Sequence:
cagtctgtgttgacgcagccgccctcagtgtctgcggccccaagacagaaggtcaccatctcctgctctggaagcagctccaac attgggaataattatgtatcctggtaccagcagctcccaggaacagcccccaaactcctcatttatgacgataataagcgaccctc agggattcctgaccgattctctggctccaagtctggcacgtcagccaccctgggcatcaccggactccagactggggacgagg ccgattattactgcggaacatgggatagcagcctgagtgctgtggtattcggcggagggaccaagctgaccgtcctaggt Light Chain Amino Acid Sequence:
QSVLTQPPSVSAAPRQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDDNKR PSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAVVFGGGTKLTVL G Heavy Chain DNA Sequence:
caggtgcagctggtgcagtctgggactgaggtgaagagggctggggcctcagtgaaggtttcctgcaaggcatctggatacac cttcaccaactactatatgcactgggtgcgacaggcccctggacaagggctggaatggatgggaataatcaaccctagtattgg tagcacaaactacgcacagaagttccagggcagagtcaccatgaccagagacacgtccacgagcacagtcttcatggaactg agcagcctcagatctgacgacacggccgtgtattactgtgcgcgctctttcggtgactctgacggtgctgattcttggggtcaag gtactctggtgaccgtctcctca
Heavy Chain Amino Acid Sequence:
QVQLVQSGTEVKRAGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGIIN PSIGSTNYAQKFQGRVTMTRDTSTSTVFMELSSLRSDDTAVYYCARSFGDSDGA DSWGQGTLVTVSS #30
DNA Sequence:
tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatgacctgtgaaggaagcaaccttgg aagtaaaagtgtgcattggtaccagcagaagccaggccaggcccctgtgctggtcgtccatgatgatagcgaccggccctcag ggatccctgaccgattctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgaggc cgactattactgtcaggtgtggcatagtagtagtgatcattatgtcttcggaactgcgaccaaggtcaccgtcctaggt tctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcc
caggtgcagctggtgcaatctggggctgaggtgaagaagcctggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaattactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggt atcacaaactacgcacagaagttccagggcagggtcagcatgaccagggacacgtccacgagcacagtctacatggagctga gcagcctgagatctgaggacactgccgtgtattactgtgcgcgctcttggcatgaaaactctggtgttgattcttggggtcaaggt actctggtgaccgtctcctca
actagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct
Amino Acid Sequence:
QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRP SGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHYVFGTGTKVTVL GSRGGGGSGGGGSGGGGSLEMAEVQLVESGGGVVQPGRSLRLSCAASGFTFNN HAMHWVRQAPGKGLEWVAVISFDGDDKFYADSVKGRFTISRDNSRNTLFLQM NNLRPEDTAVYYCSRDPYHFASGSYSYFDYWGQGTLVTVSSTSGQAGQHHHHH HGAYPYDVPDYAS
Light Chain DNA Sequence:
tcctatgtgctgactcagccaccctcggtgtcagtggccccaggacagacggccaggatgacctgtgaaggaagcaaccttgg aagtaaaagtgtgcattggtaccagcagaagccaggccaggcccctgtgctggtcgtccatgatgatagcgaccggccctcag ggatccctgaccgattctctggctccaagtctgggaacacggccaccctgaccatcagcagggtcgaagccggggatgaggc cgactattactgtcaggtgtggcatagtagtagtgatcattatgtcttcggaactgcgaccaaggtcaccgtcctaggt
Light Chain Amino Acid Sequence: QSVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRP SGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHYVFGTGTKVTVL G
Heavy Chain DNA Sequence:
caggtgcagctggtgcaatctggggctgaggtgaagaagcctggggcctctgtgaaggtttcctgcaaggcatctggatacac cttcaccaattactatattcactgggtgcgacaggcccccggacaagggcttgagtggatgggaataatcagacctagtggtggt atcacaaactacgcacagaagttccagggcagggtcagcatgaccagggacacgtccacgagcacagtctacatggagctga gcagcctgagatctgaggacactgccgtgtattactgtgcgcgctcttggcatgaaaactctggtgttgattcttggggtcaaggt actctggtgaccgtctcctca
Heavy Chain Amino Acid Sequence:
EVQLVESGGGVVQPGRSLRLSCAASGFTFNNHAMHWVRQAPGKGLEWVAVISF DGDDKFYADSVKGRFTISRDNSRNTLFLQMNNLRPEDTAVYYCSRDPYHFASGS YSYFDYWGQGTLVTVSS
#34
DNA Sequence:
caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtgcttataactatgtctcctggtaccaacactacccaggcaaagcccccaaactcatgatttatgaggtcagtgagcggcc ctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatga ggctgattatttctgcagctcatatgcgggcagcaacaattttgtcttcggaactgggaccaaggtcaccgtcctaggttctagag gtggtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggccgaggtccagctggtgcagtctggggc tgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagcagctatgctatcagctgggt gcgacaggcccctggacaagggcttgagtggatgggaaggatcatccctatccttggtatagcaaactacgcacagaagttcc agggcagagtcacgattaccgcggacaaatcctcgagcacagcctacatggcgctgagcagcctgacatctgaggacacgg ccgtgtattactgtgcgagagggggtgactacgtcgagtcctggttcgacccctggggccagggaaccctggtcaccgtctcct caactagtggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct Amino Acid Sequence:
QSALTQPPSASGSPGQSVTISCTGTSSDVGAYNYVSWYQHYPGKAPKLMIYEVS ERPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYFCSSYAGSNNFVFGTGTKVT VLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGSSVKVSCKASGGTF SSYAISWVRQAPGQGLEWMGRIIPILGIANYAQKFQGRVTITADKSSSTAYMALS SLTSEDTAVYYCARGGDYVESWFDPWGQGTLVTVSSTSGQAGQHHHHHHGAYP YDVPDYAS Light Chain DNA Sequence:
caatctgccctgactcagcctccctccgcgtccgggtctcctggacagtcagtcaccatctcctgcactggaaccagcagtgac gttggtgcttataactatgtctcctggtaccaacactacccaggcaaagcccccaaactcatgatttatgaggtcagtgagcggcc ctcaggggtccctgatcgcttctctggctccaagtctggcaacacggcctccctgaccgtctctgggctccaggctgaggatga ggctgattatttctgcagctcatatgcgggcagcaacaattttgtcttcggaactgggaccaaggtcaccgtcctaggt
Light Chain Amino Acid Sequence:
QSALTQPPSASGSPGQSVTISCTGTSSDVGAYNYVSWYQHYPGKAPKLMIYEVS ERPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYFCSSYAGSNNFVFGTGTKVT VLG Heavy Chain DNA Sequence:
gaggtccagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaaggcttctggaggca ccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtggatgggaaggatcatccctatccttg gtatagcaaactacgcacagaagttccagggcagagtcacgattaccgcggacaaatcctcgagcacagcctacatggcgct gagcagcctgacatctgaggacacggccgtgtattactgtgcgagagggggtgactacgtcgagtcctggttcgacccctggg gccagggaaccctggtcaccgtctcctca Heavy Chain Amino Acid Sequence:
EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGRIIPI LGIANYAQKFQGRVTITADKSSSTAYMALSSLTSEDTAVYYCARGGDYVESWF DPWGQGTLVTVSS
#55
DNA Sequence:
caatctgccctgactcagcctgcctccgtgtctgggtctcctggacagtcgatcaccatctcctgcactggacccaccagtgactt taatgattatctctttgtctcctggtaccaacaacacccaggcaaagcccccaaactcatcctttatgatgtcactcatcggccctca ggggtttctggtcgcttctctggctccaagtctgccagcacggcctccctgaccatctctgggctccaggctgaggacgaggct gattatttctgcggctcaaaaacaggcaggaccacttatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtg gtggtggtagcggcggcggcggctctggtggtggtggatccctcgagatggcccaggtgcagctggtgcaatctggagctga ggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcttctggttacacctttgacaactttggtatcagctgggtgcga caggcccctggacaagggcttgagtggatgggatggatcaacacttacgatggttacacaaactatgtagagaaactccaggg cagagtcaccatgaccacagacacatccacgggcacagcctacatggagctgaggggcctgagatctgacgacacggccgt gtattactgtgcgcgctctgttccgcatcagatctcttacggtgatctgtggggtcaaggtactctggtgaccgtctcctcaactagt ggccaggccggccagcaccatcaccatcaccatggcgcatacccgtacgacgttccggactacgcttct
Amino Acid Sequence:
QSALTQPASVSGSPGQSITISCTGPTSDFNDYLFVSWYQQHPGKAPKLILYDVTH RPSGVSGRFSGSKSASTASLTISGLQAEDEADYFCGSKTGRTTYVFGTGTKVTVL GSRGGGGSGGGGSGGGGSLEMAQVQLVQSGAEVKKPGASVKVSCKASGYTFD NFGISWVRQAPGQGLEWMGWINTYDGYTNYVEKLQGRVTMTTDTSTGTAYME LRGLRSDDTAVYYCARSVPHQISYGDLWGQGTLVTVSSTSGQAGQHHHHHHGA YPYDVPDYAS
Light Chain DNA Sequence:
caatctgccctgactcagcctgcctccgtgtctgggtctcctggacagtcgatcaccatctcctgcactggacccaccagtgactt taatgattatctctttgtctcctggtaccaacaacacccaggcaaagcccccaaactcatcctttatgatgtcactcatcggccctca ggggtttctggtcgcttctctggctccaagtctgccagcacggcctccctgaccatctctgggctccaggctgaggacgaggct gattatttctgcggctcaaaaacaggcaggaccacttatgtcttcggaactgggaccaaggtcaccgtcctaggt Light Chain Amino Acid Sequence:
QSALTQPASVSGSPGQSITISCTGPTSDFNDYLFVSWYQQHPGKAPKLILYDVTH RPSGVSGRFSGSKSASTASLTISGLQAEDEADYFCGSKTGRTTYVFGTGTKVTVL G
Heavy Chain DNA Sequence:
caggtgcagctggtgcaatctggagctgaggtgaagaagcctggggcctcagtaaaggtctcctgcaaggcttctggttacac ctttgacaactttggtatcagctgggtgcgacaggcccctggacaagggcttgagtggatgggatggatcaacacttacgatggt tacacaaactatgtagagaaactccagggcagagtcaccatgaccacagacacatccacgggcacagcctacatggagctga ggggcctgagatctgacgacacggccgtgtattactgtgcgcgctctgttccgcatcagatctcttacggtgatctgtggggtca aggtactctggtgaccgtctcctca
