WO2017093985A1 - Hiv binding agents - Google Patents
Hiv binding agents Download PDFInfo
- Publication number
- WO2017093985A1 WO2017093985A1 PCT/IB2016/057367 IB2016057367W WO2017093985A1 WO 2017093985 A1 WO2017093985 A1 WO 2017093985A1 IB 2016057367 W IB2016057367 W IB 2016057367W WO 2017093985 A1 WO2017093985 A1 WO 2017093985A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- binding agent
- antibody
- amino acid
- hiv
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/112—Retroviridae (F), e.g. leukemia viruses
- C07K16/114—Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
- C07K16/1145—Env proteins, e.g. gp41, gp110/120, gp160, V3, principal neutralising domain [PND] or CD4-binding site
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- This disclosure relates to binding agents with specificity for human immunodeficiency virus (HIV), methods for making the same, and to methods for using the same to treat and / or prevent HIV infection.
- HIV human immunodeficiency virus
- Figures 1A-D show the results of neutralization of a panel of nine (9) HIV-1 pseudoviruses from the Global Panel of HIV-1 reference strains by 70 plasma samples from chronically infected patients na ' ive to antiretroviral therapy. MLV pseudovirus is used as a negative control. Boxed are the seven donors selected for the collection of lymph nodes to isolate potent broadly neutralizing antibodies. Highlighted with the arrow is donor SA003 who was selected for the isolation of the broadly neutralizing antibody described in the present invention. ID50 values indicate the dilution of plasma capable of neutralizing 50% of viral infection.
- Figure 2 shows the gating and sorting strategy used to purify memory and germinal center IgG B cells from lymph node samples.
- B cells were selected for the expression of the surface marker CD19 and IgG B cells were negatively selected for the lack of IgA and IgM B cell receptor (BCR) expression.
- Germinal center B cells were further selected for the expression of the CD38 marker (that is absent on memory B cells).
- Figures 3A-B show the results of neutralization of a panel of nine (9) HIV-1 pseudoviruses (and MLV as negative control) from the Global Panel of HIV-1 reference strains by different concentration (in ⁇ g/ml) of the monoclonal antibody LN01 .
- IC50 values indicate the concentration of monoclonal antibody capable of neutralizing 50% of viral infection. Error bars indicate the standard deviation of duplicates.
- Figure 4 shows the results of neutralization of a multi-clade panel of 1 18 HIV-1 pseudoviruses by the monoclonal antibody LN01 .
- IC50 values indicate the concentration of monoclonal antibody capable of neutralizing 50% of viral infection.
- Figures 5A-J show the distribution of IC50 values on the whole panel of 1 18 viruses described in Figure 4 and on individual clades or circulating recombinant forms.
- Figure 6 shows the results of neutralization of a panel of nine (9) HIV-1 pseudoviruses from the Global Panel of HIV-1 reference strains by the monoclonal antibody LN01 when using TZM-bl or TZM-bl expressing Fc gamma Receptor I as target cells.
- Figure 7 shows the results of neutralization of a panel of seven (7) HIV-2/HIV-1 chimeric pseudoviruses where the HIV-2 (strain 7312A) MPER region is mutagenized by introducing corresponding residues from the MPER consensus sequence of clade B or clade C (in the case of the variant 7312A.C1 C) HIV-1 strains.
- Figures 8A-D show the binding of LN01 or 7B2 monoclonal antibodies to an array of 1423 15-mer peptides, overlapping by 12 amino acids, that cover the full length of the consensus HIV-1 Env gp160 sequences for clades A, B, C, D, group M, CRF01_AE and CRF02_AG. Signals below 2.0E+4 are scored as negative. As expected 7B2 reacts with the gp41 immunodominant region (gp41 ID).
- Figures 9A-D show the binding, as assessed by surface plasmon resonance, of LN01 , PGT145, PGT151 and 17B monoclonal antibodies to the cleaved and soluble HIV-1 Env trimer BG505 SOSIP.664 gp140 that expresses multiple epitopes for broadly neutralizing in the presence or absence of soluble CD4 (sCD4).
- sCD4 soluble CD4
- Figures 10A-B show the binding, as measured by ELISA, of LN01 and 10E8 (MPER- specific broadly neutralizing antibody) antibodies to a set of HIV-1 Env antigens and a negative control (Ctr) antigen. 10E8 antibody reacted to the recombinant ecto-domain of gp41 that contains the MPER region.
- LN01 and 10E8 MPER- specific broadly neutralizing antibody
- Figures 11A-B shows the binding, as measured by ELISA, of LN01 and 10E8 monoclonal antibodies to a fusion intermediate gp41 (gp41 int) or uncoated plates as a negative control (PBS). 10E8 antibody reacted to gp41 that contains the MPER region.
- Figure 12 shows the binding of imAb 10E8 to the gp41 peptide RRR- NEQELLELDKWASLWNWFDITNWLWYIRRRR (SEQ ID NO. 89).
- Figures 13A-C show the potency of LN01 antibody point mutation variants.
- A LN01 VH and VL variants.
- B IC 50 ⁇ g ml) of LN01 variants.
- C IC 50 ratio (IC 50 LN01 wt / IC 50 LN01 variants ("var.")).
- Figure 14A-K show testing of LN01 variants 7, 8 and 38 in parallel with the parental LN01 antibody against a multiclade panel of eight viruses.
- Figures 15A-B show testing of LN01 variants 41 , 42, 43, 44, 48 and 50 against a multiclade panel of seven viruses.
- Figures 16A-B show testing of LN01 variant 49 against a panel of seven viruses.
- Figure 17 shows testing of LN01 variant 82 (IC 50 ⁇ g/ml)).
- This disclosure relates to binding agents with specificity for human immunodeficiency virus (HIV), methods for producing such binding agents, as well as methods for using such binding agents to treat, prevent and / or ameliorate HIV infection.
- HIV human immunodeficiency virus
- binding agents having binding affinity for human immunodeficiency virus (HIV).
- the binding agent can bind HIV antigens on viral particles per se or on the surface of cells in vitro and / or in vivo.
- the binding agents may also bind isolated HIV antigens and / or fragments and / or derivatives thereof, typically in vitro.
- methods for using such binding agents to diagnose, treat, prevent and / or ameliorate one or more diseases associated with HIV.
- the binding agents may be antibodies (e.g., monoclonal antibodies) that may react with and / or bind to the epitopes of HIV or polypeptides thereof.
- the binding agents may be useful for treating disease caused by HIV, such as Acquired Immune Deficiency Syndrome (AIDS).
- the binding agents described herein may selectively target and/or eliminate HIV and/or HIV-infected cells containing HIV (e.g., replication competent HIV) and/or expressing proteins thereof. In some embodiments, such cells may be reservoirs for replication competent HIV.
- binding agents having, for instance, different specificities (e.g., recognizing different epitopes) may be combined to HIV activity such as infection, replication and/or spread to other cells.
- the binding agents described herein may also provide for the selective elimination and / or suppression of HIV or HIV-expressing cells.
- the binding agents described herein may be used to supress and / or eliminate HIV and/or HIV-expressing cells to treat, for instance, HIV infection and/or AIDS. Other embodiments, uses and the like are described below.
- the binding agents may be antibodies such as monoclonal antibodies. As shown in the examples herein, the techniques discussed below have been used to identify a fully human imAb termed "LN01 ", having particular characteristics that are described herein and shown in the examples. The LN01 antibody was isolated and the amino acid sequences of variable heavy (V H ) and light (V L ) chain domains of said antibody determined. A binding agent such as LN01 may identified by referencing the amino acid and/or nucleic acid sequences corresponding to the variability and / or complementarity determining regions (“CDRs”) thereof.
- CDRs complementarity determining regions
- a CDR comprises amino acid residues within the variable region identified in accordance with the definitions of the Kabat, Chothia, the accumulation of both Kabat and Chothia, AbM, contact, and/or conformational definitions or any method of CDR determination well known in the art.
- antibody modeling software now Accelrys®
- the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding (Makabe et al., 2008, Journal of Biological Chemistry, 283:1 156-1 166).
- CDR boundary definitions may not strictly follow one of the above approaches, but may nonetheless overlap with at least a portion of the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues or even entire CDRs do not significantly impact antigen binding.
- a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches. The methods used herein may utilize CDRs defined according to any of these approaches. For any given embodiment containing more than one CDR, the CDRs may be defined in accordance with any of Kabat, Chothia, extended, AbM, contact, and/or conformational definitions.
- V H Variable Heavy 7 EVQLVESGPGLVQPWGTLSLTCRVSGDSVSNDN (V H ) (CDRH 1 , YYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLRN CDRH2 and CDRH3 RVTISLDKSVNVVSLRLG S VSAADTAQYYCVRM P underlined) SHGFWSTSFSYWYFDLWGRGHFVAVSW
- V L Variable Light 8 DIQMTQSPSSLSASVGDKVTITCRASQSVTKYLN (V L ) (CDRL1 , CDRL2 WYQFKTGQAPRILIYGTYTLLSGVSPRFSGAGSG and CDRL3 SLYTLTITNIQPEDFATYYCQQAHSTPWTFGQGT underlined) HVAAN
- LN01 variant 7 9 EVQLVESGPGLVQPWGTLSLTCRVSGDSVSNW Variable Heavy (V H ) NYYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLR (CDRH1 , CDRH2 NRVTISLDKSVNWSLRLGSVSAADTAQYYCVRM and CDRH3 PSHGFWSTSFSYWYFDLWGRGHFVAVSW underlined)
- V L DIQMTQSPSSLSASVGDKVTITCRASQSVTKYLN Variable Light
- V L WYQFKTGQAPRILIYGTYTLLSGVSPRFSGAGSG (CDRL1 , CDRL2 and SLYTLTITNIQPEDFATYYCQQAHSTPWTFGQGT CDRL3 underlined) HVAAN
- LN01 variant 8 1 1 EVQLVESGPGLVQPWGTLSLTCRVSGDSVSND Variable Heavy (V H ) WYYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLR (CDRH1 , CDRH2 NRVTISLDKSVNWSLRLGSVSAADTAQYYCVRM and CDRH3 PSHGFWSTSFSYWYFDLWGRGHFVAVSW underlined)
- V L DIQMTQSPSSLSASVGDKVTITCRASQSVTKYLN Variable Light
- V L WYQFKTGQAPRILIYGTYTLLSGVSPRFSGAGSG (CDRL1 , CDRL2 and SLYTLTITNIQPEDFATYYCQQAHSTPWTFGQGT CDRL3 underlined) HVAAN
- LN01 variant 38 13 EVQLVESGPGLVQPWGTLSLTCRVSGDSVSNDN Variable Heavy (V H ) YYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLRN (CDRH1 , CDRH2 RVTISLDKSVNVVSLRLG S VSAADTAQYYCVRM P and CDRH3 SHGFWSTSFSYWYFDLWGRGHFVAVSW underlined)
- LN01 variant 41 15 EVQLVESGPGLVQPWGTLSLTCRVSGDSVSNFN Variable Heavy (V H ) YYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLRN (CDRH1 , CDRH2 RVTISLDKSVNVVSLRLG S VSAADTAQYYCVRM P and CDRH3 SHGFWSTSFSYWYFDLWGRGHFVAVSW underlined)
- V L 16 DIQMTQSPSSLSASVGDKVTITCRASQSVTKYLN Variable Light (V L ) WYQFKTGQAPRILIYGTYTLLSGVSPRFSGAGSG (CDRL1 , CDRL2 and SLYTLTITNIQPEDFATYYCQQAHSTPWTFGQGT CDRL3 underlined) HVAAN
- LN01 variant 42 17 EVQLVESGPGLVQPWGTLSLTCRVSGDSVSNYN Variable Heavy (V H ) YYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLRN (CDRH1 , CDRH2 RVTISLDKSVNVVSLRLG S VSAADTAQYYCVRM P and CDRH3 SHGFWSTSFSYWYFDLWGRGHFVAVSW underlined)
- V L WYQFKTGQAPRILIYGTYTLLSGVSPRFSGAGSG (CDRL1 , CDRL2 and SLYTLTITNIQPEDFATYYCQQAHSTPWTFGQGT CDRL3 underlined) HVAAN
- V H YYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLRN (CDRH1 , CDRH2 RVTISLDKSVNVVSLRLG S VSAADTAQYYCVRM P and CDRH3 SHGFWSTSFSYWYFDLWGRGTLVTVSS underlined)
- V L 20 DIQMTQSPSSLSASVGDKVTITCRASQSVTKYLN Variable Light (V L ) WYQFKTGQAPRILIYGTYTLLSGVSPRFSGAGSG (CDRL1 , CDRL2 and SLYTLTITNIQPEDFATYYCQQAHSTPWTFGQGT CDRL3 underlined) HVAAN
- V H EVQLVESGPGLVQPWGTLSLTCRVSGDSVSNW Variable Heavy (V H ) WYYWAWIRQTPGRELQVIGTIYYSGTTYYNPSLR (CDRH1 , CDRH2 NRVTISLDKSVNWSLRLGSVSAADTAQYYCVRM and CDRH3 PSHGFWSTSFSYWYFDLWGRGHFVAVSW underlined)
- V L DIQMTQSPSSLSASVGDKVTITCRASQSVTKYLN Variable Light
- V L WYQFKTGQAPRILIYGTYTLLSGVSPRFSGAGSG (CDRL1 , CDRL2 and SLYTLTITNIQPEDFATYYCQQAHSTPWTFGQGT CDRL3 underlined) HVAAN
- a binding agent of this disclosure may comprise, for example, any one or more of the amino acid sequences shown in Table 1 (i.e., any one or more of SEQ ID NOS. 1 -32 or GTY (LN01 CDRL2)). Fragments and/or derivatives (e.g., comprising substituted amino acids, such as conservative substitutions) thereof are also disclosed.
- An exemplary derivative of the LN01 antibody (an lgG3 antibody), for instance, is termed "IgG 1 LN01 " in which the LN01 variable regions were cloned into an lgG1 backbone.
- a binding agent of this disclosure may comprise one or more (i.e., one, two, three, four, five, six or seven) of SEQ ID NOS. 1-32.
- the binding agent may comprise each of SEQ ID NOS. 1 -6 and or GTY (LN01 CDRL2).
- such a binding agent may comprise SEQ ID NO. 7 and / or SEQ ID NO. 8; SEQ NOS. 9 and/or 10; SEQ NOS. 1 1 and/or 12; SEQ NOS. 13 and/or 14; SEQ NOS. 15 and/or 16; SEQ NOS. 17 and/or 18; SEQ NOS. 19 and/or 20; SEQ NOS.
