WO2017015553A1 - Compositions and methods for producing pro-inflammatory macrophages - Google Patents
Compositions and methods for producing pro-inflammatory macrophages Download PDFInfo
- Publication number
- WO2017015553A1 WO2017015553A1 PCT/US2016/043540 US2016043540W WO2017015553A1 WO 2017015553 A1 WO2017015553 A1 WO 2017015553A1 US 2016043540 W US2016043540 W US 2016043540W WO 2017015553 A1 WO2017015553 A1 WO 2017015553A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cid
- ctlr4
- cells
- construct
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/4353—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems
- A61K31/436—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom ortho- or peri-condensed with heterocyclic ring systems the heterocyclic ring system containing a six-membered ring having oxygen as a ring hetero atom, e.g. rapamycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/15—Cells of the myeloid line, e.g. granulocytes, basophils, eosinophils, neutrophils, leucocytes, monocytes, macrophages or mast cells; Myeloid precursor cells; Antigen-presenting cells, e.g. dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43595—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from coelenteratae, e.g. medusae
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/90—Isomerases (5.)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y502/00—Cis-trans-isomerases (5.2)
- C12Y502/01—Cis-trans-Isomerases (5.2.1)
- C12Y502/01008—Peptidylprolyl isomerase (5.2.1.8), i.e. cyclophilin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/033—Fusion polypeptide containing a localisation/targetting motif containing a motif for targeting to the internal surface of the plasma membrane, e.g. containing a myristoylation motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/60—Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/735—Fusion polypeptide containing domain for protein-protein interaction containing a domain for self-assembly, e.g. a viral coat protein (includes phage display)
Definitions
- compositions comprising engineered monocytes can be administered to a subject in need of treatment with pro-inflammatory macrophages.
- the polarization of the engineered monocytes can be regulated using a iigand, allowing for both spatial and temporal control of the treatment.
- Macrophages a main inflammatory ceil type, are known to be key players in the inflammatory response. When activated, they exist in two major phenotypes that can be broadly defined as: pro-inflammatory and pro-repair macrophages.
- Pro-inflammatory macrophages are the first to arise at the site of injury and propagate the initial response by releasing pro-inflammatory cytokines as well as by producing reactive oxygen species in order to destroy foreign material at the injury site (1).
- Pro-repair macrophages promote growth and regeneration and are present following the pro-inflammatory macrophage decline.
- These types of macrophages are present toward the end of the inflammatory response and mainly function to end and resolve inflammation, stimulate healing, and restore tissue homeostasis that is characterized by proper vascularization and little to no fibrosis or scarring (2).
- pro-inflammatory macrophages can potentially lead to chronic inflammatory diseases, like atherosclerosis and rheumatoid arthritis.
- having a local overabundance of pro-repair macrophages can lead to fibrotic diseases, like pulmonary and cardiac fibrosis.
- Pro-repair macrophages are also found associated with solid tumors. Tumors ceils are thought to induce the pro-repair macrophage phenotype that in turn allows for tumor progression and tumor vascularization (1).
- the invention meets these needs and others by providing methods and compositions that mediate selective inducement of pro-inflammatory macrophages.
- the invention provides, in one embodiment, a polynucleotide construct encoding a chimeric cellular receptor, in one embodiment, the construct comprises nucleic acid sequences encoding, in operable linkage, a myristoyiation sequence (Myr), a dimerizer domain, and an intracellular portion of the TLR4 receptor.
- the construct further comprises a sequence that enables expression of a separate reporter molecule controlled by the same promoter. Examples of such a sequence include, but are not limited to, a ribosome skipping sequence and a cleavage sequence.
- the construct is free of sequences encoding an extracellular portion of the TLR4 receptor, in preferred embodiments, the construct is sufficiently free of sequences encoding an extracellular portion of the TLR4 receptor that no extracellular iigands will bind, in one embodiment, the dimerizer domain is phenylalanine 36 to valine point mutation (F38V) derived from a mutated version of the endogenous FKBP12 protein.
- F38V phenylalanine 36 to valine point mutation
- the nucleic acid sequences encoding the myristoyiation sequence (Myr), the dimerizer domain, and the intracellular portion of the TLR4 receptor comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1.
- the nucleic acid sequences encoding the myristoyiation sequence (Myr), the dimerizer domain, the intracellular portion of the TLR4 receptor, the ribosome skipping sequence, and the green fluorescent protein comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2.
- the intracellular portion of the TLR4 receptor comprises an amino acid sequence having at least 90% sequence identify to the amino acid sequence of
- the intracellular portion of the TLR4 receptor includes one or more of the following mutations: P714A, S744A, R745A, C747S, Y751A, E752A, E775A, K776S, Q792A, N792 A, Y794A, E796A, and E798A, wherein amino acid numbering refers to the human TLR4 receptor protein, amino acid residues 861 -839 of which are shown in SEQ ID NO: 6.
- intracellular portion of the TLR4 receptor include, but are not limited to, polypeptides comprising an amino acid sequence selected from those shown in SEQ ID NO: 7-19, or SEQ ID NO: 20, the latter of which includes each of the point mutations indicated above,
- the invention further provides a method of producing a genetically engineered monocyte, in one embodiment, the method comprises the steps of: (a) contacting a monocyte with a construct as described herein under conditions sufficient to transfect the construct into the monocyte; and (b) culturing the monocyte transfected in step (a).
- the genetically engineered monocytes express the chimeric cellular receptor able to dimerize upon addition of a Chemical Inducer of Dimerization (CID) synthetic ligand, which dimerization activates signaling pathways independently of endogenous physiological ligands, thereby differentiating the transfected monocyte into a macrophage.