Heavy Chain Amino Acid Sequence:
QVQLVQSGAEVKKPGASVKVSCKASGYTFDNFGISWVRQAPGQGLEWMGWIN TYDGYTNYVEKLQGRVTMTTDTSTGTAYMELRGLRSDDTAVYYCARSVPHQIS YGDLWGQGTLVTVSS
Appendix D
EXT019-04
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
CAGCCTGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACAACATTGG AAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCATCCGGTATTCGGCGGAGG GACCAAGCTGACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGGCTTCT GGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGG ATCATCCCTATCTTTGGTACAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCAC GAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGCTCTTCTTAC TGGTGGACTTCTGATCGTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag) Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
QPVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEA GDEADYYCQVWDSSSDHPVFGGGTKLTVLG (light chain variable region)
SRGGGGSGGGGSGGGGSLEMA (scFv linker)
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTST AYMELSSLRSEDTAVYYCARSSYWWTSDRWGQGTLVTVSS (heavy chain variable region)
+
TSGQAGQHHHHHHGAYPYDVPDYAS (His tag HA tag)
EXT019-06
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
CAGTCTGTCGTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGGGGGTCACCATCCCCTGCACTGGGAGC AGCTCCAACATCGGGGCAGGTTATGATGTACACTGGTACCAGCAGCTTCCAGGGACAGCCCCCAAACTCCTCATCTA TGGTAACAACAATCGGCCCTCAGGGGTCCCTGACCGCTTCTCTGGCTCCAGGTCTGGCTCCTCAGCCTCCCTGGCCA TCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGCCTGAGTGATGTGGTATTC GGCGGAGGGACCAAGCTGACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGCAGTCTGGAGCAGAGGTGAAAAAGCCGGGGGAGTCTCTGAAGATCTCCTGTAAGGGTTCT GGATACAACTTTGCCAGCGAGTGGATCGGATGGGTCCGCCAGATGCCCGGGAAAGGCCTGGAGTGGATGGGACTG ATCTATCCTGCTGAATCTGAAATCACATACAGCCCGTCCTTCCAAGGCCAGGTCACCATTTCAGTCGACAAGTCCATC AGCACCGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGGACACCGCCATGTATTACTGTGCGCGCGCTTGGGACG CTAACTACATCTACATGGATATCTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag)
Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag) QSVVTQPPSVSGAPGQGVTIPCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSRSGSSASLAITG LQAEDEADYYCQSYDSSLSDVVFGGGTKLTVLG [SEQ ID NO: 110]
SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135]
EVQLVQSGAEVKKPGESLKISCKGSGYNFASEWIGWVRQMPGKGLEWMGLIYPAESEITYSPSFQGQVTISVDKSISTA YLQWSSLKASDTAMYYCARAWDANYIYMDIWGQGTLVTVSS [SEQ ID NO: 109]
TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141]
QSVVTQPPSVSGAPGQGVTIPCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSRSGSSASLAITG LQAEDEADYYCQSYDSSLSDVVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAEVKKPGESLKISCK GSGYNFASEWIGWVRQMPGKGLEWMGLIYPAESEITYSPSFQGQVTISVDKSISTAYLQWSSLKASDTAMYYCARAWD ANYIYMDIWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 129]
EXT019-08
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
CAGTCTGTGTTGACTCAGCCACCCTCGGTGTCTGAAGCCCCCAGGCAGAGGGTCACCATCTCCTGTTCTGGAAGCA GCTCCAACATCGGAAATAATGCTGTAAACTGGTACCAGCAGCTCCCAGGAAAGGCTCCCAAACTCCTCATCTATTAT GATGATCTGCTGCCCTCAGGGGTCTCTGACCGATTCTCTGGCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCAG TGGGCTCCAGTCTGAGGATGAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAATGGTCCTGTCTTCGGA ACTGGGACCAAGGTCACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCT GGTTACAACTTTACCAGTTATGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGA TCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACG AGCACAGCCTACATGGAGTTGAGGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGCGAGAGACTGGGATT ACGATTTTTTGACTGGGTGGGACGGTATGGACGTCTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA (heavy chain variable region)
ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag) Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGL QSEDEADYYCAAWDDSLNGPVFGTGTKVTVLG (light chain variable region)
SRGGGGSGGGGSGGGGSLEMA (scFv linker)
EVQLVQSGAEVKKPGASVKVSCKASGYNFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTS TAYMELRSLRSDDTAVYYCARDWDYDFLTGWDGMDVWGQGTTVTVSS (heavy chain variable region)
+
TSGQAGQHHHHHHGAYPYDVPDYAS (His tag HA tag)
EXT019-09
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCATTGGGTGTTCGGCGGAGG GACCAAGCTGACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTGGTGCAATCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAAACTCTCCTGTGCAGCCTCTG GGTTCGCCTTCAGCGGCTCTTCTCTGCACTGGGTCCGCCAGGCTTCCGGGAAAGGGCTGGAGTGGGTTGGCCGTAT TACAAGCAAAGCTTACAATTACGCGACACTATATGCTGCGTCGGTGAAAGGCAGGTTCACCATCTCCAGAGATGATT CAAAGAACACGGCATATCTTCAGATGAACAGCCTGCAAACCGAGGACACGGCCGTGTATTACTGTACCCAGACTGG GGACTCATCAGCCTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT +
(His tag HA tag)
Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHWVFGGGTKLTVLG [SEQ ID NO: 112]
SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135]
QVQLVQSGGGLVQPGGSLKLSCAASGFAFSGSSLHWVRQASGKGLEWVGRITSKAYNYATLYAASVKGRFTISRDDSK NTAYLQMNSLQTEDTAVYYCTQTGDSSAYWGQGTLVTVSS [SEQ ID NO: 111]
TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141]
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHWVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLVQSGGGLVQPGGSLKLSCAAS GFAFSGSSLHWVRQASGKGLEWVGRITSKAYNYATLYAASVKGRFTISRDDSKNTAYLQMNSLQTEDTAVYYCTQTGD SSAYWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 130]
EXT019-12
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCATCGAGTGTTCGGCGGAGG GACCAAGGTCACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCT GGATTCACTTTTAGTAGTTATTGGATGAATTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGGAGTGGGTGGCCAACA TAAAGCAAGATGGAAGTGAGAAAAACTATGTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAA GAATTCACTGTATCTGCAAATGAATAGCCTGAGAGGCGAGGACACGGCCGTATATTACTGTGCGCGCTACGGTGGT GGTCCGTACGATTCTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag)
Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHRVFGGGTKVTVLG [SEQ ID NO: 114]
SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135]
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMNWVRQAPGKGLEWVANIKQDGSEKNYVDSVKGRFTISRDNAKN SLYLQMNSLRGEDTAVYYCARYGGGPYDSWGQGTLVTVSS [SEQ ID NO: 113]
TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141]
SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDHRVFGGGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVESGGGLVQPGGSLRLSCAAS GFTFSSYWMNWVRQAPGKGLEWVANIKQDGSEKNYVDSVKGRFTISRDNAKNSLYLQMNSLRGEDTAVYYCARYGGG PYDSWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 131]
EXT019-13
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag) CTGCCTGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGCCTATGTCTTCGGAACTGGGAC CAAGGTCACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTACAGCTGCAGCAGTCAGGTCCAGGACTGGTGAAGCCCTCGCAGACCCTCTCACTCACCTGTGCCATCTCCG GGGACAGTGTCTCTAGCAACAGTGCTGCTTGGAACTGGATCAGGCAGTCCCCATCGAGAGGCCTTGAGTGGCTGGG AAGGACATACTACAGGTCCAAGTGGTATAATGATTATGCAGTATCTGTGAAAAGTCGAATAACCATCAACCCAGACA CATCCAAGAACCAGTTCTCCCTGCAGCTGAACTCTGTGACTCCCGAGGACACGGCTGTGTATTACTGTGCGCGCTAC TACTCTACTTCTCTGGATTCTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag)
Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
LPVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSAYVFGTGTKVTVLG (light chain variable region)
SRGGGGSGGGGSGGGGSLEMA (scFv linker)
QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTS KNQFSLQLNSVTPEDTAVYYCARYYSTSLDSWGQGTLVTVSS (heavy chain variable region)
+
TSGQAGQHHHHHHGAYPYDVPDYAS (His tag HA tag)
EXT019-15