- the binding agent comprises SEQ ID NO. 7 and SEQ ID NO. 8; SEQ NOS. 9 and 10; SEQ NOS. 1 1 and 12; SEQ NOS. 13 and 14; SEQ NOS. 15 and 16; SEQ NOS. 17 and 18; SEQ NOS. 19 and 20; SEQ NOS. 21 and 22; or SEQ NOS. 23 and 24; or a conservatively substituted variant thereof.
- the binding agent may comprise any of SEQ ID NOS. 1-32 comprising one or more amino acid substitutions, in particular conservative substitutions (see, e.g., Table 2).
- Exemplary variants of SEQ ID NO.:1 include, for instance, any of SEQ ID NOS. 25-32.
- the binding agent may be a monoclonal antibody or a fragment or derivative thereof.
- the binding agent may be an HIV-binding fragment of such a monoclonal antibody.
- Such embodiments would typically include at least one or more of SEQ ID NOS. 1 -32, and preferably include each of SEQ ID NOS. 1 -6 (or GTY (LN01 CDRL2) such as SEQ ID NOS. 7-8; SEQ ID NO. 25 (LN01 variants 7 and 48 CDR H1 ); SEQ ID NO.
- the binding agent may comprise any of SEQ ID NOS. 1-32 but not those of any one or more of SEQ ID NOS. 70-80. Other suitable embodiments may be derived by those of ordinary skill in the art from this disclosure.
- the binding agent e.g., antibody, or the antigen binding fragment thereof
- that percent identity is with respect to an amino acid sequence of at least three amino acids (e.g., as in GTY of LN01 CDRL2), six amino acids (e.g., as in LN01 CDRL1 (SEQ ID NO.:4)), seven amino acids (e.g., as in LN01 CDRH2 (SEQ ID NO.:2)), nine amino acids (e.g., as in LN01 CDRL2 (long), (SEQ ID NO.:5), LN01 CDRL3 (SEQ ID NO.:6), LN01 variant 82 CDRH1 (SEQ ID NO.
- the binding agent binds HIV and/or cells infected by HIV and/or expressing HIV proteins. In some especially preferred embodiments, the binding agent neutralizes HIV as described herein. In preferred embodiments, the binding agent both binds HIV and/or cells infected by HIV and/or expressing HIV proteins, and neutralizes HIV.
- variable region and/or CDR sequences may be used in combination with one or more other variable region / CDR amino acid sequences available to those of ordinary skill in the art.
- Such variable region / CDR amino acid sequences may alternatively and / or also be adjoined to one or more types of constant region polypeptides of an antibody molecule.
- the CDR amino acid sequences shown in Table 1 may be adjoined to or associated with the constant regions of any antibody molecule of the same or a different species (e.g., human, goat, rat, sheep, chicken) and / or antibody subtype of that from which the CDR amino acid sequence was derived.
- an exemplary binding agent may be, or may be derived from, one having about the same neutralizing activity and/or binding the same or similar epitopes and/or exhibiting about the same affinity as another binding agent comprising one or more of the amino acid sequences shown in Table 1 (e.g., LN01 and IgG 1 LN01 ).
- the binding agent may comprise an antibody heavy and / or a light chain that each comprises one or more constant and / or variable regions.
- any of the amino acid sequences described herein may also be combined with any other variable region and / or CDR in any order and / or combination to form new binding agents, e.g., hybrid and / or fusion binding agents, and / or inserted into other heavy and / or light chain variable regions using standard techniques.
- binding agents to isolate, identify, and / or target HIV and / or cells harboring and/or infected by HIV and / or expressing HIV antigens.
- binding agents may be reactive against HIV antigens such as proteins expressed on the surface of cells.
- the binding agent(s) is an antibody (antibodies).
- antibody or “antibodies” may refer to whole or fragmented antibodies in unpurified or partially purified form (e.g., hybridoma supernatant, ascites, polyclonal antisera) or in purified form.
- the antibodies may be of any suitable origin or form including, for example, murine (e.g., produced by murine hybridoma cells), or expressed as humanized antibodies, chimeric antibodies, human antibodies, and the like.
- antibodies may be wholly or partially dervied from human (e.g., IgG (IgG 1 , lgG2, lgG2a, Ig2b, lgG3, lgG4), IgM, IgA (lgA1 and lgA2), IgD, and IgE), canine (e.g., IgGA, IgGB, IgGC, IgGD), chicken (e.g., IgA, IgD, IgE, IgG, IgM, IgY), goat (e.g., IgG), mouse (e.g., IgG, IgD, IgE, IgG, IgM), pig (e.g., IgG, IgD, IgE, IgG
- the antibodies may be contained within hybridoma supernatant or ascites and utilized either directly as such or following concentration using standard techniques.
- the antibodies may be further purified using, for example, salt fractionation and ion exchange chromatography, or affinity chromatography using Protein A, Protein G, Protein A/G, and / or Protein L ligands covalently coupled to a solid support such as agarose beads, or combinations of these techniques.
- the antibodies may be stored in any suitable format, including as a frozen preparation (e.g., -20°C or -70°C), in lyophilized form, or under normal refrigeration conditions (e.g., 4°C).
- the binding agent When stored in liquid form, for instance, it is preferred that a suitable buffer such as Tris-buffered saline (TBS) or phosphate buffered saline (PBS) is utilized.
- TBS Tris-buffered saline
- PBS phosphate buffered saline
- the binding agent may be prepared as an injectable preparation, such as in suspension in a non-toxic parenterally acceptable diluent or solvent.
- Suitable vehicles and solvents that may be utilized include water, Ringer's solution, and isotonic sodium chloride solution, TBS and / or PBS, among others.
- Such preparations may be suitable for use in vitro or in vivo may be prepared as is known in the art and the exact preparation may depend on the particular application.
- the binding agents described herein are not, however, in any way limited to antibodies (i.e., whole antibodies).
- the binding agent may be any compound exhibiting similar binding properties as another (e.g., a mimetic).
- an exemplary binding agent may be one that binds HIV and/or can compete with another binding agent having specificity therefor (e.g., a monoclonal antibody such as LN01 ).
- the mimetic may exhibit substantially the same affinity in binding assays as the binding agent (e.g., monoclonal antibody) to which it is being compared.
- the affinity a particular binding agent may be measured by any suitable assay including but not limited to FACS staining of cell surface HIV antigens (e.g., polypeptides).
- One binding agent may be said to have "substantially the same affinity" as another where the measurements (e.g., nm) are within about any of 1 -20, 1 -5, 5-10, 10-15, or 15-20 percent of one another.
- Exemplary mimetics may include, for example, organic compounds that specifically bind HIV, or an affibody (Nygren, et al. FEBS J. 275 (1 1 ): 2668-76 (2008)), affilin (Ebersbach, et al. J. Mol. Biol.
- Other mimetics may include, for example, a derivative of an antibody such as, for example, an F a b, Fab2, Fab' single chain antibody, F v , single domain antibody, mono-specific antibody, bi- specific antibody, tri-specific antibody, multi-valent antibody, chimeric antibody, canine- human chimeric antibody, canine-mouse chimeric antibody, antibody comprising a canine Fc, humanized antibody, human antibody, caninized, CDR-grafted antibody (i.e., comprising any of SEQ ID NOS. 1 -32 shown in Table 1 ), shark antibody, nanobody, canelid antibody, microbody, and / or intrabody, or derivative thereof.
- Other binding agents are also provided herein as would be understood by one of ordinary skill in the art.
- binding agents having specificity for (e.g., binding to) HIV Any method known to those of ordinary skill in the art may be used to generate binding agents having specificity for (e.g., binding to) HIV.
- an animal such as a mouse may be administered (e.g., immunized) with one or more HIV proteins. Animals exhibiting serum reactivity to HIV expressed on activated human T lymphocytes (as determined by, for instance, flow cytometry and / or microscopy) may then be selected for generation of anti-HIV hybridoma cell lines. This may be repeated for multiple rounds. Screening may also include, for instance, affinity binding and / or functional characterization to identify the binding agent as an being specific for HIV.
- human beings may be screened for the expression of antibodies against HIV.
- plasma samples of human beings infected by HIV may be screened to identify persons expressing anti-HIV antibodies, and in particular, neutralizing antibodies.
- Neutralizing antibody-producing cells of such persons may then be isolated, followed by the isolation and characterization of the antibodies produced thereby (e.g., as in the examples herein).
- a neutralizing antibody may be one that exhibits the ability to neutralize, or inhibit, infection of cells by HIV.
- a neutralization assay typically measures the loss of infectivity of the virus through reaction of the virus with specific antibodies.
- a loss of infectivity is caused by interference by the bound antibody with any of the virus replication steps including but not limited to binding to target cells, entry, and/or viral release.
- the presence of unneutralized virus is detected after a predetermined amount of time, e.g., one, two, three, four, five, six, seven, eight, nine, 10, 12 or 14 days, by measuring the infection of target cells using any of the systems available to those of ordinary skill in the art (e.g., a luciferase-based system).
- a non-limiting example of a neutralization assay may include combining a given amount of a virus or pseudovirus (see below) and different concentrations of the test or control (typically positive and negative controls assayed separately) antibody or antibodies are mixed under appropriate conditions (e.g., one (1 ) hour at room temperature) and then inoculated into an appropriate target cell culture (e.g., TZM-bl cells).
- a virus or pseudovirus see below
- concentrations of the test or control typically positive and negative controls assayed separately
- antibody or antibodies are mixed under appropriate conditions (e.g., one (1 ) hour at room temperature) and then inoculated into an appropriate target cell culture (e.g., TZM-bl cells).
- binding agent-producing cells may be assayed for the production of HIV-1 neutralizing antibodies by seeding such cells in separate plates as single cell micro- cultures on human feeder cells in the presence of Epstein-Barr Virus (EBV) (which also stimulate polyclonally memory B cells), a cocktail of growth factors (e.g., TLR9 agonist CpG- 2006, IL-2 (1000 lU/ml), IL-6 (10 ng/ml), IL-21 (10 ng/ml), and anti-B cell receptor (BCR) goat antibodies (which trigger BCRs).
- ESV Epstein-Barr Virus
- supernatants of such cultures may tested in a primary luciferase-based screening system using two or more representative HIV-1 viruses or pseudoviruses that productively infect such cells.
- the pseudoviruses may be incubated with B cell culture supernatants for an appropriate time and temperature (e.g., one (1 ) h at 37% (5% C0 2 )) before the addition of host cells (e.g., 3000 TZM-bl cells). Incubation for an appropriate time (e.g., 72 hours) may then follow, after which the supernatant may be removed and Steadylite reagent (Perkin Elmer) added (e.g., 15 ⁇ ).
- Steadylite reagent Perkin Elmer
- Luciferase activity may then deteremined (e.g., five minutes later) on a Synergy microplate luminometer (BioTek). Decreased luciferase activity relative to a negative control typically indicates virus neutralization.
- Neutralization assays such as these, suitable for analyzing binding agents of this disclosure, are known in the art (see, e.g., Montefiori, D.C. Curr. Protocol. Immunol. Chapter 12, Unit 12.1 1 (2005); Edmonds, et al. Virology, 408(1 ): 1 -13 (2010); Seaman, et al. J. Virol. 84(3): 1439-1452 (2010); Pace, et al.
- test samples may be screened for the presence of antibodies able to neutralize a panel of HIV pseudoviruses (e.g., nine (9) HIV-1 pseudoviruses from the Global Panel of HIV-1 reference strains as conducted in the examples herein (those pseudoviruses being BJOX (CRF007_BC), CE1 176 (C), TRO.1 1 (B), X1632 (G), CH1 19 (CRF07_BC), CNE55 (CRF01_AE), 25710 (C), 246F3 (AC), CE0217 (C)); DeCamp, A. et al.
- HIV pseudoviruses e.g., nine (9) HIV-1 pseudoviruses from the Global Panel of HIV-1 reference strains as conducted in the examples herein (those pseudoviruses being BJOX (CRF007_BC), CE1 176 (C), TRO.1 1 (B), X1632 (G), CH1 19 (CRF07_BC), CNE55 (CRF01_AE), 25710 (C),
- a panel of ten HIV isolates may be tested and a BNA may be identified as one that neutralizes six, seven, eight, nine members of a panel of nine pseudoviruses; or six, seven, eight, nine, 10, 1 1 or 12 members of a panel of 12 pseudoviruses. Screening of larger panels of such pseudoviruses (e.g., a panel of 1 18 pseudoviruses as in the examples herein) may also be carried out.
- An exemplary panel of 1 18 pseudoviruses used in the examples against which test samples may be tested for neutralizing antibodies may include, for instance, those shown in Fig.
- neutralization may be determined as a measure of the concentration (e.g., ⁇ g/ml) of monoclonal antibody capable of neutralizing any of about 50%, 60%, 70%, 80%, 90%, 95%, or 99% of viral infection (an "IC 50 " value).
- a binding agent may be considered neutralizing if it is able to neutralize 50% of viral infection at a concentration of, for instance, about any of 10 "5 , 10 "4 , 10 “3 , 10 “2 , 10 "1 , 10°, 10 1 , 10 2 , or 10 3 ⁇ g/ml (an IC 50 value as shown in in Fig. 3). In some embodiments, as in the Examples herein, it is preferred that this IC 50 value be below 25 ⁇ g/ml, and even more preferably below about any of 15, 10, 5, 2, 1 , 0.5, 0.25, 0.1 , 0.05, or 0.01 ⁇ g/ml.
- the IC 50 value may be less than 0.01 1 (e.g., Fig. 7).
- the ability of a neutralizing antibody to neutralize viral infection may also be expressed as a percent neutralization (e.g., 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or 99% (e.g., as in Fig. 3)).
- Other measures of neutralization may also be suitable as may be determined by those of ordinary skill in the art.
- the binding agents described herein may be broadly neutralizing antibodies (BNAs) identified in biological samples (e.g., plasma) obtained from HIV-infected persons.
- BNAs may be identified by testing plasma samples of patients chronically infected by HIV (preferably those na ' ive to antiretroviral therapy) for the ability to neutralize multi-clade HIV isolates (e.g., initially using a nine or 12-member panel and then a larger panel (e.g., 1 18 members) of pseudoviruses)).
- the samples may be derived from patients known to be "Elite Controllers" with viremia ⁇ 50 HIV RNA copies per ml of plasma.
- Screening procedures such as these may result in the identification of patients that may serve as lymph node donors for the subsequent isolation and characterization of B cells producing BNAs.
- neutralizing activity is typically compared to a negative control such as murine leukemia virus (MLV) pseudovirus.
- MLV murine leukemia virus
- germinal center and memory IgG B cells of patients expressing neutralizing binding agents may be isolated and further studied.