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCGGGAGAGACGGCCAGTATTACCTGTGGGGCCAACA ACATTGGAAGTGAGAGTGTGCACTGGTATCAGCAGAAGTCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGGTCCAACTCTGACAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGAGATGAGGCCGACTATTACTGTCAGGTTTGGGATCATATTAATGATCATTATGTCTTCGGAAGTGGG ACCAAGGTCACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGCACAGCCTGGGGGGTCCCTGAGACTCTCCTGTGCAGCCTCC GGATTCTCTTTTAGCAACTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGACGGGGCTGGAGTGGGTCGCAGGTA TTAGCGGTAGAGGTGGGAGTATACATTACGCAGACTCCGTGAAGGGTCGGTTCACCATCTCCAGAGACAATTCCCA GAGCACGGTCTTTCTGCAAATGAACAACCTGGGAGCCGAGGACACGGCCATATACTACTGTGCGAAATCGAGCGAG GACTATTACTTCTATCACATGGACGCCTGGGGCATTGGGACCACGGTCACCGTCTCCTCA (heavy chain variable region)
ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag)
Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
SYVLTQPPSVSVAPGETASITCGANNIGSESVHWYQQKSGQAPVLVIYYDSDRPSGIPERFSGSNSDNTATLTISRVEAG DEADYYCQVWDHINDHYVFGSGTKVTVLG [SEQ ID NO: 116]
SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135]
EVQLVESGGGLAQPGGSLRLSCAASGFSFSNYAMSWVRQAPGTGLEWVAGISGRGGSIHYADSVKGRFTISRDNSQS TVFLQMNNLGAEDTAIYYCAKSSEDYYFYHMDAWGIGTTVTVSS [SEQ ID NO: 115]
TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141]
SYVLTQPPSVSVAPGETASITCGANNIGSESVHWYQQKSGQAPVLVIYYDSDRPSGIPERFSGSNSDNTATLTISRVEAG DEADYYCQVWDHINDHYVFGSGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVESGGGLAQPGGSLRLSCAASG FSFSNYAMSWVRQAPGTGLEWVAGISGRGGSIHYADSVKGRFTISRDNSQSTVFLQMNNLGAEDTAIYYCAKSSEDYY FYHMDAWGIGTTVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 132] EXT019-20
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
TCCTATGTGCTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAGGATTACCTGTGGGGGAAACA ACATTGGAAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTGCTGGTCATCTATTATGATAGC GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACGGCCACCCTGACCATCAGCAGGG TCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGTGGGATAGTAGTAGTGATCGTGTGGTATTCGGCGGAGG GACCAAGCTGACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTACAGCTGCAGCAGTCAGGTCCAGGACTGGTGAAGCCCTCGCAGACCCTCTCACTCACCTGTGCCATCTCCG GGGACAGTATCTCTAGCAAAAGTGCTGCTTGGAACTGGATCAGGCAGTCCCCATCGAGAGGCCTAGAGTGGCTGGG AAGGACATACTACAGGTCCAAGTGGTATTATGAATATGCACCATCTGTGAGAAGTCGAATAACCATCAACCGAGACA CATCCAAGAACCAGTTCTCCCTGCAACTTAACTCTGTGACTCCCGAGGACACGGCTGTATATTATTGTGCAAGATCCA CTGGGACCTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag)
Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDRVVFGGGTKLTVLG [SEQ ID NO: 118]
SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135]
QVQLQQSGPGLVKPSQTLSLTCAISGDSISSKSAAWNWIRQSPSRGLEWLGRTYYRSKWYYEYAPSVRSRITINRDTSK NQFSLQLNSVTPEDTAVYYCARSTGTFDYWGQGTLVTVSS [SEQ ID NO: 117]
TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141] SYVLTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAG DEADYYCQVWDSSSDRVVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQLQQSGPGLVKPSQTLSLTCAISG DSISSKSAAWNWIRQSPSRGLEWLGRTYYRSKWYYEYAPSVRSRITINRDTSKNQFSLQLNSVTPEDTAVYYCARSTGT FDYWGQGTLVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 133]
Appendix E
Figure imgf000193_0001
Appendix F
EXT018-02
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
CAGTCTGTCGTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCATCTCCTGCACTGGGAGC AGCTCCAACATCGGGGCAGGTTTTGATGTACACTGGTACCAGCAGCTTCCAGGAACAGCCCCCAAACTCCTCATCTA TGGTAACAGCAATCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGCCACCTCAGCCTCCCTGGCCA TCACTGGGCTCCAGGCTGAGGATGAGGCTGATTATTACTGCCAGTCCTATGACAGCAGCCTGAGTGGTGTGGTATTC GGCGGAGGGACCAAGCTGACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTGCAAGACTTCTG GAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAGGGA TCATCCCTATCTTTGGTACAGCAAACTACGCACAGAGGTTCCAGGGCAGAGTCACGATTACCGCGGACGAATCCACA AACACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGCGCGAATCTTGGT ACCTTGATGAATGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region)
ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag) Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
QSVVTQPPSVSGAPGQRVTISCTGSSSNIGAGFDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSATSASLAITG LQAEDEA DYYCQSYDSSLSGVVFGGGTKLTVLG (light chain variable region)
SRGGGGSGGGGSGGGGSLEMA (scFv linker)
QVQLVQSGAEVKKPGSSVKVSCKTSGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQRFQGRVTITADESTNT VYMELSSLRSEDTAVYYCARESWYLDEWGQGTLVTVSS (heavy chain variable region)
+
TSGQAGQHHHHHHGAYPYDVPDYAS (His tag HA tag)
EXT018-04
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
CAGTCTGTGTTGACGCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCATCTCCTGCACTGGGAGCA ACTCCAACATCGGGGCAGATTTTGATGTACACTGGTACCAGCAGCTTCCAGGAACAGCCCCCAAGCTCCTCATCTAT GGTAACAACAATCGGCCCTCAGGGGTCCCTGACCGATTTTCTGGCTCCAAGTCTGACACCTCAGCCTCCCTGGCCAT CACTGGGCTCCAGGCTGAGGATGAGGCTGATTACTACTGCCAGTCCTATGACATCAGCCTGAATGGTTATGTCTTCG GAACTGGGACCAAGGTCACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCGCTGTCTCTG GTGGGTCCTTCAGTGATTACTACTGGAGCTGGATCCGCCAGCCCCCAGGGAAGGGGCTGGAGTGGATTGGGGAAA TCACTCATACTGGAAGCACCAACTACAACCCGTCCCTCAAGAGTCGAGTCACCATATCAGTAGACACGTCCAAGAAC CATTTCTCCCTGAATCTGACCTCTGTGACCGCCGCGGACACGGCCGTGTATTACTGTGCGCGCTCTAACGGTTTCTA CTACGATACTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA (heavy chain variable region)
ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag)
Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
QSVLTQPPSVSGAPGQRVTISCTGSNSNIGADFDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSDTSASLAITG LQAEDEADYYCQSYDISLNGYVFGTGTKVTVLG (light chain variable region)
SRGGGGSGGGGSGGGGSLEMA (scFv linker) QVQLQQWGAGLLKPSETLSLTCAVSGGSFSDYYWSWIRQPPGKGLEWIGEITHTGSTNYNPSLKSRVTISVDTSKNHF SLNLTSVTAADTAVYYCARSNGFYYDTWGQGTLVTVSS (heavy chain variable region)
+
TSGQAGQHHHHHHGAYPYDVPDYAS (His tag HA tag)
EXT018-05
DNA Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
CAGTCTGTGTTGACTCAGCCACCCTCAGTGTCAGTGGCCCCAGGAAAGACGGCCAAGATTACCTGTGGCGGAGACA ACATTGGAAGTAAAACTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGCACTTCTCATCTATTATGATAGT GACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAATTCTGGAAATACGGCCACCCTGAGCATCAGCAGGG TCGAGGCCGGGGATGAGGCCGGCTATTTCTGTCAGGTGTGGGATGGGAGTAGTGATCATGTGATCTTCGGCGGAG GGACCAAGCTGACCGTCCTAGGT (light chain variable region)
TCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTCTGGTGGTGGTGGATCCCTCGAGATGGCC (scFv linker) CAGATGCAGCTGGTGCAATCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCCTCT GGATTCACCTTCAGTAGCTATGCTATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTA TATCATATGATGGAAGTAATAAATACTACGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAG AACACGCTGTATCTGCAAATGAACAGCCTGAGAGCTGAGGACACGGCTGTGTATTACTGTGCGAGAGATCGGCATG ATTACGTTATGGACGTCTGGGGCAAAGGGACCACGGTCACCGTCTCCTCA (heavy chain variable region) ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCCGTACGACGTTCCGGACTACGCTTCT
+
(His tag HA tag) Amino Acid Sequence
+
(light chain variable region scFv linker heavy chain variable region His tag HA tag)
QSVLTQPPSVSVAPGKTAKITCGGDNIGSKTVHWYQQKPGQAPALLIYYDSDRPSGIPERFSGSNSGNTATLSISRVEA GDEAGYFCQVWDGSSDHVIFGGGTKLTVLG [SEQ ID NO: 120]
SRGGGGSGGGGSGGGGSLEMA [SEQ ID NO: 135]
QMQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKN TLYLQMNSLRAEDTAVYYCARDRHDYVMDVWGKGTTVTVSS [SEQ ID NO: 119]
TSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 141]
QSVLTQPPSVSVAPGKTAKITCGGDNIGSKTVHWYQQKPGQAPALLIYYDSDRPSGIPERFSGSNSGNTATLSISRVEA GDEAGYFCQVWDGSSDHVIFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQMQLVQSGGGVVQPGRSLRLSCAA SGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDRHD YVMDVWGKGTTVTVSSTSGQAGQHHHHHHGAYPYDVPDYAS [SEQ ID NO: 134]
Appendix G
Figure imgf000196_0001

Claims

WHAT IS CLAIMED IS:
1. An isolated antibody, or an antigen-binding portion thereof, which binds to a Foxp3 peptide bound to a human major histocompatibility complex (MHC) molecule.
2. The antibody or antigen-binding portion thereof of claim 1, wherein the human MHC molecule is a human leukocyte antigen (HLA) molecule.
3. The antibody or antigen-binding portion thereof of claim 2, wherein the HLA molecule is a HLA class I molecule.
4. The antibody or antigen-binding portion thereof of claim 3, wherein the HLA class I molecule is HLA-A.
5. The antibody or antigen-binding portion thereof of claim 4, wherein the HLA-A is HLA-A2.
6. The antibody or antigen-binding portion thereof of claim 5, wherein the HLA-A2 is HLA-A*02:01.
7. The antibody or antigen-binding portion thereof of any one of claims 1-6, wherein the Foxp3 peptide is a portion of a human Foxp3 polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1.
8. The antibody or antigen-binding portion thereof of any one of claims 1-7, wherein the Foxp3 peptide has a length of 8-12 amino acids.
9. The antibody or antigen-binding portion thereof of claim 8, wherein the Foxp3 peptide has a length of 9 amino acids.
10. The antibody or antigen-binding portion thereof of claim 8, wherein the Foxp3 peptide has a length of 10 amino acids.
11. The antibody or antigen-binding portion thereof of any one of claims 1-10, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof , Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
12. The antibody or antigen-binding portion thereof of any one of claims 1-8, and 10- 11, comprising a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 11 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino acid sequence set forth in SEQ ID NO: 14 or a modification thereof;
(b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 17 or a modification thereof, and a light chain variable region CDR3 sequence comprising amino an acid sequence set forth in SEQ ID NO: 20 or a modification thereof;
(c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 23 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 26 or a modification thereof;
(d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 29 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 32 or a modification thereof;
(e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 35 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 38 or a modification thereof;
(f) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 41 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 44 or a modification thereof;
(g) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 47 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 50 or a modification thereof; and
(h) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 53 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 56 or a modification thereof.
13. The antibody or antigen-binding portion thereof of any one of claims 1-8 and 10- 12, further comprising a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 10 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 13 or a modification thereof;
(b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 16 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 19 or a modification thereof;
(c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 22 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 25 or a modification thereof;
(d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 28 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 31 or a modification thereof;
(e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 34 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 37 or a modification thereof;
(f) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 40 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 43 or a modification thereof;
(g) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 46 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 49 or a modification thereof; and (h) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 52 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 55 or a modification thereof.
14. The antibody or antigen-binding portion thereof of of any one of claims 1-8 and 10-13, further comprising a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 9 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 12 or a modification thereof;
(b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 15 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 18 or a modification thereof;
(c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 21 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 24 or a modification thereof; and
(d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 27 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 30 or a modification thereof;
(e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 33 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 36 or a modification thereof;
(f) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 39 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 42 or a modification thereof;
(g) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 45 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 48 or a modification thereof; and
(h) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 51 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 54 or a modification thereof.
15. The antibody or antigen-binding portion thereof of any one of claims 1-8 and 10- 14, comprising:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50; or (h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56.
16. The antibody or antigen-binding portion thereof of claim 15, comprising: a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44.
17. The antibody or antigen-binding portion thereof of any one of claims 1-8, and 10- 15, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107.
18. The antibody or antigen-binding portion thereof of claim 17, comprising a heavy chain variable region that comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 95, 97, 99, 101, 103, 105, and 107.
19. The antibody or antigen-binding portion thereof of any one of claims 1-8, and 10- 15, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108.
20. The antibody or antigen-binding portion thereof of claim 19, comprising a light chain variable region that comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 96, 98, 100, 102, 104, 106, and 108.
21. The antibody or antigen-binding portion thereof of any one of claims 17-20, comprising: (a) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 94;
(b) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 106; or (h) a heavy chain variable region comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 108.
22. The antibody or antigen-binding portion thereof of claim 21, comprising: (a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106; or
(h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108.
23. The antibody or antigen-binding portion thereof of claim 22, comprising: a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104.
24. The antibody or antigen-binding portion thereof of claim 11, wherein the Foxp3 peptide is Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3.
25. The antibody or antigen-binding portion thereof of claim 24, comprising a heavy chain variable region CDR3 sequence and a light chain variable region CDR3 sequence selected from the group consisting of: (a) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 59 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 62 or a modification thereof;
(b) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 65 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 68 or a modification thereof;
(c) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 74 or a modification thereof;
(d) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 77 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 80 or a modification thereof; and
(e) a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 83 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 86 or a modification thereof.
26. The antibody or antigen-binding portion thereof of claims 24 or 25, further comprising a heavy chain variable region CDR2 sequence and a light chain variable region CDR2 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 58 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 61 or a modification thereof;
(b) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 64 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 67 or a modification thereof;
(c) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 70 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 73 or a modification thereof;
(d) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 76 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 79 or a modification thereof; and
(e) a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 82 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 85 or a modification thereof.
27. The antibody or antigen-binding portion thereof of claim 24, 25 or 26, further comprising a heavy chain variable region CDR1 sequence and a light chain variable region CDR1 sequence selected from the group consisting of:
(a) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 57 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 60 or a modification thereof;
(b) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 63 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 66 or a modification thereof;
(c) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 69 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 71 or a modification thereof;
(d) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 75 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 78 or a modification thereof; and
(e) a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 81 or a modification thereof, and a light chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 84 or a modification thereof.
28. The antibody or antigen-binding portion thereof of any one of claims 24-27, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 109, 111, 113, 115, and 117.
29. The antibody or antigen-binding portion thereof of any one of claims 24-28, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the sequence selected from the group consisting of SEQ ID NOS: 110, 112, 114, 116, and 118.
30. The antibody or antigen-binding portion thereof of claim 11, wherein the Foxp3 peptide is Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5.
31. The antibody or antigen-binding portion thereof of claim 30, comprising a heavy chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 89 or a modification thereof, and a light chain variable region CDR3 sequence comprising an amino acid sequence set forth in SEQ ID NO: 92 or a modification thereof.
32. The antibody or antigen-binding portion thereof of claim 30 or 31, comprising a heavy chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 88 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 91 or a modification thereof.
33. The antibody or antigen-binding portion thereof of claim 30, 31 or 32, comprising a heavy chain variable region CDR1 sequence comprising an amino acid sequence set forth in SEQ ID NO: 87 or a modification thereof, and a light chain variable region CDR2 sequence comprising an amino acid sequence set forth in SEQ ID NO: 90 or a modification thereof.
34. The antibody or antigen-binding portion thereof of any one of claims 30-33, comprising a heavy chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 119.
35. The antibody or antigen-binding portion thereof of any one of claims 30-34, comprising a light chain variable region that comprises an amino acid sequence that is at least about 80% homologous to the amino acid sequence set forth in SEQ ID NO: 120.
36. The antibody or antigen-binding portion thereof of any one of claims 1-35, which binds to the N-terminal of the Foxp3 peptide that is bound to the human MHC molecule, or the C-terminal of the Foxp3 peptide that is bound to the human MHC molecule.
37. The antibody or antigen-binding portion thereof of any one of claims 1-36, which binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 1 x 10-7 M or less.
38. An isolated antibody, or an antigen-binding portion thereof, which cross- competes for binding to a Foxp3 peptide bound to a human MHC molecule with a reference antibody or antigen-binding portion comprising:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26; (d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50; (h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56;
(i) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(j) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(k) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74; (l) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80;
(m) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86; or
(n) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92, and
wherein the cross-competing antibody or antigen-binding portion thereof specifically binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 5 x 10-7 M or less.
39. An isolated antibody, or an antigen-binding portion thereof, which binds to the same epitope on a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(a) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 9; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 10; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 11; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 12; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 14;
(b) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 15; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 16; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 17; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 18; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 19; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 20;
(c) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 21; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 22; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 23; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 24; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 25; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 26;
(d) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 27; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 28; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 29; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 30; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 31; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 32;
(e) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 33; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 34; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 35; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 36; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 37; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 38;
(f) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 39; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 40; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 41; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 42; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 43; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 44;
(g) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 45; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 46; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 47; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 48; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 49; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 50;