- the cells may be sorted separately according to IgG (e.g., IgA and IgM negative cells), CD19, and CD38 expression (germinal center B cells are CD38 positive) (see, e.g., Figure 2) and interrogated for the production of HIV-1 neutralizing antibodies.
- IgG memory B cells and IgG germinal cells may be seeded in separate plates as single cell micro-cultures on human feeder cells in the presence of Epstein-Barr Virus (EBV) (which also stimulate polyclonally memory B cells) and a cocktail of growth factors and the like (e.g., composed TLR9 agonist CpG-2006, IL-2 (1000 lU/ml), IL-6 (10 ng/ml), IL-21 (10 ng/ml), and anti-BCR goat antibodies (B cell receptor (BCR) triggering)).
- EBV Epstein-Barr Virus
- Supernatants of such cultures may then be tested in a primary screening (e.g., using a 384-well based HIV-1 pseudoviruses neutralization assay using in parallel two strains, CE1 176 and BJOX2000, representative of clade C and CRF07, as shown in the examples herein).
- Neutralization assays may be carried out using any suitable host cells (e.g., TZM-bl cells (Seaman, et al. J. Virol. 84(3): 1439-52 (2010); NIH AIDS Reagent Program Catalog Number 8129)).
- HIV-1 pseudoviruses resulting in a significant output relative light units may then incubated with B cell culture supernatants for an appropriate time and temperature (e.g., one (1 ) h at 37% (5% C0 2 )) before the addition of host cells (e.g., 3000 TZM-bl cells).
- RLU relative light units
- B cell culture supernatants for an appropriate time and temperature (e.g., one (1 ) h at 37% (5% C0 2 )) before the addition of host cells (e.g., 3000 TZM-bl cells).
- Incubation for an appropriate time typically follows, after which the supernatant may be removed and Steadylite reagent (Perkin Elmer) added (e.g., 15 ⁇ ).
- Luciferase activity may then detected (e.g., five minutes later) on a Synergy microplate luminometer (BioTek). Decreased luciferase activity indicates a lesser amount of virus being released by the cells and virus neutralization. For instance, if the base RLU for a particular psuedovirus is 50-100 x 10 4 RLU, a neutralizing antibody may be determined to decrease the RLU for that pseudovirus to 25-50 x 10 4 RLU (i.e., a 50% decrease), or less. Using such systems, supernatants capable of cross-neutralizing strains may be identified, further harvested, and tested for their ability to neutralize other pseudoviruses.
- the antibodies derived from such neutralizing antibody-containing cultures may then be further characterized by determining the amino acid and nucleotide sequences of the antibody variable and complementarity determining regions (CDRs) regions.
- CDRs complementarity determining regions
- LN01 was determined to be derived from the IGHV4-39 * 07 and IGKV1-39 * 01 germline genes and highly somatically mutated in variable genes of both heavy chain (28%) and kappa light chain (27%) compared to germ line. LN01 was also found to possess a long heavy-chain complementarity-determining 3 region ("CDR H3") loop composed of 20 amino acids.
- CDR H3 long heavy-chain complementarity-determining 3 region
- the variable heavy chain (V H ) and variable light chain (V L ) genes of a binding agent may then be cloned into an IgG expression vector of the same or a different isotype.
- nucleic acids encoding LN01 CDRs (Table 3) were cloned into lgG1 backbone, and the recombinant lgG 1 -based antibody (IgG 1 LN01 ) was produced by transfecting appropriate host cells (e.g., Expi293F cells).
- the antibody full-length IgG 1 -based antibody may then be purified using standard techniques (e.g., a full-length lgG 1 -based antibody may be purified using a recombinant protein-A column (GE-Healthcare)).
- the recombinantly-produced IgG 1 antibody may then be tested against any of a panel of pseudoviruses such as any of those described herein (e.g., the Global Panel of nine (9) HIV-1 reference pseudoviruses used in the examples) on an appropriate host cell (e.g. , TZM-bl cells).
- the binding agent will exhibit the ability to neutralize a majority (i.e. , at least about 50% or greater) of the pseudovirus panel members (e.g., comprising nine, 12 or 1 18 members) without neutralizing a negative control virus (e.g., MLV pseudovirus).
- the binding agent exhibit the ability to neutralize a majority of such viruses (e.g., neutralization of greater than about 50%, such as any of about 60%, 70%, 80%, 90%, 95%, 99%, or 100%) with IC 50 values considered neutralizing (see below).
- a binding agent of this disclosure may exhibit neutralization of HIV-1 pseudoviruses BJOX (CRF07_BC), CE1 176, TRO.1 1 (B), X1632 (G), CH 1 19 (CRF07_BC), CNE55 (CRF01_AE), 25710 (C), CD0217(C) but not of the control virus SVA-MLV at about 10° ⁇ g/m ⁇ or less ( Figure 3).
- neutralization of the HIV-1 pseudoviruses viruses may be observed where the antibody concentration is from 10 2 -10° ⁇ g/ml, or between 10°-10 1 ⁇ g/ml ( Figure 3). In some such embodiments, the percent neutralization by the binding agent is at least about 50% ( Figure 3). In some embodiments, infection of one HIV-1 isolate is considered neutralized by a binding agent (e.g. , antibody) at an ICso of less than 25 ⁇ g/ml, if infection of at least one isolate of this isolate is neutralized with an ICso of less than 25 ⁇ g/ml.
- a binding agent e.g. , antibody
- the binding agent may be considered neutralizing where a majority of the 1 18 HIV-1 pseudoviruses listed in Figure 4 are considered neutralized at an IC 50 of less than 25 ⁇ g/ml, such as about 10 ⁇ g/ml, 9 ⁇ g/ml, 8 ⁇ g/ml, 7 ⁇ g/ml, 6 ⁇ g/ml, 5 ⁇ g/ml, 4 ⁇ g/ml, 3 ⁇ g/ml, 2 ⁇ g/ml, 1 ⁇ g/ml, 0.9 ⁇ g/ml, 0.8 ⁇ g/ml, 0.7 ⁇ g/ml, 0.6 ⁇ g/ml, 0.5 ⁇ g/ml, 0.4 ⁇ g/ml, 0.3 ⁇ / ⁇ , 0.2 ⁇ / ⁇ , 0.1 ⁇ g/m ⁇ , 0.09 ⁇ / ⁇ , 0.08 ⁇ / ⁇ , 0.07 ⁇ / ⁇ , 0.06 ⁇ / ⁇ , 0.05 ⁇ / ⁇ , 0.04 ⁇ g/m ⁇ ,
- the binding agent may neutralize HIV-1 pseudovirus strains of ID 6535.3, QH0692.42, SC422661 .8, PVO.4, TRO.1 1 , PEJ04541.67, WITO4160.33, 1006_1 1_C3_1601 , 1054_07_TC4_1499, 1056_TA1 1_1826, 1012_1 1_TC21_3257, 6244_13_B5_4576, SC05_8C1 1_2344, Du156.12, Du172.17, Du422.1 , ZM197M.PB7, ZM214M.PL15, ZM233M.PB6, ZM249M.PL1 , ZM109F.PB4, ZM135M.PL10a, HIV-0013095-2.1 1 , HIV-16055-2.3, HIV-16845-2.22, Ce1086_B2, Ce1 176_A3, Ce0682_E4, Ce1 172_H1 , ZM247v1 (
- the binding agent may neutralize HIV-1 pseudovirus strains of ID QH0692.42, SC422661 .8, PVO.4, TRO.1 1 , PEJ04541.67, WIT04160.33, 1006_1 1_C3_1601 , 1054_07_TC4_1499, 1056_TA1 1_1826, 6244_13_B5_4576, SC05_8C1 1_2344, Du156.12, Du172.17, ZM197M.PB7, HIV-0013095-2.1 1 , HIV-16055-2.3, HIV-16845-2.22, Ce1086_B2, Ce1 172_H1 , ZM247v1 (Rev-), 3016.v5.c45, A07412M1 .vrc12, CNE20, CNE21 , CNE53, CNE58, 9004SS_A3_4, 928-28, 263-8, T255-34, CNE8, C1080.C03
- the binding agent may neutralize HIV-1 pseudovirus strains of ID 1054_07_TC4_1499, 1056_TA1 1_1826, 6244_13_B5_4576, Du172.17, HIV-0013095-2.1 1 , HIV-16845-2.22, Ce1 172_H1 , CNE20, CNE21 , 928-28, CNE8, P1981_C5_3 at an IC 5 o of less than or about 0.1 ⁇ g/ml (Fig. 4). It is further preferred that the binding agent not exhibit clade-dependency.
- the binding agent may exhibit the ability to neutralize pseudoviruses of HIV-1 Clades B, B (T/F), C, C (T/F), D, D (T/F), BC, A, A (T/F), CRF02_AG, CRF01_Ae, CRF01_AE (T/F), G, CD, AC and ACD (Fig. 4).
- the binding agent may neutralize at least one pseudovirus in each of clades B, B (T/F), C, C (T/F), D, BC, A, A (T/F), CRF02_AG, CRF01_Ae, CRF01_AE (T/F), G, CD, and ACD at at an IC 50 of less than or about 1 ⁇ g/ml (Fig. 4).
- the binding agent may neutralize at least one pseudovirus in each of clades B, B (T/F), C, C (T/F), D, BC, A (T/F), CRF02_AG, CRF01_Ae, CRF01_AE (T/F), G, CD, and ACD at at an IC 5 o of less than or about 0.5 ⁇ g/ml (Fig. 4).
- the binding agent may neutralize at least one pseudovirus in each of clades B (T/F), C, C (T/F), BC, A (T/F), CRF02_AG, CRF01_AE, CRF01_AE (T/F), G, and CD at at an IC 50 of less than or about 0.1 ⁇ g/ml (Fig. 4).
- the binding agent comprises any one or more of these properties and one or more of SEQ ID NOS. 1 -32, preferably each of SEQ ID NOS. 1-7 and/or SEQ ID NOS. 8-9 and/or fragments and/or derivatives thereof.
- SEQ ID NOS. 1 -32 preferably each of SEQ ID NOS. 1-7 and/or SEQ ID NOS. 8-9 and/or fragments and/or derivatives thereof.
- the binding agents may be tested for neutralization capacity against HIV reference pseudoviruses (e.g., the above-described Global Panel of nine (9) HIV-1 reference pseudoviruses) using cells expressing or not expressing one or more types of Fc receptors (e.g., parental TZM-bl cells and TZM-bl cells expressing Fc-gamma receptor I (CD64) as in the examples; see e.g. Perez, et al. Utilization of immunoglobulin G Fc receptors by human immunodeficiency virus type 1 : a specific role for antibodies against the membrane-proximal external region of gp41.
- HIV reference pseudoviruses e.g., the above-described Global Panel of nine (9) HIV-1 reference pseudoviruses
- Fc receptors e.g., parental TZM-bl cells and TZM-bl cells expressing Fc-gamma receptor I (CD64) as in the examples; see e.g. Perez, et al. Utilization
- Enhanced neutralizing activity in cells expressing Fc receptors may provide antibodies a kinetic advantage for virus inhibition. This kinetic advantage could be unique to antibodies, whose epitopes are thought to be difficult to access or exposed for only a short time on intermediate conformations of the Env protein during an early stage of fusion. Fc-gamma receptors could also potentially facilitate HIV-1 neutralization is phagocytosis, thereby increasing neutralization capacity of the antibodies. To this point, HeLa cells, from which the TZM-bl cell line was constructed, are known to exhibit properties of nonprofessional phagocytes.
- TZM-bl cells were converted to professional phagocytic cells by introducing Fc-gamma receptor on their surface.
- Fc- gamma receptors are rarely expressed on CD4+ lymphocytes, but several other HIV-1 - susceptible cell types express multiple Fc-gamma receptors and are involved in sexual transmission and the early establishment of long-lived viral reservoirs.
- macrophages are among the first infection-susceptible cells that the virus encounters after mucosal exposure, and are thought to serve as a long-lived virus reservoir in chronic infection.
- Macrophages, as well as certain subsets of monocytes and dendritic cells, are known to express multiple Fc-gamma receptors. It is also important to mention that Fc- gamma receptors play a role in regulating adaptive immunity and peripheral tolerance, by facilitating antigen uptake, antigen presentation, cell activation and B cell tolerance.
- the binding agents described herein may be used in conjunction with agents that induce and/or enhance Fc receptor expression, including the introduction of nucleic acids encoding one or more Fc receptors with or in conjunction with treatment by the binding agents described herein.
- the specificity of the binding agents described herein may be determined using any of the many techniques available to those of ordinary skill in the art. For instance, as shown in the examples herein, the specificity of a binding agent (e.g., lgG1 LN01 antibody), with respect to particular epitopes, may be ascertained using a panel of chimeric pseudoviruses (e.g., HIV-2/HIV-1 chimeras containing various segments of the HIV-1 MPER into the parental HIV-2/7312A) to test for neutralization capacity. For instance, the examples herein demonstrate that IgG 1 LN01 antibody does not neutralize the parental HIV-2 7312A strain.
- a binding agent e.g., lgG1 LN01 antibody
- lgG1 LN01 antibody was found to potently neutralize the chimeric virus 7312A.C4 in which six (6) residues of HIV-2 MPER (LASWVKYIQ (SEQ ID NO. 65)) were replaced by those of HIV-1 MPER region (ITKWLWYIK (SEQ ID NO. 66)).
- lgG1 LN01 antibodies was also found not to neutralize the chimeric virus 7312A.C6 in which only three (3) residues in the same region were replaced (ITSWIKYIQ (SEQ ID NO. 67)) (see, e.g., Fig. 7).
- the binding agent exhibits the capacity to bind to and/or neutralize HIV expressing gp41 comprising the amino acid residues L679, W680 and K683 as found in the HIV-1 envelope amino acid sequence of GenBank Accession No. K03455 (NCBI GenPept Accession No. AAB50262), such as, for instance, SEQ ID NO. 68 (L679, W680 and K683 underlined):
- gp41 polypeptide is shown below:
- Another exemplary gp41 polypeptide has GenBank Accession No. 1 103299B (Meusing, et al. Nature 313 (6002), 450-458 (1985)).
- Exemplary equivalents to amino acid residues L679, W680 and K683 are the underlined amino acid residues L168, W169 and K172 of SEQ ID NO. 14 (as well as GenBank Accession No. 1 103299B).
- the binding agent exhibits the capacity to bind to and/or neutralize HIV expressing amino acid sequence ITKWLWYIK (SEQ ID NO. 66).
- the binding agent exhibits the capacity to bind to and/or neutralize HIV expressing amino acid sequence ITKWLWYIK (SEQ ID NO.