(h) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 51; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 52; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 53; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 54; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 55; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 56;
(i) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 57; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 58; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 59; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 60; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 61; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 62;
(j) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 63; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 64; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 65; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 66; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 67; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 68;
(k) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 69; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 70; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 71; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 72; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 73; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 74;
(l) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 75; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 76; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 77; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 78; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 79; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 80;
(m) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 81; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 82; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 83; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 84; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 85; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 86; or
(n) a heavy chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 87; a heavy chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 88; a heavy chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 89; a light chain variable region CDR1 comprising an amino acid sequence set forth in SEQ ID NO: 90; a light chain variable region CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 91; and a light chain variable region CDR3 comprising an amino acid sequence set forth in SEQ ID NO: 92.
40. An isolated antibody, or an antigen-binding portion thereof, which cross- competes for binding to a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94;
(b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104; (g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106;
(h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108;
(i) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(j) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(k) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(l) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116;
(m) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118; or
(n) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120, and
wherein the cross-competing antibody or antigen-binding portion thereof specifically binds to the Foxp3 peptide/MHC complex with a binding affinity (KD) of about 5 x 10-7 M or less.
41. An isolated antibody, or an antigen-binding portion thereof, which binds to the same epitope on a Foxp3 peptide bound to an MHC molecule with a reference antibody or antigen-binding portion comprising:
(a) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 93, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 94; (b) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 95, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 96;
(c) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 97, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 98;
(d) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 99, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 100;
(e) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 101, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 102;
(f) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 103, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 104;
(g) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 105, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 106;
(h) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 107, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 108;
(i) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 109, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 110;
(j) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 111, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 112;
(k) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 113, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 114;
(l) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 115, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 116; (m) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 117, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 118; or
(n) a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 119, and a light chain variable region that comprising an amino acid sequence set forth in SEQ ID NO: 120.
42. The antibody or antigen-binding portion thereof of any one of the preceding claims, wherein the antibody comprises a human variable region framework region.
43. The antibody or antigen-binding portion thereof of any one of the preceding claims, which is a fully human antibody or an antigen-binding portion thereof, a chimeric antibody or an antigen-binding portion thereof, or a humanized antibody or an antigen- binding portion thereof.
44. The antibody or antigen-binding portion thereof of any one of the preceding claims, wherein the antigen-binding portion of the antibody is an Fab, Fab', F(ab')2, Fv or single chain Fv (scFv).
45. The antibody or antigen-binding portion thereof of any one of the preceding claims, which is of an IgG1, IgG2, IgG3, or IgG4 isotype.
46. The antibody or antigen-binding portion thereof of any one of the preceding claims, comprising one or more post-translational modifications.
47. The antibody or antigen-binding portion thereof of claim 46, wherein the one or more post-translational modifications comprise afucosylation.
48. The antibody or antigen-binding portion thereof of claim 47, comprising an afucosylated Fc region.
49. An immunoconjugate comprising the antibody or antigen-binding portion thereof of any one of claims 1-48 linked to a therapeutic agent.
50. The immunoconjugate of claim 49, wherein said therapeutic agent is a drug, cytotoxin, or a radioactive isotope.
51. A bispecific molecule comprising the antibody or antigen-binding portion thereof of any one of claims 1-48, linked to a second functional moiety.
52. The bispecific molecule of claim 51, which recognizes a Foxp3 peptide bound to the MHC molecule and a cell surface protein.
53. The bispecific molecule of claim 52, wherein the cell surface protein is CD3 or CD16.
54. A composition comprising the antibody or antigen-binding portion thereof of any one of claims 1-48, the immunoconjugate of claim 49 or 50, or the bispecific molecule of any one of claims 51-53 and a pharmaceutically acceptable carrier.
55. An isolated nucleic acid that encodes an antibody or antigen-binding portion thereof of any one of claims 1-48.
56. An expression vector comprising the nucleic acid molecule of claim 55.
57. A host cell comprising the expression vector of claim 56.
58. A method for detecting Foxp3 in a whole cell or tissue, comprising:
(a) contacting a cell or tissue with an antibody or an antigen-binding portion thereof that binds to a Foxp3 peptide that is bound to a human MHC molecule, wherein the antibody or antigen-binding portion thereof comprises a detectable label; and
(b) determining the amount of the labeled antibody or antigen-binding portion thereof bound to the cell or tissue by measuring the amount of detectable label associated with the cell or tissue, wherein the amount of bound antibody or antigen-binding portion thereof indicates the amount of Foxp3 in the cell or tissue.
59. The method of claim 58, wherein the antibody or antigen-binding portion thereof is the antibody or antigen-binding portion thereof of any one of claims 1-48.
60. A chimeric antigen receptor (CAR) specific for a Foxp3 peptide bound to a human MHC molecule.
61. The CAR of any one of claims 60, wherein the Foxp3 peptide is selected from the group consisting of Foxp3-7 having the amino acid sequence set forth in SEQ ID NO: 8 or a portion thereof; Foxp3-1 having the amino acid sequence set forth in SEQ ID NO: 2 or a portion thereof, Foxp3-2 having the amino acid sequence set forth in SEQ ID NO: 3 or a portion thereof, Foxp3-3 having the amino acid sequence set forth in SEQ ID NO: 4 or a portion thereof, Foxp3-4 having the amino acid sequence set forth in SEQ ID NO: 5 or a portion thereof, Foxp3-5 having the amino acid sequence set forth in SEQ ID NO: 6 or a portion thereof, and Foxp3-6 having the amino acid sequence set forth in SEQ ID NO: 7 or a portion thereof.
62. The CAR of any one of claims 60-61, wherein the CAR comprises the antigen- binding portion of any one of claims 1-48.
63. The CAR of any one of claims 60-62, wherein the antigen-binding portion comprises a single-chain variable fragment (scFv).
64. The CAR of claim 63, wherein the scFv is a human scFv.
65. The CAR of claim 64, wherein the human scFv comprises the amino acid sequence selected from the group consisting of SEQ ID NOS: 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, and 134.
66. An isolated nucleic acid encoding the CAR of any one of claims 60-65.
67. A vector comprising the isolated nucleic acid of claim 66.
68. A host cell comprising the nucleic acid of claim 67.
69. A method of killing a Foxp3-expressing cell, inducing an immune response, and/or treating a cancer, comprising contacting a Foxp3-expressing cell with one of:
(a) the antibody or antigen-binding portion thereof of any one of claims 1-48; (b) the CAR of any one of claims 60-65;
(c) the bispecific antibody of any one of claims 51-53;
(d) the immunoconjugate of claim 49 or 50; and
(d) or the composition of claim 54.
70. Use of the antibody or antigen-binding portion thereof of any one of claims 1-48, the CAR of any one of claims 60-65, the bispecific antibody of any one of claims 51-53, the immunoconjugate of claim 49 or 50, or the composition of claim 54 for killing a Foxp3-expressing cell, and/or for inducing an immune response.
71. The antibody or antigen-binding portion thereof of any one of claims 1-48, the CAR of any one of claims 60-65, the bispecific antibody of any one of claims 51-53, the immunoconjugate of claim 49 or 50, or the composition of claim 54 for use in killing a Foxp3-expressing cell, and/or for use in inducing an immune response.
72. The method of claim 69, use of claim 70, or the antibody, CAR, bispecific antibody, immunoconjugate or composition of claim 71, wherein the Foxp3-expressing cell is a T cell selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
73. A method of selectively inhibiting a T cell in a subject, comprising administering to the subject one of:
(a) the antibody or antigen-binding portion thereof of any one of claims 1-48; (b) the CAR of any one of claims 60-65;
(c) the bispecific antibody of any one of claims 51-53;
(d) the immunoconjugate of claim 49 or 50; and
(d) or the composition of claim 54. wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
74. Use of the antibody or antigen-binding portion thereof of any one of claims 1-48, the CAR of any one of claims 60-65, the bispecific antibody of any one of claims 51-53, the immunoconjugate of claim 49 or 50, or the composition of claim 54 for selectively inhibiting a T cell in a subject, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
75. The antibody or antigen-binding portion thereof of any one of claims 1-48, the CAR of any one of claims 60-65, the bispecific antibody of any one of claims 51-53, the immunoconjugate of claim 49 or 50, or the composition of claim 54 for use in selective inhibition of a T cell, wherein the T cell is selected from the group consisting of CD4+ T cells, CD25high T cells, CD127low T cells, Foxp3high T cells, and combinations thereof.
76. The method of any one of claims 69, 72, and 73, the use of any one of claims 70, 72, and 74, or the antibody, CAR, bispecific antibody, immunoconjugate or composition of any one of claims 71, 72, and 75, wherein the subject suffers from cancer.
77. The method of any one of claims 69, 72, 73 and 76, the use of any one of claims 70, 72, 74 and 76, or the antibody, CAR, bispecific antibody, immunoconjugate or composition of any one of claims 71, 72, 75, and 76, comprising one or more of the followings:
(i) reducing number of a T cell,
(ii) depleting the T cell,
(iii) inhibiting immunosuppressive activity of the T cell, and
(iv) blocking the T cell trafficking into lymph nodes;
(v) inhibiting the T cell; and
(vi) inducing death of the cancer cell.
78. The method of any one of claims 72, 73, 76, and 77, the use of any one of claims 72, 74, 76, and 77 or the antibody, CAR, bispecific antibody, immunoconjugate or composition of any one of claims 72, 75, 76, and 77, wherein the T cell is a regulatory T cell.
79. The method of any one of claims 69, 72, 73, and 76-78, the use of any one of claims 70, 72, 74 and 76-78, or the antibody, CAR, bispecific antibody, immunoconjugate or composition of any one of claims 71, 72, and 75-78, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
80. The method of any one of claims 69, 72, 73, and 76-79, the use of any one of claims 70, 72, 74 and 76-79, or the antibody, CAR, bispecific antibody, immunoconjugate or composition of any one of claims 71, 72, and 75-79, wherein the subject is a human.
81. The method of any one of claims 69, 72, 73, and 76-80, the use of any one of claims 70, 72, 74 and 76-80, or the antibody, CAR, bispecific antibody, immunoconjugate or composition of any one of claims 71, 72, and 75-80, wherein the subject receives an anticancer immunotherapy.
82. A kit for treating cancer, comprising one or more of the following:
antibody or antigen-binding portion thereof of any one of claims 1-48;
(b) the CAR of any one of claims 60-65;
(c) the bispecific antibody of any one of claims 51-53;
(d) the immunoconjugate of claim 49 or 50; and
(d) or the composition of claim 54
83. The kit of claim 82, wherein the cancer is selected from the group consisting of breast cancer, ovarian cancer, melanoma, lung cancer, pancreatic cancer, gastric cancer, colon cancer, glioblastoma, kidney cancer, liver cancer, lymphoma, leukemia, myeloma, sarcoma, and combinations thereof.
PCT/US2017/013511 2016-01-14 2017-01-13 T cell receptor-like antibodies specific for foxp3-derived peptides WO2017124001A2 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
CN201780017192.9A CN109069627A (en) 2016-01-14 2017-01-13 To the T cell receptor sample antibody of the derivative peptide specific of FOXP3
US16/069,999 US11505599B2 (en) 2016-01-14 2017-01-13 T cell receptor-like antibodies specific for Foxp3-derived peptides
EP17739080.4A EP3402518A4 (en) 2016-01-14 2017-01-13 T cell receptor-like antibodies specific for foxp3-derived peptides
JP2018536458A JP7022067B2 (en) 2016-01-14 2017-01-13 T-cell receptor-like antibody specific for FOXP3-derived peptide

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662278815P 2016-01-14 2016-01-14
US62/278,815 2016-01-14

Publications (2)

Publication Number Publication Date
WO2017124001A2 true WO2017124001A2 (en) 2017-07-20
WO2017124001A3 WO2017124001A3 (en) 2017-08-17

Family

ID=59311684

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/013511 WO2017124001A2 (en) 2016-01-14 2017-01-13 T cell receptor-like antibodies specific for foxp3-derived peptides

Country Status (5)

Country Link
US (1) US11505599B2 (en)
EP (1) EP3402518A4 (en)
JP (1) JP7022067B2 (en)
CN (1) CN109069627A (en)
WO (1) WO2017124001A2 (en)

Cited By (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019161133A1 (en) 2018-02-15 2019-08-22 Memorial Sloan Kettering Cancer Center Foxp3 targeting agent compositions and methods of use for adoptive cell therapy
CN111328288A (en) * 2017-08-18 2020-06-23 磨石肿瘤生物技术公司 Antigen binding proteins targeting common antigens
WO2022221669A1 (en) * 2021-04-15 2022-10-20 Kyverna Therapeutics, Inc. Methods and compositions for treating disease using targeted foxp3+cd4+ t cells and cellular suicide agents
US11879003B2 (en) 2021-02-01 2024-01-23 Kyverna Therapeutics, Inc. Methods for increasing T-cell function
US11965021B2 (en) 2017-04-26 2024-04-23 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
US11976105B2 (en) 2015-10-23 2024-05-07 Eureka Therapeutics, Inc. Antibody/T-cell receptor chimeric constructs and uses thereof
WO2024100170A1 (en) 2022-11-11 2024-05-16 F. Hoffmann-La Roche Ag Antibodies binding to hla-a*02/foxp3

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN108337890B (en) * 2015-06-23 2021-10-15 纪念斯隆-凯特琳癌症中心 Novel PD-1 immunomodulators
EP3954707A1 (en) * 2018-12-21 2022-02-16 Zhejiang Shimai Pharmaceutical Co., Ltd. Protease cleavable bispecific antibodies and uses thereof

Citations (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US1975A (en) 1841-02-12 Manner of constructing corn-shellers
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US4956778A (en) 1987-07-02 1990-09-11 Mitsubishi Denki Kabushiki Kaisha Constant speed holding device
EP0401384A1 (en) 1988-12-22 1990-12-12 Kirin-Amgen, Inc. Chemically modified granulocyte colony stimulating factor
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US20030153043A1 (en) 1997-05-21 2003-08-14 Biovation Limited Method for the production of non-immunogenic proteins
US20050196754A1 (en) 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
WO2008081581A1 (en) 2007-01-03 2008-07-10 Oncotherapy Science, Inc. Foxp3 peptide vaccine

Family Cites Families (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20030059427A1 (en) 2000-04-28 2003-03-27 Force Walker R. Isolation and characterization of highly active anti-CD40 antibody
PT1391464E (en) * 2001-04-27 2007-11-15 Kirin Pharma Kk Anti-cd40 monoclonal antibody
US20100003253A1 (en) 2002-11-08 2010-01-07 Ablynx N.V. Single domain antibodies directed against epidermal growth factor receptor and uses therefor
CA2505325C (en) 2002-11-08 2014-02-25 Ablynx N.V. Stabilized single domain antibodies
US9320792B2 (en) 2002-11-08 2016-04-26 Ablynx N.V. Pulmonary administration of immunoglobulin single variable domains and constructs thereof
RS51847B (en) 2004-05-27 2012-02-29 Crucell Holland Bv. Binding molecules capable of neutralizing rabies virus and uses thereof
JP4829609B2 (en) * 2004-12-22 2011-12-07 独立行政法人科学技術振興機構 Human antibody enzyme and production method thereof
CA2625951A1 (en) * 2005-09-01 2007-03-08 National Research Council Of Canada Anti-apoptotic protein antibodies
EP2064350B1 (en) 2006-11-27 2013-01-02 Ludwig Institute for Cancer Research Ltd. Expression of foxp3 by cancer cells
WO2009003489A1 (en) * 2007-07-02 2009-01-08 Natimmune A/S CaOU-1 EPITOPE BINDING POLYPEPTIDES
EP2020419A1 (en) * 2007-07-31 2009-02-04 Bayer Schering Pharma Aktiengesellschaft Anti ephB4 antibody fragments
WO2009079259A2 (en) * 2007-12-06 2009-06-25 Dana-Farber Cancer Institute, Inc. Antibodies against influenza virus and methods of use thereof
CN101965403B (en) * 2008-01-29 2013-07-03 株式会社抗体研究所 Composition for neutralizing botulinus toxin type-a, and human anti-botulinus toxin type-a antibody
EP2271760A2 (en) * 2008-04-29 2011-01-12 Monsanto Technology LLC Genes and uses for plant enhancement
US20120005773A1 (en) * 2008-10-01 2012-01-05 Aasen Eric D Transgenic plants with enhanced agronomic traits
AU2009313560B2 (en) * 2008-11-07 2016-04-14 Fabrus Llc Combinatorial antibody libraries and uses thereof
US20120117685A1 (en) * 2009-02-27 2012-05-10 Wei Wu Isolated Novel Nucleic Acid and Protein Molecules from Soybeans and Methods of Using Thos Molecules
CA2786692A1 (en) 2010-01-11 2011-07-14 Alexion Pharmaceuticals, Inc. Biomarkers of immunomodulatory effects in humans treated with anti-cd200 antibodies
MX347078B (en) * 2010-12-09 2017-04-10 Univ Pennsylvania Use of chimeric antigen receptor-modified t cells to treat cancer.
JP6261341B2 (en) 2011-02-01 2018-01-17 ゲンマブ エー／エス Human antibodies and antibody-drug conjugates against CD74
US20130102031A1 (en) 2011-10-25 2013-04-25 Anaptysbio, Inc. Use of somatic hypermutation to create insertion and deletion mutations in vitro
CN104736168B (en) 2012-05-31 2018-09-21 索伦托治疗有限公司 The antigen-binding proteins combined with PD-L1
EP2897631A4 (en) * 2012-08-31 2016-10-05 Univ Virginia Patent Found Target peptides for immunotherapy and diagnostics
CN106414500B (en) 2013-11-07 2020-04-10 纪念斯隆-凯特琳癌症中心 anti-WT 1/HLA bispecific antibodies
EP4043493A1 (en) 2013-12-24 2022-08-17 Janssen Pharmaceutica NV Anti-vista antibodies and fragments
GB201410520D0 (en) 2014-06-12 2014-07-30 Univ London Queen Mary Antibody

Patent Citations (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US1975A (en) 1841-02-12 Manner of constructing corn-shellers
EP0154316A2 (en) 1984-03-06 1985-09-11 Takeda Chemical Industries, Ltd. Chemically modified lymphokine and production thereof
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5091513A (en) 1987-05-21 1992-02-25 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US5132405A (en) 1987-05-21 1992-07-21 Creative Biomolecules, Inc. Biosynthetic antibody binding sites
US4956778A (en) 1987-07-02 1990-09-11 Mitsubishi Denki Kabushiki Kaisha Constant speed holding device
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
EP0401384A1 (en) 1988-12-22 1990-12-12 Kirin-Amgen, Inc. Chemically modified granulocyte colony stimulating factor
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US6180370B1 (en) 1988-12-28 2001-01-30 Protein Design Labs, Inc. Humanized immunoglobulins and methods of making the same
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US6350861B1 (en) 1992-03-09 2002-02-26 Protein Design Labs, Inc. Antibodies with increased binding affinity
US6165745A (en) 1992-04-24 2000-12-26 Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US20030153043A1 (en) 1997-05-21 2003-08-14 Biovation Limited Method for the production of non-immunogenic proteins
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US20050196754A1 (en) 2000-03-31 2005-09-08 Drmanac Radoje T. Novel nucleic acids and polypeptides
WO2008081581A1 (en) 2007-01-03 2008-07-10 Oncotherapy Science, Inc. Foxp3 peptide vaccine

Non-Patent Citations (114)