- the epitope(s) to which the binding agent binds includes the amino acid residues L679, W680 and K683, or equivalents thereof of, HIV env (e.g., SEQ ID NO. 68.
- the epitope(s) to which the binding agent binds includes the amino acid residues L168, W169 and K172 of SEQ ID NO. 69, or equivalents thereof.
- a binding agent of this disclosure may comprise these binding specificities along with the neutralization characteristics described above (i.e., neutralization of HIV-1 pseudoviruses BJOX (CRF07_BC), CE1 176, TRO.1 1 (B), X1632 (G), CH1 19 (CRF07_BC), CNE55 (CRF01_AE), 25710 (C), CD0217(C) but not of the control virus SVA-MLV at a concentration is from 10 2 -10° ug/ml, or between 10°-10 1 ug/ml, to at least about 50% (Fig. 3), as well as the neutralization a majority of the 1 18 HIV-1 pseudoviruses listed in Figure 4 at an IC 50 of less than 25 ⁇ g/ml).
- Peptide microarrays may alternatively and/or also be used to determine the binding specificity of the binding agents described herein.
- One or more peptide microarrays may be designed such that overlapping peptides encompassing the entire amino acid sequence of a HIV polypeptide. For instance, as shown in the examples herein, a peptide microarray formed by 1423 overlapping (by 12 amino acids) 15-mer peptides covering the consensus HIV-1 Env gp160 sequences for clades A, B, C, D, group M, CRF01_AE and CRF02_AG was utilized to test the specificity of binding agent IgG 1 LN01.
- the peptides were printed onto 3D-Epoxy glass slides and were analyzed with a GenePix 4000B scanner (Tomaras, G. D. et al. Polyclonal B cell responses to conserved neutralization epitopes in a subset of H IV- 1 -infected individuals. J Virol 85, 1 1502-1 1519 (201 1 )) but any suitable system available to those of ordinary skill in the art may be utilized.
- the binding agent may be tested along with a control binding agent (e.g., in the examples herein lgG01 LN01 was tested at 20 ⁇ g/ml in parallel with a control antibody called 7B2 haivng specificity for the immunodominant region of gp41 ).
- the binding of the binding agent to the peptides in the microarray may be detected by any suitable process, including by incubation with DyLight 649-labeled goat anti-human IgG as in the examples herein. Fluorescence intensity may be measured by any suitable system, such as a GenePix 4000B scanner/GenePix software as in the examples herein (see, e.g., Fig. 8).
- IgG 1 LN01 antibody did not clearly react with any of the peptides in that library, while the control antibody (7B2) strongly reacted with 190-195 peptides that spanned the gp41 immunodominant region, indicating that the lgG1 LN01 antibody does not recognize a linear epitope in HIV-1 Env. Similar tests may also be performed on any of the binding agents contemplated herein.
- a binding agent may also be tested for binding to soluble trimers representing HIV proteins (e.g., soluble, cleaved SOSIP.664 gp140 trimers based on the subtype A transmitted/founder strain, BG505 as used in the examples herein).
- Preferred trimers are those being highly stable, homogenous and closely resembling native virus spikes when visualized by negative stain electron microscopy (EM) (Sanders, R. W. et al.
- a next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140 expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies.
- BG505 SOSIP.664 gp140 expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies.
- broadly neutralizing antibodies against multiple neutralizing epitopes on HIV-1 Env will be highly reactive with such trimers (e.g., the BG505 SOSIP.664 gp140 trimers, including quaternary epitopes antibodies (CH01 , PG9, PG16 and PGT145)).
- non-neutralizing antibodies to the CD4-binding site, CD4-induced epitopes or gp41 ectodomain would not (and did not in the example) react with the trimers, even when their epitopes were present on simpler forms of Env (e.g., gp120 monomers or dissociated gp41 subunits).
- the examples also included a test, which may be used in testing any of binding agents described herein, in which the MPER was also deleted to improve trimer solubility and reduce aggregate formation. The binding agents may also be tested for binding to such trimers in the presence or absence of soluble CD4 (sCD4).
- the examples herein describe the testing of the lgG1 LN01 , PGT145 (V1 -V2 glycan specific), PGT151 (binding to a site at the interface between gp120 and gp41 ) and 17b (binding to a CD4 binding induced site) antibodies for binding to BG505 SOSIP.664 gp140 trimers in the presence or absence of sCD4 (measured by surface plasmon resonance (SPR)).
- SPR surface plasmon resonance
- the PGT145 and PGT151 antibodies reacted strongly to BG505 SOSIP.664 gp140 trimers in the presence and absence of sCD4; 17b reacted to BG505 SOSIP.664 gp140 trimers only in the presence of sCD4; and lgG1 LN01 did not react with BG505 SOSIP.664 gp140 trimers neither in the presence nor in the absence of sCD4 (see, e.g., Fig. 9). Similar tests may also be performed on any of the binding agents contemplated herein.
- ELISA ELISA
- lgG1 LN01 antibody in parallel with MPER-specific 10E8 antibody (Huang, J. et al. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.
- gp41 int antigen is recognized with high affinity by MPER antibodies 4E10, 2F5 and 10E8. While 10E8 reacted to gp41 int by ELISA, lgG1 LN01 antibody did not (see, e.g., Fig. 11 ). These results indicate that lgG1 LN01 antibody recognizes a conserved epitope, possibly in the MPER region, that is not readily displayed in any of the antigens tested. Similar tests may be performed on any of the binding agents contemplated herein.
- binding affinity and/or K D refers to the dissociation rate of a particular antibody-antigen interaction.
- the K D is the ratio of the rate of dissociation ("off-rate (k d )") to the association rate ("on-rate (k a )).
- K D therefore equals k d /k a and is expressed as a molar concentration (M).
- M molar concentration
- the binding agents described herein may be compared with another binding agent with reference to the respective K D values of each. These properties may be combined with other characteristics such as neutralization capacity and/or epitope specificity in order to compare binding agents to one another. Accordingly, binding agents having a similar K D to those described herein, perhaps also sharing the neutralization capacity and epitope specificity described herein (e.g., as exhibited by LN01 ), are also contemplated as part of this disclosure.
- any of the amino acid sequences of Tables 1 may be also substituted by any other amino acid as desired by one of ordinary skill in the art.
- one of skill in the art may make conservative substitutions by replacing particular amino acids with others as shown in Table 2 below.
- the specific amino acid substitution selected may depend on the location of the site selected.
- An amino acid substitution may be said to "correspond to" where one of ordinary skill in the art could ascertain a significant amount of similarity between the amino acid sequences surrounding the amino acid being substituted.
- a particular amino acid sequence may correspond to another where two, three, four or more N-terminal and C- terminal amino acids surrounding the amino acid being substituted are the same or similar (e.g., as described in Table 2) in the polypeptides being compared.
- Conservative amino acid substitutions may involve a substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the size, polarity, charge, hydrophobicity, or hydrophilicity of the amino acid residue at that position and, in particular, does not result in, e.g., decreased HIV neutralization capacity and/or different epitope specificity.
- a nucleic acid molecule encoding one or more binding agents described herein may be inserted into one or more expression vectors, as discussed below in greater detail.
- the binding agent may be encoded by nucleotides corresponding to the amino acid sequence.
- the particular combinations of nucleotides (codons) that encode the various amino acids (AA) are well known in the art, as described in various references used by those skilled in the art (e.g., Lewin, B. Genes V, Oxford University Press, 1994).
- the nucleotide sequences encoding the amino acids of said binding agents may be ascertained with reference to Table 3, for example.
- Nucleic acid variants may use any combination of nucleotides that encode the binding agent.
- nucleotide sequence encoding a particular amino acid sequence may be easily derived from the amino acid sequence of any of SEQ ID NOS. 1 -7 and the information presented in Table 4. For instance, it may be deduced from the amino acid sequence GDSVSNDNYY (SEQ ID NO.: 1 ) and the information presented in Table 4 that the amino acid sequence may be encoded by the nucleotide sequence GGTGACTCAGTCAGTAATGATAATTATTAT (SEQ ID NO.: 33).
- nucleotide sequences encoding SEQ ID NOS. 2-32 and 34-36 may be deduced in the same way, and such nucleotide sequences are contemplated herein.
- Table 4 provides exemplary nucleic acid sequences encoding the amino acid sequences shown in Table 1 (SEQ ID NOS. 1 -32):
- RQTPG RE LQVI GTIYYSGTTY TGGGGGACCCTGTCCCTCACCT YNPSLRNRVTISLDKSVNWS GTCGTGTCTCTGGTGACTCAGT LRLGSVSAADTAQYYCVRMP CAGTAATG ATAATTATTATTG G G SHGFWSTSFSYWYFDLWGR CCTGGATTCGCCAGACCCCCGG GHFVAVSW (SEQ ID NO. 7) G AG G G AACTG CAGGTCATCG G A
- RGHFVAVSW (SEQ ID NO.: CAGAGAACTGCAAGTGATCGGC
- V L DIQMTQSPSSLSASVGDKVTI GACATCCAGATGACCCAGTCTC Variable Light (V L ) TCRASQSVTKYLNWYQFKT CGTCCTCCCTGTCTGCCTCTGT (CDRL1 , CDRL2 and GQAPRILIYGTYTLLSGVSPR TGGAGACAAAGTCACCATCACC CDRL3 underlined) FSGAGSGSLYTLTITNIQPED TGCCGGGCCAGTCAGAGTGTCA
- GHFVAVSW (SEQ ID NO.: CGCGAGCTGCAGGTCATCGGG
- V L DIQMTQSPSSLSASVGDKVTI GACATCCAGATGACCCAGTCTC Variable Light (V L ) TCRASQSVTKYLNWYQFKT CGTCCTCCCTGTCTGCCTCTGT (CDRL1 , CDRL2 and GQAPRILIYGTYTLLSGVSPR TG G AG ACAAAGTCACCATCACC CDRL3 underlined) FSGAGSGSLYTLTITNIQPED TGCCGGGCCAGTCAGAGTGTCA
- CAGCTCC (SEQ ID NO. 51 )
- V L DIQMTQSPSSLSASVGDKVTI GACATCCAGATGACCCAGTCTC Variable Light (V L ) TCRASQSVTKYLNWYQFKT CGTCCTCCCTGTCTGCCTCTGT (CDRL1 , CDRL2 and GQAPRILIYGTYTLLSGVSPR TG G AG ACAAAGTCACCATCACC CDRL3 underlined) FSGAGSGSLYTLTITNIQPED TGCCGGGCCAGTCAGAGTGTCA
- V L DIQMTQSPSSLSASVGDKVTI GACATCCAGATGACCCAGTCTC Variable Light (V L ) TCRASQSVTKYLNWYQFKT CGTCCTCCCTGTCTGCCTCTGT (CDRL1 , CDRL2 and GQAPRILIYGTYTLLSGVSPR TG G AG ACAAAGTCACCATCACC CDRL3 underlined) FSGAGSGSLYTLTITNIQPED TGCCGGGCCAGTCAGAGTGTCA
- GHFVAVSW (SEQ ID NO. 23) CGCGAGCTGCAGGTCATCGGCA
- a nucleic acid encoding a binding agent of this disclosure may comprise one or more SEQ ID NOS. 33-64 or GGGACTTAT, or a derivative thereof that encodes any of SEQ ID NOS. 1 -32 or GTY (LN01 CDRL2) and/or a derivative thereof (e.g., any of SEQ ID NOS. 1 -32 conservatively substituted as described in Table 2, encoded by a nucleotide sequence determined using standard techniques, e.g., as described in Table 3, including but not limited to those described in Table 4).
- Expression vectors comprising such nucleic acid sequences are also contemplated by this disclosure.
- nucleotide sequences encoding the variable regions thereof may also be isolated from the phage and / or hybridoma cells expressing the same cloned into expression vectors. Methods for producing such preparations are well-known in the art.
- Nucleic acid molecules encoding one or more HIV binding agents may be contained within a viral and / or a non-viral vector.
- a DNA vector is utilized to deliver nucleic acids encoding one or more HIV binding agents to the patient.
- various strategies may be utilized to improve the efficiency of such mechanisms including, for example, the use of self-replicating viral replicons (Caley, et al. 1999. Vaccine, 17: 3124- 2135; Dubensky, et al. 2000. Mol. Med. 6: 723-732; Leitner, et al. 2000. Cancer Res. 60: 51 - 55), codon optimization (Liu, et al. 2000. Mol.
- Other methods are known in the art, some of which are described below.
- Various viral vectors that have been successfully utilized for introducing a nucleic acid to a host include retrovirus, adenovirus, adeno-associated virus (AAV), herpes virus, and poxvirus, among others.
- the vectors may be constructed using standard recombinant techniques widely available to one skilled in the art. Such techniques may be found in common molecular biology references such as Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by D. Goeddel, 1991 . Academic Press, San Diego, CA), and PCR Protocols: A Guide to Methods and Applications (Innis, et al. 1990. Academic Press, San Diego, ca). "Non-viral" plasmid vectors may also be suitable in certain embodiments. Preferred plasmid vectors are compatible with bacterial, insect, and / or mammalian host cells.
- Such vectors include, for example, PCR-ii, PCR3, and pcDNA3.1 (Invitrogen, San Diego, CA), pBSii (Stratagene, La Jolla, CA), pet15 (Novagen, Madison, Wl), pGEX (Pharmacia Biotech, Piscataway, NJ), pEGFp-n2 (Clontech, Palo Alto, CA), pETI (Bluebacii, Invitrogen), pDSR-alpha (PCT pub. No.
- WO 90/14363 and pFASTBACdual (Gibco-BRL, Grand island, NY) as well as Bluescript ® plasmid derivatives (a high copy number COLel -based phagemid, Stratagene Cloning Systems, La Jolla, CA), PCR cloning plasmids designed for cloning TAQ-amplified PCR products (e.g., TOPOTM TA cloning ® kit, PCR2.1 plasmid derivatives, Invitrogen, Carlsbad, CA). Bacterial vectors may also be used.
- Bluescript ® plasmid derivatives a high copy number COLel -based phagemid, Stratagene Cloning Systems, La Jolla, CA
- PCR cloning plasmids designed for cloning TAQ-amplified PCR products e.g., TOPOTM TA cloning ® kit, PCR2.1 plasmid derivatives, Invitrogen
- vectors include, for example, Shigella, Salmonella, Vibrio cholerae, Lactobacillus, Bacille Calmette Guerin (BCG), and Streptococcus (see for example, WO 88/6626; WO 90/0594; WO 91/13157; WO 92/1796; and WO 92/21376).
- BCG Bacille Calmette Guerin
- Streptococcus see for example, WO 88/6626; WO 90/0594; WO 91/13157; WO 92/1796; and WO 92/21376).