* Cited by examiner, † Cited by third party
Title
"Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy", pages: 303 - 16
ALLEN, T.M., NAT. REV. CANCER, vol. 2, 2002, pages 750 - 763
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10
ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402
ANJA ET AL., BLOOD, vol. 95, no. 6, 2000, pages 2098 - 2103
ARNON ET AL.: "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy", MONOCLONAL ANTIBODIES AND CANCER THERAPY
AZINOVIC I ET AL.: "Survival benefit associated with human anti-mouse antibody (HAMA) in patients with B-cell malignancies", CANCER IMMUNOL IMMUNOTHER, vol. 55, no. 12, 2006, pages 1451 - 8, XP019422507, DOI: 10.1007/s00262-006-0148-4
BAUMGARTNER JWILSON CPALMER B ET AL.: "Melanoma induces immunosuppression by up-regulating Foxp3+ regulatory T cells", J. SURG. RES., vol. 141, 2007, pages 72, XP022117353, DOI: 10.1016/j.jss.2007.03.053
BENTONDAVIS, SCIENCE, vol. 196, 1977, pages 180
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BOS PDPLITAS G.RUDRA D ET AL.: "Transient regulatory T cell ablation deters oncogene-driven breast cancer and enhances radiotherapy", J EXP. MED., vol. 210, no. 11, 2013, pages 2435, XP055768618, DOI: 10.1084/jem.20130762
BREGNI ET AL., BLOOD, vol. 80, 1992, pages 1418 - 1422
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 - 83
BRENTJENS ET AL.: "Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias in", BLOOD, vol. 118, no. 18, November 2011 (2011-11-01), pages 4817 - 4828, XP055169039, DOI: 10.1182/blood-2011-04-348540
BRIGHAM ET AL., AM. J. MED. SCI., vol. 298, 1989, pages 278
BROCKS ET AL., IMMUNOTECHNOLOGY, vol. 3, no. 3, 1997, pages 173 - 84
CARON ET AL., J EXP MED, vol. 176, 1992, pages 1191 - 1195
CHAMES ET AL., PROC NALT ACAD SCI USA, vol. 97, 2000, pages 7969 - 7974
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
COX, J. P. L. ET AL.: "A Directory of Human Germ-line V Segments Reveals a Strong Bias in their Usage", EUR. J. IMMUNOL., vol. 24, 1994, pages 827 - 836, XP003004702, DOI: 10.1002/eji.1830240409
CUESTA ET AL.: "Multivalent antibodies: when design surpasses evolution", TRENDS IN BIOTECHNOLOGY, vol. 28, 2010, pages 355 - 362, XP002666460, DOI: 10.1016/j.tibtech.2010.03.007
CURIEL TJCOUKOS GZOU L ET AL.: "Specific recruitment of regulatory T cells in ovarian carcinoma fosters immune privilege and predicts reduced survival", NAT. MED., vol. 10, 2004, pages 942, XP002523105, DOI: 10.1038/nm1093
DAFNE ET AL., JBIOL CHEM, vol. 282, 2007, pages 12650 - 12660
DANNULL J.SU ZRIZZIERI D ET AL.: "Enhancement of vaccine-mediated antitumor immunity in cancer patients after depletion of regulator T cells", J. CLIN. INVEST., vol. 115, no. 12, pages 3623, XP002396935, DOI: 10.1172/JCI25947
DANOS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 6460 - 6464
E. MEYERSW. MILLER, COMPUT. APPL. BIOSCI., vol. 4, 1988, pages 11 - 17
FEIGNER ET AL., PROC. NAT!. ACAD. SCI. U.S.A., vol. 84, 1987, pages 7413
FIFE, J CLIN INVST, vol. 116, no. 8, 2006, pages 2252 - 61
GERD R ET AL.: "Serological Analysis of Human Anti-Human Antibody Responses in Colon Cancer Patients Treated with Repeated Doses of Humanized Monoclonal Antibody A33", CANCER RES, vol. 61, 2001, pages 6851 - 6859, XP001184719, DOI: 10.1016/S0065-230X(01)81003-4
GIOMARELLI ET AL., THROMB HAEMOST, vol. 97, no. 6, 2007, pages 955 - 63
GLENNIE ET AL., J. IMMUNOL., vol. 139, 1987, pages 2367 - 2375
GODFREY WRGE YGSPODEN DJ ET AL.: "In vitro-expanded human CD4+CD25+ regulatory T cells can markedly inhibit allogenic dendritic cell-stimulated MLR cultures", BLOOD, vol. 104, 2004, pages 453 - 461, XP002457226, DOI: 10.1182/blood-2004-01-0151
GRUNSTEINROGNESS, PROC. NATL. ACAD. SCI., USA, vol. 72, pages 3961
HEID JBSCHMIDT AOBERLE N ET AL.: "Foxp3+CD25-tumor cells with regulatory function in sezary syndrome", J. INVEST. DERMATOL., vol. 129, 2009, pages 2875 - 2885
HELD ET AL., EUR J. IMMUNOL., vol. 34, 2004, pages 2919 - 2929
HELLSTROM ET AL.: "Guide to Molecular Cloning Techniques", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery", pages: 623 - 53
HO ET AL., BIOCHIM BIOPHYS ACTA, vol. 1638, no. 3, 2003, pages 257 - 66
HUGHES ET AL., J. CLIN. INVEST., vol. 89, 1992, pages 1817
HUSTON ET AL., PROC. NATL. ACAD. SCI., vol. 85, 1988, pages 5879 - 5883
JONES, P. ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES
KARPOVSKY ET AL., J. EXP. MED., vol. 160, 1984, pages 1686
KLECHEVSKY E ET AL.: "Antitumor activity of immunotoxins with T-cell receptor-like specificity against human melanoma xenografts", CANCER RES, vol. 68, no. 15, 2008, pages 6360 - 6367, XP002597798, DOI: 10.1158/0008-5472.CAN-08-0928
KOBAYASHI ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 55, no. 7, 2006, pages 850 - 860
KONERU MPURDON TJSPRIGGS DKONERU SBRENTJENS RJ: "IL-12 secreting tumor-targeted chimeric antigen receptor T cells eradicate ovarian tumors.", ONCOIMMUNOLOGY, vol. 4, 2015, pages e994446
LARSEN SKMUNIR SWOETMANN A ET AL.: "Functional characterization of Foxp3-specific spontaneous immune responses", LEUKEMIA, vol. 27, 2013, pages 2332 - 2340, XP055591119, DOI: 10.1038/leu.2013.196
LEDBETTER ET AL., CRIT REV IMMUNO1, vol. 17, no. 5-6, 1997, pages 427 - 55
LEV ET AL., CANCER RES, vol. 62, 2002, pages 3184 - 3194
LEVINGS MKSANGREGORIO RSARTIRANA C ET AL.: "Human CD4+CD25+ T suppressor cells clones produce transforming growth factor b, but not interleukin 10, and are distinct from type 1 T regulator cells", J EXP MED., vol. 196, no. 10, 2002, pages 1335 - 1346, XP055518788
LIDIJA P ET AL.: "An integrated vector system for the eukaryotic expression of antibodies or their fragments after selection from phage display libraries", GENE, vol. 187, no. 1, 1997, pages 9 - 18
LISA JH ET AL.: "Crystallographic structure of an intact IgG 1 monoclonal antibody", JOURNAL OF MOLECULAR BIOLOGY, vol. 275, no. 5, 1998, pages 861 - 872
LITZINGER MTFERMANDO RCURIEL TJ ET AL.: "IL-2 immunotoxin denileukin diftitox reduces regulator T cells and enhances vaccine-mediated T-cell immunity", BLOOD, vol. 110, no. 9, 2007, pages 3192 - 201, XP002628064, DOI: 10.1182/blood-2007-06-094615
LIU, MA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 8648
LIYANAGE UKMOORE TTJOO HG ET AL.: "Prevalence of regulatory T cells is increased in peripheral blood and tumor microenvironment of patients with pancreas or breast adenocarcinoma", J. IMMUNOL., vol. 169, 2002, pages 2756
LU LZHOU XWANG J ET AL.: "Characterization of protective human CD4+CD25+Foxp3+ regulatory T cells generated with IL-2, TGF-b and retinoic acid", PLOSONE, vol. 5, no. 12, 2010, pages e15150, XP002652171, DOI: 10.1371/journal.pone.0015150
MCCAFFERTY ET AL.: "Phage antibodies: filamentous phage displaying antibody variable domains", NATURE, vol. 348, pages 552 - 554, XP002196759, DOI: 10.1038/348552a0
MIEDERER ET AL., ADV DRUG DELIV REV, vol. 60, no. 12, 2008, pages 1371 - 1382
MILLER ET AL., MOL. CELL. BIOL., vol. 5, 1985, pages 431 - 437
MILLER ET AL., MOL. CELL. BIOL., vol. 6, 1986, pages 2895 - 2902
MOOSMAYER ET AL., THER IMMUNOL, vol. 2, no. 10, 1995, pages 31 - 40
NAIR SBOCZKOWSKI, FASSNACHT M ET AL.: "Vaccination against the forkhead family transcription factor Foxp3 enhances tumor immunity", CANCER RES., vol. 67, no. 1, 2007, pages 371, XP002582943, DOI: 10.1158/0008-5472.CAN-06-2903
NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 444 - 453
NOY, EXPERT REV ANTICANCER THER, vol. 5, no. 3, 2005, pages 523 - 536
OKA ET AL., THE SCIENTIFIC WORLD JOURNAL, vol. 7, 2007, pages 649 - 665
ONO ET AL., NEUROSCIENCE LETTERS, vol. 17, 1990, pages 259
PARK JHGEYER MBBRENTJENS RJ, BLOOD, vol. 127, no. 26, 30 June 2016 (2016-06-30), pages 3312 - 20
PASTAN, I.KREITMAN, R. J., CURR. OPIN. INVESTIG. DRUGS, vol. 3, 2002, pages 1089 - 1091
PAULUS, BEHRING INS. MITT., vol. 78, 1985, pages 118 - 132
PAYNE, G., CANCER CELL, vol. 3, 2003, pages 207 - 212
PETER ET AL., J BIOI CHERN, vol. 25278, no. 38, 2003, pages 36740 - 7
PETER ET AL., J CACHEXIA SARCOPENIA MUSCLE, 12 August 2012 (2012-08-12)
PROC. NAT. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
QUEEN C ET AL.: "A humanized antibody that binds to the interleukin 2 receptor", PROC NATL ACAD SCI USA, vol. 86, no. 24, 1989, pages 10029 - 33, XP000310534, DOI: 10.1073/pnas.86.24.10029
QUEEN, C. ET AL., PROC. NATL. ACAD. SEE. U.S.A., vol. 86, 1989, pages 10029 - 10033
RAFIQ SPURDON TJDANIYAN AF ET AL.: "Optimized T-cell receptor-mimic chimeric antigen receptor T cells directed toward the intracellular Wilms tumor 1 antigen", LEUKEMIA, DOI: 10.1038/LEU.2016.373, 2017
RECH AJMICK RMARTIN S ET AL.: "CD25 blockade depletes and selectively reprogram regulatory T cells in concert with immunotherapy in cancer patients", SCI. TRANSL. MED., vol. 4, no. 134, 2012, XP055924343, DOI: 10.1126/scitranslmed.3003330
RENA MAYTAO DAOJAVIER PINILLA-IBARZ ET AL.: "CD4+ peptide epitopes from the WT1 oncoprotein stimulate CD4+ and CD8+ T cells that recognize and kill human malignant mesothelioma tumor cells", CLIN. CANCER RES., vol. 13, 2007, pages 4547 - 4555, XP002544528, DOI: 10.1158/1078-0432.ccr-07-0708
RIECHMANN L ET AL.: "Reshaping human antibodies for therapy", NATURE, vol. 332, no. 6162, 1988, pages 552 - 554, XP002007067, DOI: 10.1038/332323a0
RIECHMANN, L. ET AL., NATURE, vol. 332, 1998, pages 323 - 327
ROBERTS ET AL., BLOOD, vol. 99, no. 10, 2002, pages 3748 - 3755
ROSSI ET AL., PROC NATL ACA SCI USA, vol. 103, 2006, pages 6841 - 6
RYUTARO ET AL., JBIOL CHEM, vol. 286, 2011, pages 1812 - 1818
SAITO, G. ET AL., ADV. DRUG DELIV. REV., 2003, pages 199 - 215
SCHULER ET AL., IMMUNOINFORMATICS METHODS IN MOLECULAR BIOLOGY, vol. 409, no. 1, 2007, pages 75 - 93
See also references of EP3402518A4
SENTER, P.D.SPRINGER, C.J., ADV. DRUG DELIV. REV., vol. 53, 2001, pages 247 - 264
SHIEH ET AL., J IMUNOL, vol. 183, no. 4, 2009, pages 2277 - 85
STAUBINGER ET AL., METHODS IN ENZYMOLOGY, vol. 101, 1983, pages 512
STEWART ET AL., TETRAHEDRON LETTERS, vol. 39, 1998, pages 1517 - 1520
SUGIYAMA DNISHIKAWA HMAEDA Y ET AL.: "Anti-CCR4 mAb selectively depletes effector-type Foxp3+CD4+ regulator T cells, evoking antitumor immune responses in humans", PNAS, vol. 110, no. 44, 2013, pages 17945, XP055284822, DOI: 10.1073/pnas.1316796110
TAO DAODMITRY PANKOVANDREW SCOTTTATYANA KORONTSVITVICTORIYA ZAKHALEVAYIYANG XUJINGYI XIANGSU YANMANUEL DIREITO DE MORAIS GUERREIRO: "Therapeutic bispecific T-cell engager antibody targeting the intracellular oncoprotein WT1", NAT. BIO. TECH. DOI:10.1038/NBT.3349, 2015
TAO DAOSU YANNICHOLAS VEOMETTDMITRY PANKOVLIANG ZHOUTATYANA KRONTSVITANDREW SCOTTJOSEPH WITTENPETER MASLAKEMILY CASEY: "Targeting the intracellular WT1 oncogene product with a therapeutic human antibody", SCI TRANSLMED., vol. 5, no. 176, 2013, XP009178626, DOI: 10.1126/scitranslmed.3005661
TAO DAOTATYANA KORONSVITVICTORIA ZAKHALEVA ET AL.: "Identification of a human cyclin D1-derived peptide that induces human cytotoxic CD4 T cells", PLOS ONE, vol. 4, no. 8, 2009, pages e6730
THORPE ET AL.: "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review", MONOCLONAL ANTIBODIES '84: BIOLOGICAL AND CLINICAL APPLICATIONS, 1985, pages 475 - 506
THORPE ET AL.: "The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates", IMMUNOL. REV., vol. 62, 1982, pages 119 - 58, XP001179872, DOI: 10.1111/j.1600-065X.1982.tb00392.x
TJANDRA JJ ET AL.: "Development of human anti-murine antibody (HAMA) response in patients", IMMUNOL CELL BIOL, vol. 68, no. 6, 1990, pages 367 - 76
TOMLINSON, I. M. ET AL.: "The Repertoire of Human Germline V Sequences Reveals about Fifty Groups of V Segments with Different Hypervariable Loops", J. MOL. BIOL., vol. 227, 1992, pages 776 - 798, XP024020607, DOI: 10.1016/0022-2836(92)90223-7
TOMOMATSU ET AL.: "Production of human monoclonal antibodies against FceRIa by a method combining in vitro immunization with phage display", BIOSCI BIOTECHNOL BIOCHEM, vol. 73, no. 7, 2009, pages 1465 - 1469
TRAIL, P.A. ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 52, 2003, pages 328 - 337
WAHL ET AL., J. NUCL. MED., vol. 24, 1983, pages 316 - 325
WAHL, G. M.S. L. BERGER, METHODS ENZYMOL., vol. 152, 1987, pages 507
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WEINER ET AL., J. IMMUNOLOGY, vol. 152, no. 5, 1994, pages 2385 - 2392
WEINTRAUB, B.: "Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques", March 1986, THE ENDOCRINE SOCIETY
WOLF AMWOLF DSTEURER M ET AL.: "Increase of regulatory T cells in the peripheral blood of cancer patients", CLIN. CANCER. RES., vol. 9, 2003, pages 606
WOLFF ET AL., SCIENCE, vol. 247, 1990, pages 1465
WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 263, 1988, pages 14621
WU ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 264, 1989, pages 16985
XIE ET AL., NAT BIOTECH, vol. 15, no. 8, 1997, pages 768 - 71
XU ET AL., EXP. HEMAT., vol. 22, 1994, pages 223 - 230
YAN ET AL., J. BIOL. CHEM., vol. 285, 2010, pages 19637 - 19646
YASMINA ET AL., PROTEIN SCIENCE, vol. 17, no. 8, 2008, pages 1326 - 1335
YASMINA NA ET AL.: "Probing the binding mechanism and affinity of tanezumab, a recombinant humanized anti-NGF monoclonal antibody, using a repertoire of biosensors", PROTEIN SCIENCE, vol. 17, no. 8, 2008, pages 1326 - 1335, XP055113671, DOI: 10.1110/ps.035402.108
ZHAO ET AL., HYRBIDOMA (LARCHMT, vol. 27, no. 6, 2008, pages 455 - 51

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11976105B2 (en) 2015-10-23 2024-05-07 Eureka Therapeutics, Inc. Antibody/T-cell receptor chimeric constructs and uses thereof
US11965021B2 (en) 2017-04-26 2024-04-23 Eureka Therapeutics, Inc. Cells expressing chimeric activating receptors and chimeric stimulating receptors and uses thereof
CN111328288A (en) * 2017-08-18 2020-06-23 磨石肿瘤生物技术公司 Antigen binding proteins targeting common antigens
JP2021500852A (en) * 2017-08-18 2021-01-14 グリットストーン オンコロジー インコーポレイテッド Antigen-binding protein that targets shared antigens
WO2019161133A1 (en) 2018-02-15 2019-08-22 Memorial Sloan Kettering Cancer Center Foxp3 targeting agent compositions and methods of use for adoptive cell therapy
CN112041432A (en) * 2018-02-15 2020-12-04 纪念斯隆-凯特林癌症中心 FOXP3 targeting agent compositions and methods of use for adoptive cell therapy
EP3752601A4 (en) * 2018-02-15 2022-03-23 Memorial Sloan-Kettering Cancer Center Foxp3 targeting agent compositions and methods of use for adoptive cell therapy
US20220267420A1 (en) * 2018-02-15 2022-08-25 Memorial Sloan Kettering Cancer Center Foxp3 targeting agent compositions and methods of use for adoptive cell therapy
US11879003B2 (en) 2021-02-01 2024-01-23 Kyverna Therapeutics, Inc. Methods for increasing T-cell function
WO2022221669A1 (en) * 2021-04-15 2022-10-20 Kyverna Therapeutics, Inc. Methods and compositions for treating disease using targeted foxp3+cd4+ t cells and cellular suicide agents
WO2024100170A1 (en) 2022-11-11 2024-05-16 F. Hoffmann-La Roche Ag Antibodies binding to hla-a*02/foxp3

Also Published As

Publication number Publication date
JP7022067B2 (en) 2022-02-17
CN109069627A (en) 2018-12-21
JP2019512207A (en) 2019-05-16
WO2017124001A3 (en) 2017-08-17
EP3402518A4 (en) 2019-07-03
US11505599B2 (en) 2022-11-22
EP3402518A2 (en) 2018-11-21
US20190284262A1 (en) 2019-09-19

Similar Documents

Publication Publication Date Title
US11384144B2 (en) T cell receptor-like antibodies specific for a PRAME peptide
JP7345578B2 (en) Novel anti-PD-L1 antibody
US11505599B2 (en) T cell receptor-like antibodies specific for Foxp3-derived peptides
RU2725811C1 (en) Anti-human 4-1bb antibodies and use thereof
JP7027401B2 (en) Antibodies to TIM3 and its use
AU2020215576A1 (en) Antibodies and chimeric antigen receptors specific for receptor tyrosine kinase like orphan receptor 1 (ROR1)
JP2019519223A (en) Immune modulatory protein and bispecific binding protein binding to tumor antigens
JP2017501692A (en) Therapeutic peptide
JP2017532290A (en) Bispecific antibodies against CD3 epsilon and BCMA
TW201735947A (en) Cell injury inducing therapeutic drug for use in cancer therapy
TW201710294A (en) Constructs targeting AFP peptide/MHC complexes and uses thereof
KR20170128234A (en) Antibodies specific for ROR1 and chimeric antigen receptors
JP2021501605A (en) Antibodies and chimeric antigen receptors specific for B cell maturation antigens
MX2014003156A (en) Anti-cd134 (ox40) antibodies and uses thereof.
CN113301919A (en) Bispecific antibodies that activate immune cells
EP4118120A2 (en) Novel anti-lilrb4 antibodies and derivative products
US20220002412A1 (en) Humanized Anti-PD-1 Antibody and The Use Thereof
KR102449868B1 (en) Anti-cd83 antibodies and use thereof
RU2725807C2 (en) Soluble universal reinforcing adcc synthetic fused gene, peptide technology and use thereof
CA3144755A1 (en) Method of inhibiting or activating gamma delta t cells
CN114302733A (en) anti-New York esophageal squamous cell carcinoma 1(NY-ESO-1) antigen binding proteins and methods of use thereof
US20240101667A1 (en) Methods for identifying lilrb-blocking antibodies
WO2023020475A1 (en) Cd40-targetting antibodies and uses thereof
CA3167424A1 (en) Lilrb3 antibody molecules and uses thereof
IL280731A (en) Reactive protective armor

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17739080

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2018536458

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2017739080

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2017739080

Country of ref document: EP

Effective date: 20180814