- Other delivery techniques may also suffice including, for example, DNA- ligand complexes, adenovirus-ligand-DNA complexes, direct injection of DNA, CaP0 4 precipitation, gene gun techniques, electroporation, and colloidal dispersion systems.
- Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- the preferred colloidal system is a liposome, which are artificial membrane vesicles useful as delivery vehicles in vitro and in vivo.
- RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (Fraley, R., et al., 1981 , Trends Biochem. Sci., 6: 77).
- the composition of the liposome is usually a combination of phospholipids, particularly high-phase-transition-temperature phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations. Examples of lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
- diacylphosphatidylglycerols where the lipid moiety contains from 14-18 carbon atoms, particularly from 16-18 carbon atoms, and is saturated.
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine and distearoylphosphatidylcholine.
- a cultured cell comprising the vector is also provided.
- the cultured cell may be a cultured cell transfected with the vector or a progeny of the cell, wherein the cell expresses the immunogenic polypeptide.
- Suitable cell lines are known to those of skill in the art and are commercially available, for example, through the American Type Culture Collection (ATCC).
- ATCC American Type Culture Collection
- the transfected cells can be used in a method of producing an immunogenic polypeptide.
- the method comprises culturing a cell comprising the vector under conditions that allow expression of the immunogenic polypeptide, optionally under the control of an expression sequence.
- the immunogenic polypeptide can be isolated from the cell or the culture medium using standard protein purification methods.
- the binding agents described herein may be conjugated to active agents to target and inhibit the function of and /or eliminate cell populations expressing HIV polypeptides and/or harboring HIV (and / or another antigen in the case of binding agents with multiple specificities).
- CD4 + T-cell populations containing replication competent HIV may be targeted and eliminated using binding agent / drug conjugates (e.g., antibody-drug conjugates (ADC)).
- ADC antibody-drug conjugates
- Mono- and/or bi-specific candidate binding agents may be conjugated with one or more types of drugs (e.g., drugs damaging DNA, targeting microtubules).
- the binding agents described herein and/ or derivatives thereof may also be adjoined to and / or conjugated to functional agents for in vitro and / or in vivo use.
- the binding agent may be adjoined to and / or conjugated to functional moieties such as cytotoxic drugs or toxins, and / or active fragments thereof such as diphtheria A chain, exotoxin A chain, ricin A chain, abrin A chain, curcin, crotin, phenomycin, enomycin, among others.
- Suitable functional moieties may also include radiochemicals.
- Binding agents, such as antibodies, may be adjoined to and / or conjugated to the one or more functional agents using standard techniques in the art.
- this disclosure provides binding agents with multiple specificities such that epitopes bound by LN01 (e.g., ITKWLWYIK (SEQ ID NO. 72) but not LASWVKYIQ (SEQ ID NO. 71 ) and/or ITKWIKYIQ (SEQ ID NO. 73)) and at least one other secondary antigen (e.g., a cell surface protein) may be bound by a single binding agent.
- the secondary antigen may be one expressed by cells infected by an infectious agent.
- an exemplary secondary antigen may be HIV Env antigen other than gp41 .
- binding agents may bind the secondary antigen and / or may serve to neutralize the infectious agent as may be determined using the assays described herein.
- Combinations of binding agents such as one or more described herein with another available to those of ordinary skill in the art, are also contemplated herein.
- the combinations may be identified to provide statistically significant differences from results (e.g., neutralization assays) obtained using only one or more of the binding agents and not others.
- combinations exhibit synergistic neutralization of HIV, for example.
- the combination may comprise a first binding agent having the characteristics of LN01 (e.g., such as IgG 1 LN01 ) and/or comprising any one or more of SEQ ID NOS.
- any of the binding agents described herein may be combined with (i.e., as a single composition, and/or used in conjunction with) one or more the antibodies commonly known as 2F5, 4E10 and/or Z13e1 , and/or derivatives thereof, among others.
- the binding agents of such compositions may be different entities such as two or more different monoclonal antibodies or derivatives thereof, or may be found on the same entity such as a bi-functional antibody (a single antibody or derivative thereof comprising multiple binding specificities).
- Such combinations as described herein may also be combined with one or more other agents that may effect immune cell function such as antibodies against CTLA-4, and the like.
- One of ordindary skill in the art would recognize that many such combinations may be suitable for use as descrbed herein.
- HIV binding agents described herein may be used to treat and / or prevent and / or ameliorate the symptoms of infection by HIV.
- HIV isolates are now classified into discrete genetic subtypes.
- HIV-1 is known to comprise at least ten subtypes (A1 , A2, A3, A4, B, C, D, E, F1 , F2, G, H, J and K) (Taylor et al, NEJM, 359(18):1965-1966 (2008)).
- HIV-2 is known to include at least five subtypes (A, B, C, D, and E).
- Subtype B has been associated with the HIV epidemic in homosexual men and intravenous drug users worldwide.
- HIV-1 immunogens laboratory adapted isolates, reagents and mapped epitopes belong to subtype B.
- subtype B In sub-Saharan Africa, India and China, areas where the incidence of new HIV infections is high, HIV-1 subtype B accounts for only a small minority of infections, and subtype HIV-1 C appears to be the most common infecting subtype. Any of these types of isolates may be addressed using the binding agents described herein.
- One or more binding agents may also be administered with or in conjunction with one or more agents used to prevent, treat and / or ameliorate HIV such as for example, a protease inhibitor, an HIV entry inhibitor, a reverse transcriptase inhibitor, and / or an anti- retroviral nucleoside analog.
- Suitable compounds include, for example, Agenerase (amprenavir), Combivir (Retrovir / Epivir), Crixivan (indinavir), Emtriva (emtricitabine), Epivir (3tc / lamivudine), Epzicom, Fortovase / Invirase (saquinavir), Fuzeon (enfuvirtide), Hivid (ddc / zalcitabine), Kaletra (lopinavir), Lexiva (Fosamprenavir), Norvir (ritonavir), Rescriptor (delavirdine), Retrovir / AZT (zidovudine), Reyatax (atazanavir, BMS- 232632), Sustiva (efavirenz), Trizivir (abacavir / zidovudine / lamivudine), Truvada (Emtricitabine / Tenofovir DF), Videx (ddl / didanosine), Videx EC (
- binding agents e.g., antibodies
- antibodies may be utilized to isolate HIV or cells containing HIV and / or expressing HIV antigens using, for example, immunoprecipitation or other capture-type assay.
- This well-known technique is performed by attaching the antibody to a solid support or chromatographic material (e.g., a bead coated with Protein A, Protein G and / or Protein L).
- the bound antibody is then introduced into a solution either containing or believed to contain HIV antigens (e.g., an HIV-infected cell).
- the HIV antigen(s) may then bind to the antibody and non-binding materials are washed away under conditions in which the HIV antigen(s) remains bound to the antibody.
- the bound protein may then be separated from the antibody and analyzed as desired. Similar methods for isolating a protein using an antibody are well-known in the art.
- the binding agents e.g., antibodies
- the antibodies may also be utilized to detect HIV or HIV antigens within a biological sample.
- the antibodies may be used in assays such as, for example, flow cytometric analysis, ELISA, immunoblotting (e.g., western blot), in situ detection, immunocytochemistry, and / or immunhistochemistry. Methods of carrying out such assays are well-known in the art.
- the binding agents may be adjoined to and / or conjugated to one or more detectable labels.
- suitable detectable labels may include, for instance, fluorosceins (e.g., DyLight, Cy3, Cy5, FITC, HiLyte Fluor 555, HiLyte Fluor 647; 5-carboxy-2,7-dichlorofluorescein; 5- Carboxyfluorescein (5-FAM); 5-HAT (Hydroxy Tryptamine); 5-Hydroxy Tryptamine (HAT); 6- JOE; 6-carboxyfluorescein (6-FAM); FITC; 6-carboxy-1 ,4-dichloro-2',7'-dichlorofluorescein (TET); 6-carboxy-1 ,4-dichloro-2',4', 5', 7'-tetrachlorofluorescein (HEX); 6-carboxy-4',5'- dichloro-2', 7'-dime
- the binding agents described herein may be also be used to determine the presence of a disease state in a patient, to predict prognosis, or to determine the effectiveness of a chemotherapeutic or other treatment regimen.
- Expression profile assays performed as described herein or as is otherwise known in the art, may be used to determine the relative level of expression of HIV in a cell, for instance. The level of expression may then be correlated with base (e.g., control) levels to determine whether a particular disease is present within the patient, the patient's prognosis, or whether a particular treatment regimen is effective.
- an increased or decreased level of expression of HIV in the patient's tissues may indicate the regimen is worsening or improving the load of HIV in that host.
- the increase or decrease in expression may indicate the regimen is having or not having the desired effect and another therapeutic modality may therefore be selected.
- the binding agents described herein may be used to ascertain the effect of a drug candidate on the expression of the immunogenic target in a cell line, or a cell or tissue of a patient.
- the expression profiling technique may be combined with high throughput screening techniques to allow rapid identification of useful compounds and monitor the effectiveness of treatment with a drug candidate (see, for example, ZIokarnik, et al., Science 279, 84-8 (1998)).
- Drug candidates may be chemical compounds, nucleic acids, proteins, antibodies, or derivatives therefrom, whether naturally occurring or synthetically derived. Drug candidates thus identified may be utilized, among other uses, as pharmaceutical compositions for administration to patients or for use in further screening assays.
- the binding agents are in purified form.
- a "purified” binding agent e.g., antibody
- a purified binding agent may be one that is separated from at least about 50% of the proteins and / or other components with which it is initially found (e.g., as part of a hybridoma supernatant or ascites preparation in the case of a monoclonal antibody).
- a purified binding agent e.g., antibody
- polypeptides and nucleic acids described herein may also be combined with one or more pharmaceutically acceptable carriers prior to administration to a host.
- a pharmaceutically acceptable carrier is a material that is not biologically or otherwise undesirable, e.g., the material may be administered to a subject, without causing any undesirable biological effects or interacting in a deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.
- the carrier would naturally be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject, as would be well known to one of skill in the art. Suitable pharmaceutical carriers and their formulations are described in, for example, Remington's: The Science and Practice of Pharmacy, 21 st Edition, David B.
- a pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic.
- the pharmaceutically-acceptable carriers include, but are not limited to, sterile water, saline, buffered solutions like Ringer's solution, and dextrose solution. The pH of the solution is generally from about 5 to about 8 or from about 7 to about 7.5.
- Other carriers include sustained-release preparations such as semipermeable matrices of solid hydrophobic polymers containing polypeptides or fragments thereof. Matrices may be in the form of shaped articles, e.g., films, liposomes or microparticles.
- Carriers are those suitable for administration of polypeptides and / or fragments thereof to humans or other subjects.
- Pharmaceutical compositions may also include carriers, thickeners, diluents, buffers, preservatives, surface active agents, adjuvants, immunostimulants, in addition to the immunogenic polypeptide.
- Pharmaceutical compositions may also include one or more active ingredients such as antimicrobial agents, antiinflammatory agents and anesthetics.
- the pharmaceutical composition may be administered orally, parentally, by inhalation spray, rectally, intranodally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles.
- pharmaceutically acceptable carrier or “physiologically acceptable carrier” as used herein refers to one or more formulation materials suitable for accomplishing or enhancing the delivery of a nucleic acid, polypeptide, or peptide as a pharmaceutical composition.
- a “pharmaceutical composition” is a composition comprising a therapeutically effective amount of a nucleic acid or polypeptide.
- effective amount and “therapeutically effective amount” each refer to the amount of a binding agent, nucleic acid or the like used to observe the desired therapeutic effect (e.g., eliminating HIV).
- Methods for treating one or more disease conditions comprising administering to the mammal at least one or more effective doses of one or more binding agents (and / or derivative(s) thereof) described herein are also provided.
- the binding agent is a monoclonal antibody or fragment or derivative thereof comprising one or more of SEQ ID NOS. 1 -32 and / or shown in Table 1.
- the one or more binding agents may be administered in a dosage amount of about 1 to about 50 mg / kg, about 1 to about 30 mg / kg, or about 5 to about 30 mg / kg (e.g., about any of 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, or 40 mg / kg).
- the one or more binding agents may be administered to the mammal (e.g., intradermally, intravenously, orally, rectally) at about 10 mg / kg one or more times. When multiple doses are administered, the doses may comprise about the same or different amount of binding agent in each dose.
- the doses may also be separated in time from one another by the same or different intervals.
- the doses may be separated by about any of 6, 12, 24, 36, 48, 60, 72, 84, or 96 hours, one week, two weeks, three weeks, one month, two months, three months, four months, five months, six months, seven months, eight months, nine months, 10 months, 1 1 months, 12 months, 1.5 years, 2 years, 3 years, 4 years, 5 years, or any time period before, after, and / or between any of these time periods.
- the binding agents may be administered in conjunction with other agents (e.g., anti-infective agents and/or chemotherapeutic agent). Such other agents may be administered about simultaneously with the binding agents, or at a different time and / or frequency. Other embodiments of such methods may also be appropriate as could be readily determined by one of ordinary skill in the art.
- kit format A kit including one or more of such binding agents and optionally other components necessary for using the same to detect cells expressing HIV is also provided.
- the binding agents of the kit may be provided in any suitable form, including frozen, lyophilized, or in a pharmaceutically acceptable buffer such as TBS or PBS.
- the kit may also include other reagents required for utilization of the binding agents in vitro or in vivo such as buffers (e.g., TBS, PBS), blocking agents (solutions including nonfat dry milk, normal sera, Tween-20 Detergent, BSA, or casein), and / or detection reagents (e.g., goat anti-mouse IgG biotin, streptavidin-HRP conjugates, allophycocyanin, B-phycoerythrin, R- phycoerythrin, peroxidase, detectable labels, and other labels and / or staining kits (e.g., ABC Staining Kit, Pierce)).
- buffers e.g., TBS, PBS
- blocking agents solutions including nonfat dry milk, normal sera, Tween-20 Detergent, BSA, or casein
- detection reagents e.g., goat anti-mouse IgG biotin, streptavidin-HRP conjugates, allophy
- kits may also include other reagents and / or instructions for using the antibodies in commonly utilized assays described above such as, for example, flow cytometric analysis, ELISA, immunoblotting (e.g., western blot), in situ detection, immunocytochemistry, immunhistochemistry.
- the kit provides a binding agent in purified form.
- the binding agent may be provided in biotinylated form either alone or along with an avidin-conjugated detection reagent (e.g., antibody).
- the kit includes a binding agents comprising one or more detectable labels that may be used to directly detect HIV.
- kits and the like required for using any of these systems are well-known in the art and / or may be prepared by the end- user or provided as a component of the kit.
- the kit may also include a solid support containing positive- and negative-control protein and / or tissue samples.
- kits for performing spotting or western blot-type assays may include control cell or tissue lysates for use in SDS-PAGE or nylon or other membranes containing pre-fixed control samples with additional space for experimental samples.
- Kits for visualization of HIV in cells on slides may include pre-formatted slides containing control cell or tissue samples with additional space for experimental samples.
- Other embodiments of kits are also contemplated herein as would be understood by those of ordinary skill in the art.
- binding agents such as the LN01 antibody with specificity for HIV.
- the binding agent is a polypeptide comprising at least one amino acid sequence selected from the group consisting of SEQ ID NOS. 1 -32 and / or shown in Table 1.
- the binding agent is a polypeptide comprising one or more combinations of SEQ ID NOS. 1 -32.
- the binding agent is an antibody.
- the binding agent is a polypeptide such as an antibody comprising a heavy chain CDR amino acid sequence selected from the group consisting of SEQ ID NOS. 1 -3.
- the binding agent is a polypeptide such as an antibody comprising a light chain CDR amino acid sequence selected from the group consisting of SEQ ID NOS. 4-7.
- the binding agent is a polypeptide such as an antibody comprising a V H amino acid sequence of SEQ ID NO. 7 (LN01 ), SEQ ID NO. 9 (LN01 variant 7), SEQ ID NO. 1 1 (LN01 variant 8), SEQ ID NO. 13 (LN01 variant 38), SEQ ID NO. 15 (LN01 variant 41 ), SEQ ID NO. 17 (LN01 variant 42), SEQ ID NO. 19 (LN01 variant 48), SEQ ID NO. 21 (LN01 variant 49), or SEQ ID NO.
- the binding agent is a polypeptide such as an antibody comprising a V L amino acid sequence of SEQ ID NO. 8 (LN01 ), SEQ ID NO. 10 (LN01 variant 7), SEQ ID NO. 12 (LN01 variant 8), SEQ ID NO. 14 (LN01 variant 38), SEQ ID NO. 16 (LN01 variant 41 ), SEQ ID NO. 18 (LN01 variant 42), SEQ ID NO. 20 (LN01 variant 48), SEQ ID NO. 22 (LN01 variant 49), or SEQ ID NO. 28 (LN01 variant 24).
- the binding agent comprises the combinations of CDRs (SEQ ID NOS.
- variable regions SEQ ID NOS. 7 and 8; SEQ NOS. 9 and 10; SEQ NOS. 1 1 and 12; SEQ NOS. 13 and 14; SEQ NOS. 15 and 16; SEQ NOS. 17 and 18; SEQ NOS. 19 and 20; SEQ NOS. 21 and 22; or, SEQ ID NOS. 23 and 24; or a conservatively substituted variant thereof
- Table 1 SEQ ID NOS. 7 and 8; SEQ NOS. 9 and 10; SEQ NOS. 1 1 and 12; SEQ NOS. 13 and 14; SEQ NOS. 15 and 16; SEQ NOS. 17 and 18; SEQ NOS. 19 and 20; SEQ NOS. 21 and 22; or, SEQ ID NOS. 23 and 24; or a conservatively substituted variant thereof
- the binding agents have specificity for an epitope comprising amino acid residues L679, W680 and K683 of SEQ ID NO. 68 and/or amino acid residues L168, W169 and K172 of SEQ ID NO. 69.
- the binding agent exhibits the capacity to bind to and/or neutralize HIV expressing amino acid sequence ITKWLWYIK (SEQ ID NO. 66).
- the binding agent exhibits the capacity to bind to and/or neutralize HIV expressing amino acid sequence ITKWLWYIK (SEQ ID NO. 66) but not LASWVKYIQ (SEQ ID NO. 65) and/or ITKWIKYIQ (SEQ ID NO. 67).
- a binding agent of this disclosure may comprise any one or more of these binding specificities along with the neutralization characteristics described above (i.e., neutralization of HIV-1 pseudoviruses BJOX (CRF07_BC), CE1 176, TRO.1 1 (B), X1632 (G), CM 19 (CRF07_BC), CNE55 (CRF01_AE), 25710 (C), CD0217(C) but not of the control virus SVA-MLV at a concentration is from 10 2 -10° ug/ml, or between 10°-10 1 ug/ml, to at least about 50%, and/or the ability to the neutralize a majority of the 1 18 HIV-1 pseudoviruses listed in Figure 4 at an IC 50 of less than 25).
- nucleic acids encoding such binding agents are also provided as in Table 4.
- the binding agent is derived from or related to (e.g., by sequence or derivation) a human antibody, human IgG, human lgG1 , human lgG2, human lgG2a, human lgG2b, human lgG3, human lgG4, human IgM, human IgA, human lgA1 , human lgA2, human IgD, human IgE, canine antibody, canine IgGA, canine IgGB, canine IgGC, canine IgGD, chicken antibody, chicken IgA, chicken IgD, chicken IgE, chicken IgG, chicken IgM, chicken IgY, goat antibody, goat IgG, mouse antibody, mouse IgG, pig antibody, and / or rat antibody, and / or a derivative thereof.
- a human antibody human IgG, human lgG1 , human lgG2, human lgG2a, human lgG2b, human lgG3,
- the derivative may be selected from the group consisting of an F a b, F a b2, Fab' single chain antibody, F v , single chain, mono-specific antibody, bispecific antibody, trimeric antibody, multi-specific antibody, multivalent antibody, chimeric antibody, canine-human chimeric antibody, canine-mouse chimeric antibody, antibody comprising a canine Fc, humanized antibody, human antibody, caninized antibody, CDR-grafted antibody, shark antibody, nanobody, and / or canelid antibody.
- the binding agent comprises at least a least a first and second specificity, the first being against HIV gp41 and the second being against a different antigen (e.g., an antigen of an infectious agent such as HIV (e.g., env) and / or a tumor antigen).
- a different antigen e.g., an antigen of an infectious agent such as HIV (e.g., env) and / or a tumor antigen.
- the binding agent and / or derivative thereof may comprise a detectable label fixably attached thereto.
- the binding agent of any one and / or derivative thereof comprises an effector moiety (e.g., a cytotoxic drug, toxin, diphtheria A chain, exotoxin A chain, ricin A chain, abrin A chain, curcin, crotin, phenomycin, enomycin, and radiochemical) fixably attached thereto.
- an effector moiety e.g., a cytotoxic drug, toxin, diphtheria A chain, exotoxin A chain, ricin A chain, abrin A chain, curcin, crotin, phenomycin, enomycin, and radiochemical fixably attached thereto.
- polynucleotides encoding one or more binding agents are also provided (e.g., as an expression vector). Host cells comprising and / or expressing the polypeptide products of such polynucleotides are also provided.
- compositions comprising at least one binding agent or derivative; at least one isolated polynucleotide; at least one expression vector; and / or, at least one host cell; or a combination thereof; and, a pharmaceutically acceptable carrier are also provided.
- This disclosure also provides methods for detecting HIV on a cell, the method comprising contacting a test biological sample with a binding agent or derivative described herein and detecting the binding agent bound to the biological sample or components thereof.
- Such methods may be an in vivo method or an in vitro method.
- the method may comprise comparing the amount of binding to the test biological sample or components thereof to the amount of binding to a control biological sample or components thereof, wherein increased binding to the test biological sample or components thereof relative to the control biological sample or components thereof indicates the presence of a cell expressing HIV polypeptides in the test biological sample (e.g., mammalian blood).
- a kit for detecting the expression of HIV in or on a cell comprising a binding agent or derivative thereof and instructions for use.
- the binding agent and / or derivative thereof is in lyophilized form.
- this disclosure provides methods for treating, preventing and / or ameliorating an infectious disease, cancer and / or autoimmunity in a mammal comprising administering to the mammal at least one effective dose of a pharmaceutical composition comprising a binding agent or derivative thereof.
- the infectious disease is human immunodeficiency virus (HIV).
- multiple doses are administered to the animal.
- the binding agent and / or derivative thereof may be administered in a dosage amount of about 1 to 50 mg / kg.
- a subject or a host is meant to be an individual.
- the subject can include domesticated animals, such as cats and dogs, livestock (e.g., cattle, horses, pigs, sheep, and goats), laboratory animals (e.g., mice, rabbits, rats, guinea pigs) and birds.
- livestock e.g., cattle, horses, pigs, sheep, and goats
- laboratory animals e.g., mice, rabbits, rats, guinea pigs
- the subject is a mammal such as a primate or a human.
- Optional or optionally means that the subsequently described event or circumstance can or cannot occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.
- the phrase optionally the composition can comprise a combination means that the composition may comprise a combination of different molecules or may not include a combination such that the description includes both the combination and the absence of the combination (i.e., individual members of the combination).
- Ranges may be expressed herein as from about one particular value, and/or to about another particular value. When such a range is expressed, another aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent about or approximately, it will be understood that the particular value forms another aspect.
- combined or “in combination” or “in conjunction” may refer to a physical combination of agents that are administered together or the use of two or more agents in a regimen (e.g., administered separately, physically and / or in time) for treating, preventing and / or ameliorating a particular disease.
- treat, prevent, and / or ameliorate or derivatives thereof are used herein in connection with a given treatment for a given condition (e.g., preventing cancer infection by HIV), it is meant to convey that the treated patient either does not develop a clinically observable level of the condition at all, or develops it more slowly and/or to a lesser degree than he/she would have absent the treatment.
- a given treatment for a given condition e.g., preventing cancer infection by HIV
- a treatment will be said to have prevented the condition if it is given during exposure of a patient to a stimulus that would have been expected to produce a given manifestation of the condition, and results in the patient's experiencing fewer and/or milder symptoms of the condition than otherwise expected.
- a treatment can "prevent" infection by resulting in the patient's displaying only mild overt symptoms of the infection; it does not imply that there must have been no penetration of any cell by the infecting microorganism.
- reduce, reducing, and reduction as used herein in connection with prevention, treatment and / or amelioration of a given condition by a particular treatment typically refers to a subject developing an infection more slowly or to a lesser degree as compared to a control or basal level of developing an infection in the absence of a treatment (e.g., administration of one or more HIV binding agents).
- a reduction in the risk of infection may result in the patient's displaying only mild overt symptoms of the infection or delayed symptoms of infection; it does not imply that there must have been no penetration of any cell by the infecting microorganism.
- Germinal center and Memory IgG B cells from donor SA003 were sorted separately according to IgG (i.e. IgA and IgM negative cells), CD19 and CD38 expression (germinal center B cells are CD38 positive) ( Figure 2) and interrogated for the production of HIV-1 neutralizing antibodies.
- IgG memory B cells and IgG germinal cells were seeded in separate plates as single cell micro-cultures on human feeder cells in the presence of Epstein-Barr Virus (EBV) (which also stimulate polyclonally memory B cells) and a cocktail composed TLR9 agonist CpG-2006, IL-2 (1000 lU/ml), IL-6 (10 ng/ml), IL-21 (10 ng/ml), and anti-BCR goat antibodies (BCR triggerring).
- EBV Epstein-Barr Virus
- IL-2 1000 lU/ml
- IL-6 10 ng/ml
- IL-21 10 ng/ml
- BCR triggerring anti-BCR goat antibodies
- TZM-bl cells Neutralization assays were undertaken on TZM-bl cells.
- HIV-1 pseudoviruses that resulted in an output of 50-100 x 10 4 relative light units (RLU) were incubated with B cell culture supernatants for 1 h at 37% (5% C02) before the addition of 3000 TZM-bl cells. These were incubated for a further 72 h, after which supernatant was removed and 15 ⁇ Steadylite reagent (Perkin Elmer) was added. Luciferase activity was detected 5 min later by reading the plates on a Synergy microplate luminometer (BioTek).
- the supernatants derived from two cultures of germinal center B cells were found able to cross-neutralize both CE1 176 and BJOX2000 strains.
- the supernatants from these two cultures were further harvested and tested for their ability to neutralize four (4) pseudoviruses (CE1 176, BJOX2000, X1632 and 25710).
- pseudoviruses CE1 176, BJOX2000, X1632 and 25710
- one of the two supernatants neutralized all four pseudoviruses.
- the antibody derived from the neutralizing culture was characterized by determining the amino acid and nucleotide sequences of its variable regions (Tables 1 and 5) and the complementarity determining regions (CDRs) therein and termed "LN01 ".
- the binding agent termed "LN01” is an lgG3-type fully human monoclonal antibody having the CDR, VH and VL sequences as shown above in Tables 1 and 2.
- This antibody was derived from IGHV4-39 * 07 and IGKV1 -39 * 01 germline genes, and was highly somatically mutated in variable genes of both heavy chain (28%) and kappa light chain (27%) compared to germ line.
- the LN01 antibody also possessed a long heavy-chain complementarity-determining 3 region (CDR H3) loop composed of 20 amino acids.
- the LN01 VH and VL genes were cloned into lgG1 expression vectors, and the recombinant IgG 1 LN01 antibody was produced by transfecting Expi293F cells. The full-length lgG1 LN01 antibody was then purified using a recombinant protein-A column (GE-Healthcare).
- IgG 1 LN01 antibody was then tested against the Global Panel of nine (9) HIV-1 reference pseudoviruses on TZM-bl cells. Strikingly, IgG 1 LN01 antibody neutralized eight (8) out of nine (9) HIV-1 pseudoviruses with IC50 values ranging from 0.03 to 1 .6 ⁇ g/ml ( Figure 3) and did not neutralize the negative control MLV pseudovirus.
- IgG 1 LN01 antibody was subsequently tested on an extended panel of 1 18 HIV-1 pseudoviruses including clade A, clade B, clade C, clade D, clade G, circulating recombinant forms CRF10_CD, CRF01_AE, CRF02_AG and CRF07_BC and non-circulating recombinants AC and ACD strains.
- IgG 1 LN01 antibody broadly neutralized 109 viruses out of 1 18 with IC50 below 25 Mg/ml, i.e. the 92% of the tested viruses, with a median IC50 of 1 .1 ⁇ / ⁇ ( Figures 4 and 5). The analysis of the viruses neutralized indicated that LN01 neutralizing activity is not clade-dependent.
- lgG1 LN01 antibody was tested against the Global Panel of nine (9) HIV-1 reference pseudoviruses on parental TZM-bl cells and TZM-bl cells expressing Fc-gamma receptor I (CD64) (Perez, L. G., Costa, M. R., Todd, C. A., Haynes, B. F. & Montefiori, D. C. Utilization of immunoglobulin G Fc receptors by human immunodeficiency virus type 1 : a specific role for antibodies against the membrane-proximal external region of gp41 . J Virol 83, 7397-7410 (2009)).
- Fc-gamma receptors are rarely expressed on CD4+ lymphocytes, several additional HIV-1 -susceptible cell types express multiple Fc- gamma receptors and are involved in sexual transmission and the early establishment of long-lived viral reservoirs.
- macrophages are among the first infection- susceptible cells that the virus encounters after mucosal exposure, and they are thought to serve as a long-lived virus reservoir in chronic infection.
- Macrophages are well known to express multiple Fc-gamma receptors as well as certain subsets of monocytes and dendritic cells. It is also important to mention that Fc-gamma receptors play a role in regulating adaptive immunity and peripheral tolerance, by facilitating antigen uptake, antigen presentation, cell activation and B cell tolerance.
- IgG 1 LN01 antibody In order to better define the specificity of IgG 1 LN01 antibody we used a panel of HIV- 2/HIV-1 chimeric pseudoviruses containing various segments of the HIV-1 MPER into the parental HIV-2/7312A. IgGI LN01 antibody did not neutralize the parental HIV-2 7312A strain. Of note, IgGI LN01 antibody was found to potently neutralize the chimeric virus 7312A.C4 in which only 6 residues from HIV-1 were replaced in the HIV-2 MPER region (LASWVKYIQ (SEQ ID NO. 65) was replaced into ITKWLWYIK (SEQ ID NO.
- LN01 In order to better define the specificity of LN01 we used a peptide microarray formed by 1423 15-mer peptides, overlapping by 12 amino acids, that cover the full length of the consensus HIV-1 Env gp160 sequences for clades A, B, C, D, group M, CRF01_AE and CRF02_AG.
- the peptides were printed onto 3D-Epoxy glass slides and were analyzed with a GenePix 4000B scanner (Tomaras, G. D. et al. Polyclonal B cell responses to conserved neutralization epitopes in a subset of HIV-1 -infected individuals. J Virol 85, 1 1502-1 1519 (201 1 )).
- LN01 was tested at 20 ⁇ g/ml in parallel with a control antibody called 7B2 (that is specific for the immunodominant region of gp41 ) for binding to the peptide microarray.
- 7B2 that is specific for the immunodominant region of gp41
- the binding of LN01 and 7B2 was detected by incubation with DyLight 649-labeled goat anti- human IgG. Fluorescence intensity was measured using a GenePix 4000B scanner and was analyzed with GenePix software ( Figure 8).
- IgGI LN01 antibody did not clearly react with any of the peptides in this library, while 7B2 strongly reacted with 190-195 peptides that spanned the gp41 immunodominant region.
- IgGI LN01 antibody was also tested for binding to soluble, cleaved SOSIP.664 gp140 trimers based on the subtype A transmitted/founder strain, BG505. These trimers are highly stable, homogenous and closely resemble native virus spikes when visualized by negative stain electron microscopy (EM) (Sanders, R. W. et al. A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies. PLoS Pathog. 9, e1003618 (2013)).
- EM negative stain electron microscopy
- lgG1 LN01 antibody in parallel with MPER-specific 10E8 antibody (Huang, J. et al. Broad and potent neutralization of HIV-1 by a gp41 -specific human antibody. Nature 491 , 406-412 (2012)), was also tested by ELISA against a panel of HIV-1 antigens (ConsB, consensus clade B gp140, 426c, clade C gp140, 426c-NLGS, 426c gp140 where the elinked glycosylation sites were removed, 426c core, gp140 where the V loops were removed, UG37 gp140, clade A and gp41 , recombinant ecto-domain of gp41 , amino acids 541 -682 from HxB2 strain, Vybion).
- ConsB consensus clade B gp140, 426c, clade C gp140, 426c-NLGS, 426c gp140 where the e
- IgG 1 LN01 antibody was tested against a fusion intermediate gp41 and uncoated plates (PBS), called gp41 int (Lai, R. P. J. et al. A fusion intermediate gp41 immunogen elicits neutralizing antibodies to HIV-1 . J Biol Chem 289, 29912-29926 (2014)).
- the gp41 int antigen is recognized with high affinity by MPER antibodies 4E10, 2F5 and 10E8. While 10E8 reacted to gp41 int by ELISA, lgG1 LN01 antibody did not react ( Figure 11 ).
- LN01 lack of high affinity binding to a MPE peptide
- LN01 variant 7 showed 39-fold increase in potency as compared to the parental LN01 antibody. These results were confirmed when LN01 variants 7, 8 and 38 were tested in parallel with the parental LN01 antibody against a multiclade panel of 8 viruses ( Figures 14A-K). In this second test the increased potency observed for LN01 variants 7, 8 and 38 was on average 47, 2.3 and 2.7 fold, respectively.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Communicable Diseases (AREA)
- Tropical Medicine & Parasitology (AREA)
- AIDS & HIV (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP16819370.4A EP3383902A1 (en) | 2015-12-05 | 2016-12-05 | Hiv binding agents |
| JP2018548300A JP2019509046A (ja) | 2015-12-05 | 2016-12-05 | Hiv結合剤 |
| US15/780,821 US10730933B2 (en) | 2015-12-05 | 2016-12-05 | HIV binding agents |
| CN201680080738.0A CN108779168A (zh) | 2015-12-05 | 2016-12-05 | Hiv结合剂 |
| CA3045756A CA3045756A1 (en) | 2015-12-05 | 2016-12-05 | Hiv binding agents |
| US16/912,886 US20210009661A1 (en) | 2015-12-05 | 2020-06-26 | HIV Binding Agents |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562263618P | 2015-12-05 | 2015-12-05 | |
| US62/263,618 | 2015-12-05 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/780,821 A-371-Of-International US10730933B2 (en) | 2015-12-05 | 2016-12-05 | HIV binding agents |
| US16/912,886 Continuation US20210009661A1 (en) | 2015-12-05 | 2020-06-26 | HIV Binding Agents |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017093985A1 true WO2017093985A1 (en) | 2017-06-08 |
| WO2017093985A4 WO2017093985A4 (en) | 2017-07-27 |
Family
ID=57629603
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2016/057367 Ceased WO2017093985A1 (en) | 2015-12-05 | 2016-12-05 | Hiv binding agents |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US10730933B2 (https=) |
| EP (1) | EP3383902A1 (https=) |
| JP (1) | JP2019509046A (https=) |
| CN (1) | CN108779168A (https=) |
| CA (1) | CA3045756A1 (https=) |
| WO (1) | WO2017093985A1 (https=) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020012435A1 (en) * | 2018-07-13 | 2020-01-16 | Lausanne University Hospital | Hiv binding agents |
| WO2020082045A1 (en) * | 2018-10-19 | 2020-04-23 | University Of Maryland, College Park | Multispecfic anti-hiv antibodies |
| US10730933B2 (en) | 2015-12-05 | 2020-08-04 | Centre Hospitalier Universitaire Vaudois | HIV binding agents |
| WO2021009697A3 (en) * | 2019-07-15 | 2021-04-15 | Lausanne University Hospital | Hiv binding agents |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115963260B (zh) * | 2022-06-27 | 2025-05-23 | 珠海碳云晶芯智能科技有限公司 | 多肽芯片及其在艾滋病诊断产品制备中的应用 |
Citations (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1988006626A1 (en) | 1987-03-02 | 1988-09-07 | Whitehead Institute For Biomedical Research | Recombinant mycobacterial vaccine |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| WO1990000594A2 (en) | 1988-07-07 | 1990-01-25 | Whitehead Institute For Biomedical Research | Recombinant mycobacterial expression vehicles and uses therefor |
| DE3932461A1 (de) | 1988-09-30 | 1990-04-05 | Olympus Optical Co | Monoklonaler antikoerper gegen ein synthetisches peptid und verfahren zu dessen herstellung |
| WO1990014363A1 (en) | 1989-05-19 | 1990-11-29 | Amgen Inc. | Metalloproteinase inhibitor |
| WO1991013157A1 (en) | 1990-02-26 | 1991-09-05 | Commonwealth Scientific And Industrial Research Organisation | Shuttle plasmid for escherichia coli and mycobacteria |
| WO1992001796A1 (en) | 1990-07-19 | 1992-02-06 | Smithkline Beecham Biologicals (S.A.) | Mycobacterial expression vector |
| US5087557A (en) | 1986-06-23 | 1992-02-11 | Genetic Systems Corporation | Human monoclonal antibody to lymphadenopathy-associated virus |
| WO1992021376A1 (en) | 1991-06-06 | 1992-12-10 | Med Immune, Inc. | Induction of ctl responses to foreign antigens expressed in mycobacteria |
| US5298419A (en) | 1988-03-31 | 1994-03-29 | The Arizona Board Of Regents On Behalf Of The University Of Arizona | Human hybridomas and monoclonal antibodies which bind both gp41 and gp120 envelope proteins of human immunodeficiency virus |
| EP0335134B1 (en) | 1988-03-30 | 1995-03-01 | Abbott Laboratories | Mouse monoclonal antibody to human immunodeficiency virus gp41 protein |
| US5459060A (en) | 1989-08-24 | 1995-10-17 | Bioclonetics Incorporated | Human monoclonal antibodies directed against the transmembrane glycoprotein (gp41) of human immunodeficiency virus-1 (HIV-1) |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5693752A (en) | 1992-05-14 | 1997-12-02 | Hermann Katinger | Peptides that induce antibodies which neutralize genetically divergent HIV-1 isolates |
| US5731189A (en) | 1989-02-28 | 1998-03-24 | New York University | Human monoclonal antibodies to human immunodeficiency virus |
| US5753503A (en) | 1987-11-13 | 1998-05-19 | Hermann W. D. Katinger | Human monoclonal anti-HIV-I-antibodies |
| US5804440A (en) | 1992-09-30 | 1998-09-08 | The Scripps Research Institute | Human neutralizing monoclonal antibodies to human immunodeficiency virus |
| US5831034A (en) | 1987-11-13 | 1998-11-03 | Hermann Katinger | Human monoclonal anti-HIV-I-antibodies |
| US6008044A (en) | 1989-08-24 | 1999-12-28 | Bioclonetics | Human monoclonal antibodies directed against the transmembrane glycoprotein (gp41) of human immunodeficiency virus-1 (HIV-1) and detection of antibodies against epitope (GCSGKLIC) |
| WO2001024810A1 (en) * | 1999-10-05 | 2001-04-12 | Epimmune Inc. | Inducing cellular immune responses to human immunodeficiency virus-1 using peptide and nucleic acid compositions |
| WO2002032452A1 (en) | 2000-08-18 | 2002-04-25 | Tsinghua University | Composition for aids and method producing it |
| US20030118985A1 (en) | 1997-05-14 | 2003-06-26 | Hunt Jeffrey C. | Mouse monoclonal antibody (5-21-3) to human immunodeficiency virus gp41 protein |
| US20070292390A1 (en) | 2004-10-29 | 2007-12-20 | Dimitrov Dimiter S | Broadly Cross-Reactive Hiv-1 Neutralizing Human Monoclonal Antibodies |
| US7774887B2 (en) | 2003-10-28 | 2010-08-17 | Applied Materials, Inc. | Scrubber box and methods for using the same |
| WO2011046623A2 (en) * | 2009-10-16 | 2011-04-21 | Duke University | Hiv-1 antibodies |
| WO2013070776A1 (en) * | 2011-11-07 | 2013-05-16 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Neutralizing gp41 antibodies and their use |
| US20140205612A1 (en) | 2010-08-31 | 2014-07-24 | Theraclone Sciences, Inc. | Human immunodeficiency virus (hiv)-neutralizing antibodies |
Family Cites Families (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| DK169582B1 (da) | 1986-06-23 | 1994-12-12 | Squibb Bristol Myers Co | Humant monoklonalt antistof, der er i stand til at reagere med en epitop på LAV/HTLV-III kappeglycoproteinet gp41, cellelinier, som producerer sådant antistof, farmaceutisk præparat indeholdende antistoffet samt fremgangsmåde til bestemmelse af nærværelsen af LAV/HTLV-III i en biologisk prøve og fremgangsmåde til separering af specifikke antigendeterminanter af LAV/HTLV-III under anvendelse af ant |
| EP0418347A4 (en) | 1989-02-28 | 1994-12-14 | Univ New York | Human monoclonal antibodies to human immunodeficiency virus |
| JPH05506142A (ja) | 1990-01-16 | 1993-09-16 | レプリゲン・コーポレーション | Hiv蛋白質の非免疫支配エピトープに特異的なモノクローナル抗体 |
| US6057421A (en) | 1994-11-30 | 2000-05-02 | Immpheron, Inc. | Variable heavy and light chain regions of murine monoclonal antibody 1F7 |
| AU2308595A (en) | 1995-04-19 | 1996-11-07 | Polymun Scientific Immunobiologische Forschung Gmbh | Monoclonal antibodies against hiv-1 and vaccines made thereo f |
| JP2001502315A (ja) * | 1996-10-10 | 2001-02-20 | プローブ・インターナショナル | ウイルス感染を処置するための組成物および方法 |
| JPH10226699A (ja) * | 1996-12-10 | 1998-08-25 | Fujirebio Inc | Hiv−1グループoを認識するモノクローナル抗体及び該モノクローナル抗体を産生するハイブリドーマ |
| EP1765398B1 (en) | 2004-06-01 | 2011-07-13 | Merck Sharp & Dohme Corp. | Human antibodies interacting with hiv gp41 |
| US20120102582A1 (en) * | 2009-04-03 | 2012-04-26 | Haynes Barton F | Mouse models |
| WO2015103549A1 (en) | 2014-01-03 | 2015-07-09 | The United States Of America, As Represented By The Secretary Department Of Health And Human Services | Neutralizing antibodies to hiv-1 env and their use |
| CA3045756A1 (en) | 2015-12-05 | 2017-06-08 | Centre Hospitalier Universitaire Vaudois | Hiv binding agents |
-
2016
- 2016-12-05 CA CA3045756A patent/CA3045756A1/en not_active Abandoned
- 2016-12-05 US US15/780,821 patent/US10730933B2/en not_active Expired - Fee Related
- 2016-12-05 WO PCT/IB2016/057367 patent/WO2017093985A1/en not_active Ceased
- 2016-12-05 CN CN201680080738.0A patent/CN108779168A/zh active Pending
- 2016-12-05 EP EP16819370.4A patent/EP3383902A1/en not_active Withdrawn
- 2016-12-05 JP JP2018548300A patent/JP2019509046A/ja active Pending
-
2020
- 2020-06-26 US US16/912,886 patent/US20210009661A1/en not_active Abandoned
Patent Citations (34)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5087557A (en) | 1986-06-23 | 1992-02-11 | Genetic Systems Corporation | Human monoclonal antibody to lymphadenopathy-associated virus |
| WO1988006626A1 (en) | 1987-03-02 | 1988-09-07 | Whitehead Institute For Biomedical Research | Recombinant mycobacterial vaccine |
| US5753503A (en) | 1987-11-13 | 1998-05-19 | Hermann W. D. Katinger | Human monoclonal anti-HIV-I-antibodies |
| US5831034A (en) | 1987-11-13 | 1998-11-03 | Hermann Katinger | Human monoclonal anti-HIV-I-antibodies |
| EP0335134B1 (en) | 1988-03-30 | 1995-03-01 | Abbott Laboratories | Mouse monoclonal antibody to human immunodeficiency virus gp41 protein |
| US5298419A (en) | 1988-03-31 | 1994-03-29 | The Arizona Board Of Regents On Behalf Of The University Of Arizona | Human hybridomas and monoclonal antibodies which bind both gp41 and gp120 envelope proteins of human immunodeficiency virus |
| WO1990000594A2 (en) | 1988-07-07 | 1990-01-25 | Whitehead Institute For Biomedical Research | Recombinant mycobacterial expression vehicles and uses therefor |
| DE3932461A1 (de) | 1988-09-30 | 1990-04-05 | Olympus Optical Co | Monoklonaler antikoerper gegen ein synthetisches peptid und verfahren zu dessen herstellung |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5731189A (en) | 1989-02-28 | 1998-03-24 | New York University | Human monoclonal antibodies to human immunodeficiency virus |
| WO1990014363A1 (en) | 1989-05-19 | 1990-11-29 | Amgen Inc. | Metalloproteinase inhibitor |
| US5459060A (en) | 1989-08-24 | 1995-10-17 | Bioclonetics Incorporated | Human monoclonal antibodies directed against the transmembrane glycoprotein (gp41) of human immunodeficiency virus-1 (HIV-1) |
| US6008044A (en) | 1989-08-24 | 1999-12-28 | Bioclonetics | Human monoclonal antibodies directed against the transmembrane glycoprotein (gp41) of human immunodeficiency virus-1 (HIV-1) and detection of antibodies against epitope (GCSGKLIC) |
| WO1991013157A1 (en) | 1990-02-26 | 1991-09-05 | Commonwealth Scientific And Industrial Research Organisation | Shuttle plasmid for escherichia coli and mycobacteria |
| WO1992001796A1 (en) | 1990-07-19 | 1992-02-06 | Smithkline Beecham Biologicals (S.A.) | Mycobacterial expression vector |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5777074A (en) | 1990-12-26 | 1998-07-07 | Bioclonetics Incorporated | Human monoclonal antibodies directed against the transmembrane glycoprotein (GP41) of human immunodeficiency virus-1 (HIV-1) |
| WO1992021376A1 (en) | 1991-06-06 | 1992-12-10 | Med Immune, Inc. | Induction of ctl responses to foreign antigens expressed in mycobacteria |
| US5756674A (en) | 1992-05-14 | 1998-05-26 | Herman Katinger | Peptides that induce antibodies which neutralize genetically divergent HIV-1 isolates |
| US5693752A (en) | 1992-05-14 | 1997-12-02 | Hermann Katinger | Peptides that induce antibodies which neutralize genetically divergent HIV-1 isolates |
| US5804440A (en) | 1992-09-30 | 1998-09-08 | The Scripps Research Institute | Human neutralizing monoclonal antibodies to human immunodeficiency virus |
| US20030118985A1 (en) | 1997-05-14 | 2003-06-26 | Hunt Jeffrey C. | Mouse monoclonal antibody (5-21-3) to human immunodeficiency virus gp41 protein |
| WO2001024810A1 (en) * | 1999-10-05 | 2001-04-12 | Epimmune Inc. | Inducing cellular immune responses to human immunodeficiency virus-1 using peptide and nucleic acid compositions |
| WO2002032452A1 (en) | 2000-08-18 | 2002-04-25 | Tsinghua University | Composition for aids and method producing it |
| US7774887B2 (en) | 2003-10-28 | 2010-08-17 | Applied Materials, Inc. | Scrubber box and methods for using the same |
| US20070292390A1 (en) | 2004-10-29 | 2007-12-20 | Dimitrov Dimiter S | Broadly Cross-Reactive Hiv-1 Neutralizing Human Monoclonal Antibodies |
| WO2011046623A2 (en) * | 2009-10-16 | 2011-04-21 | Duke University | Hiv-1 antibodies |
| US20140205612A1 (en) | 2010-08-31 | 2014-07-24 | Theraclone Sciences, Inc. | Human immunodeficiency virus (hiv)-neutralizing antibodies |
| WO2013070776A1 (en) * | 2011-11-07 | 2013-05-16 | The United States Of America, As Represented By The Secretary, Department Of Health & Human Services | Neutralizing gp41 antibodies and their use |
Non-Patent Citations (77)
| Title |
|---|
| AMARA ET AL., SCIENCE, vol. 292, 2001, pages 69 - 74 |
| BOERNER ET AL., J. IMMUNOL., vol. 147, no. 1, 1991, pages 86 - 95 |
| CALEY ET AL., VACCINE, vol. 17, 1999, pages 3124 - 2135 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77 |
| D. GOEDDEL,: "Gene Expression Technology", vol. 185, 1991, ACADEMIC PRESS |
| DARJI ET AL., CELL, vol. 91, 1997, pages 765 - 775 |
| DAVID B. TROY, E: "Remington's: The Science and Practice of Pharmacy, 21st Edition,", 2005, LIPPICOTT WILLIAMS & WILKINS |
| DECAMP, A. ET AL.: "Global panel of HIV-1 Env reference strains for standardized assessments of vaccine-elicited neutralizing antibodies", J VIROL, vol. 88, 2014, pages 2489 - 2507 |
| DUBENSKY ET AL., MOL. MED, vol. 6, 2000, pages 723 - 732 |
| EARL ET AL., J. VIROL., vol. 71, no. 4, 1997, pages 2674 - 2684 |
| EBERSBACH ET AL., J. MOL. BIOL., vol. 372, no. 1, 2007, pages 172 - 85 |
| ECKERT ET AL., PNAS USA, vol. 98, no. 20, 2001, pages 11187 - 11192 |
| EDMONDS ET AL., VIROLOGY, vol. 408, no. 1, 2010, pages 1 - 13 |
| EVANS ET AL., J. IMMUNOL., vol. 140, no. 3, 1988, pages 941 - 3 |
| FISHWILD ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 51 |
| FRALEY, R. ET AL., TRENDS BIOCHEM. SCI., vol. 6, 1981, pages 77 |
| GORNEY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 1624 - 28 |
| GRABULOVSKI ET AL., J. BIOL. CHEM., vol. 282, no. 5, 2007, pages 3196 - 3204 |
| HANKE ET AL., VACCINE, vol. 16, 1998, pages 439 - 445 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HARLOW ET AL.: "Using Antibodies: A Laboratory Manual, Portable Protocol No. 1", 1998 |
| HOOGENBOOM ET AL., J. MOL. BIOL., vol. 227, 1991, pages 381 |
| HUANG ET AL., J. VIROL, vol. 75, 2001, pages 4947 - 4951 |
| HUANG ET AL., NATURE, 2012 |
| HUANG, J. ET AL.: "Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.", NATURE, vol. 491, 2012, pages 406 - 412, XP055134187, DOI: doi:10.1038/nature11544 |
| INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| IWASAKI ET AL., J. IMMUNOL., vol. 158, 1997, pages 4591 - 3201 |
| JIANG ET AL., J. VIROL., vol. 72, no. 12, 1998, pages 10213 - 17 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| KIM ET AL., EUR. J. IMMUNOL., vol. 28, 1998, pages 1089 - 1103 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOIDE ET AL., METHODS MOL. BIOL., vol. 352, 2007, pages 95 - 109 |
| KREHENBRINK ET AL., J. MOL. BIOL., vol. 383, no. 5, 2008, pages 1058 - 68 |
| LAI, R. P. J. ET AL.: "A fusion intermediate gp41 immunogen elicits neutralizing antibodies to HIV-1", J BIOL CHEM, vol. 289, 2014, pages 29912 - 29926 |
| LAI, R. P. J. ET AL.: "A fusion intermediate gp41 immunogen elicits neutralizing antibodies to HIV-1.", J BIOL CHEM, vol. 289, 2014, pages 29912 - 29926 |
| LEITNER ET AL., CANCER RES., vol. 60, 2000, pages 51 - 55 |
| LEWIN, B.: "Genes V", 1994, OXFORD UNIVERSITY PRESS |
| LIU ET AL., MOL. THER., vol. 1, 2000, pages 497 - 500 |
| LONBERG ET AL., NATURE, vol. 368, 1994, pages 856 - 859 |
| LONBERG; HUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LOUIS ET AL., J. BIOL. CHEM., vol. 278, no. 22, 2003, pages 20278 - 20285 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745 |
| MAKABE ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 283, 2008, pages 1156 - 1166 |
| MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 |
| MEUSING ET AL., NATURE, vol. 313, no. 6002, 1985, pages 450 - 458 |
| MONTEFIORI, D.C.: "Curr. Protocol. Immunol.", 2005, article "Chapter 12," |
| MORRISON, NATURE, vol. 368, 1994, pages 812 - 13 |
| NEUBERGER, NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 826 |
| NIXON ET AL., CURR. OPIN. DRUG DISCOV. DEVEL, vol. 9, no. 2, 2006, pages 261 - 8 |
| NYGREN ET AL., FEBS J., vol. 275, no. 11, 2008, pages 2668 - 76 |
| PACE ET AL., PNAS USA, vol. 110, no. 33, 2013, pages 13540 - 13545 |
| PEREZ ET AL.: "Utilization of immunoglobulin G Fc receptors by human immunodeficiency virus type 1: a specific role for antibodies against the membrane-proximal external region of gp41", J VIROL, vol. 83, 2009, pages 7397 - 7410 |
| PEREZ, L. G.; COSTA, M. R.; TODD, C. A.; HAYNES, B. F.; MONTEFIORI, D. C.: "Utilization of immunoglobulin G Fc receptors by human immunodeficiency virus type 1: a specific role for antibodies against the membrane-proximal external region of gp41", J VIROL, vol. 83, 2009, pages 7397 - 7410 |
| PIETZSCH ET AL., J. VIROL, vol. 84, no. 10, 2010, pages 5032 - 42 |
| PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SANDERS, R. W. ET AL.: "A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gp140, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies", PLOS PATHOG., vol. 9, 2013, pages E1003618 |
| SEAMAN ET AL., J. VIROL., vol. 84, no. 3, 2010, pages 1439 - 1452 |
| SEAMAN ET AL., J. VIROL., vol. 84, no. 3, 2010, pages 1439 - 52 |
| SHEERLINCK ET AL., VACCINE, vol. 19, 2001, pages 2647 - 2656 |
| SILVERMAN ET AL., NAT. BIOTECHNOL., vol. 23, no. 12, 2005, pages 1556 - 61 |
| SKERRA, A., FEBS J., vol. 275, no. 11, 2008, pages 2677 - 83 |
| STUMPP ET AL., DRUG DISCOV. TODAY, vol. 13, no. 15-16, 2008, pages 695 - 701 |
| SULLIVAN ET AL., NATURE, vol. 408, 2000, pages 605 - 609 |
| TAYLOR ET AL., NEJM, vol. 359, no. 18, 2008, pages 1965 - 1966 |
| TEEUWSEN ET AL., AIDS RES. HUM. RETROVIRUSES, vol. 6, 1990, pages 381 - 392 |
| THOMSON ET AL., J. VIROL, vol. 72, 1998, pages 2246 - 2252 |
| TOMARAS, G. D. ET AL.: "Polyclonal B cell responses to conserved neutralization epitopes in a subset of HIV-1-infected individuals", J VIROL, vol. 85, 2011, pages 11502 - 11519 |
| VELDERS ET AL., J. IMMUNOL., vol. 166, 2001, pages 5366 - 5373 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| WIDERA ET AL., J. IMMUNOL., vol. 164, 2000, pages 4635 - 3640 |
| WOO ET AL., VACCINE, vol. 19, 2001, pages 2945 - 2954 |
| XIANG ET AL., IMMUNITY, vol. 2, 1995, pages 129 - 135 |
| ZLOKARNIK ET AL., SCIENCE, vol. 279, 1998, pages 84 - 8 |
| ZWICK ET AL., J. VIROL., vol. 75, no. 22, 2001, pages 10892 - 10905 |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10730933B2 (en) | 2015-12-05 | 2020-08-04 | Centre Hospitalier Universitaire Vaudois | HIV binding agents |
| WO2020012435A1 (en) * | 2018-07-13 | 2020-01-16 | Lausanne University Hospital | Hiv binding agents |
| WO2020082045A1 (en) * | 2018-10-19 | 2020-04-23 | University Of Maryland, College Park | Multispecfic anti-hiv antibodies |
| US12365722B2 (en) | 2018-10-19 | 2025-07-22 | University Of Maryland, College Park | Multispecific antibodies targeting multiple epitopes on the HIV-1 envelope |
| WO2021009697A3 (en) * | 2019-07-15 | 2021-04-15 | Lausanne University Hospital | Hiv binding agents |
Also Published As
| Publication number | Publication date |
|---|---|
| CN108779168A (zh) | 2018-11-09 |
| US20190345234A1 (en) | 2019-11-14 |
| EP3383902A1 (en) | 2018-10-10 |
| CA3045756A1 (en) | 2017-06-08 |
| JP2019509046A (ja) | 2019-04-04 |
| US10730933B2 (en) | 2020-08-04 |
| WO2017093985A4 (en) | 2017-07-27 |
| US20210009661A1 (en) | 2021-01-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20220169733A1 (en) | Immunological Reagents | |
| US20210009661A1 (en) | HIV Binding Agents | |
| ES3034233T3 (en) | Non-blocking pd1 specific antibodies | |
| EP4271707A1 (en) | Neutralizing monoclonal antibodies against covid-19 | |
| US9982052B2 (en) | Immunological reagents | |
| WO2020012435A1 (en) | Hiv binding agents | |
| US20220259315A1 (en) | Immunological Reagents | |
| US20250312438A1 (en) | Humanized constructs, vaccines, and methods | |
| JP7678790B2 (ja) | Hiv結合剤 | |
| CN117062624A (zh) | 抗covid-19中和单克隆抗体 | |
| AU2019306543A1 (en) | Antibodies against campylobacter species |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16819370 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018548300 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016819370 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016819370 Country of ref document: EP Effective date: 20180705 |
|
| ENP | Entry into the national phase |
Ref document number: 3045756 Country of ref document: CA |