- the CID synthetic ligand is a recombinant FK506 molecule, in one embodiment, the recombinant FK506 molecule is
- the composition further comprises a CID synthetic ligand.
- the CID synthetic ligand is a
- FK506 molecule such as, for example, AP20187.
- the invention additionally provides a method of reversibly inducing pro-inflammatory macrophages in a subject.
- the method comprises: (a)administering the composition of claim 1 to a subject; and (b) administering a CID synthetic ligand to the subject.
- the CID synthetic ligand activates the genetically engineered monocytes
- the method further comprises: (c) withdrawing administration of the CID synthetic ligand and/or administering a washout ligand, thereby reversing the activation of the genetically engineered monocytes.
- the administering of step (a) can be via means suitable to the particular patient and treatment objective, such as by implantation into a target organ, injection into a target tissue, introduction of a scaffold to a target site, or intravenous administration, in some embodiments, the genetically engineered monocyte is pre-treated with a CID synthetic ligand prior to the administering of step (a), in such embodiments, pre-polarized ceils are administered to the subject, thereby jump-starting the process.
- the CID synthetic ligand is administered subsequently to maintain the cells in a polarized state in vivo.
- the invention provides a method of treating a fibrotic disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand.
- fibrotic disease include, but are not limited to, those selected from the group consisting of pulmonary fibrosis, cardiac fibrosis, and foreign body reaction.
- the invention provides a method of treating an inflammatory disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand.
- the inflammatory disease is a chronic inflammatory disease.
- Representative examples of chronic inflammatory disease include, but are not limited to, those selected from the group consisting of atherosclerosis and rheumatoid arthritis.
- the invention provides a method of treating cancer inflammation comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand.
- FIG. 1 Engineered ⁇ utilizing the Chemically Induced Dimerization (CID) system. Schematic representation of the engineered macrophages and the activation by CID drug.
- CID Chemically Induced Dimerization
- FIG. 1 Diagram of cTLR4 Construct and Engineered Receptor and Confirmation of cTLR4 construct expression.
- the cTLR4 construct contains: a myristolation domain (Myr), an engineered dimerization domain (F36V), the cytoplasmic portion of the TLR4 domain
- FIG. 4 Mouse F36V-cTLR4 Amino Acid sequence (SEQ ID NO: 4).
- FIG. 1 Residues 661 to 839 human TLR4 cytoplasmic/intracellular portion of the receptor (SEQ ID NO: 6). Mutations in ail three possible binding sites abrogate TLR4 T1R-TLR4 TIR interactions. Only potential binding sites i and II in the TLR4 T!R domain are critical for LPS-induced NF- ⁇ signaling. An iRF3/GAL4-based assay suggests that binding site 111 may be important for !RF-3 activation. [0020] Figure 8.
- Proposed mutations in human TLR4 cytoplasmic/intracellular portion amino acid residues 861 to 839 include: P714A, S744A, R745A, C747S, Y751A, E752A, E775A, K776S, Q792A, N792 A, Y794A, E796A, and E798A (SEQ ID NO: 20).
- FIG. 8 CiD-treated M -cTLR4 Cells Exhibit Increased Expression of TNFa, IL-6, and iNOS. Expression of classical inflammatory ⁇ phenotype markers, determined by sandwich ELISA assay. Bar graphs show the levels of (A) TNFa and (B) IL-6 of CID-treated (50 nM) ⁇ - cTLR4 cells compared to untreated, vehicle (100% EtOH), and LPS-treated ceils (100 ng/mL). Cell media was collected following 24 h treatment. (C) Western blot shows intensity of iNOS expression (130 kDa) for CID and LPS-treated IV ⁇ -cTLR4 cells when compared to controls. Ceils were lysed following 24 h treatment.
- FIG. 9 ⁇ - ⁇ 4 Ceils are influenced by IL-4 Treatment. Expression of classical inflammatory ⁇ phenotype markers following cocktail treatment of IL-4 (60 ng/mL) and CID drug (50 nM), LPS (100 ng/mL) or vehicle. Bar graphs show the levels of (A) TNFa and (B) IL-6 of cocktail-treated cells compared to controls. Cell medium was collected following 24 hour treatment, (C) Western blot shows intensity of iNOS expression (130 kDa) for cocktail -treated !V ⁇ -cTLR4 cells when compared to controls. Ceils were lysed following 24 hour treatment.
- FIG. 10 Figure 10. !V ⁇ -cTLR4 Cells Return to Baseline Levels 48 Hours Following CID Drug Withdrawal.
- CID drug withdrawal experiment determined by IL-6 expression. Ceils were treated with CID drug (50 nM), LPS (100 ng/mL), or vehicle for 24 hours or left untreated for 24 hours. Media was collected at the indicated timepoints after complete CID drug withdrawal and IL-6 levels were measured at each timepoinf to determine activation intensity.
- Figure 1 CID-treated ⁇ -cTLR4 Ceils Remain Activated for At Least 48 Hours.
- FIG. 12 CID-treated Md>-cTLR4 Ceils Activate the MyD88-dependent Pathway.
- A Western blot probing for p-ERK and total ERK. Cells were lysed at the time points indicated following CID drug (50 nM), LPS (100 ng/mL), or vehicle (100% EtOH) treatment. Top panel shows phosphorylated over total ERK ratio relative to the zero timepoinf for each subsequent timepoint. Bottom panel shows corresponding blots.
- B A Dual-luciferase ® assay was used to determine NF- ⁇ activity in IV -cTLR4 cells. Luciferase activity was measured 4 hours following treatment of M0-TLR4 cells with CID drug or vehicle treatment. Luciferase activity was normalized to baseline Renilia luciferase activity.
- FIG. 1 CID-treated MO-cTLR4 Ceils Activate the yD88-independent Pathway.
- Cells were lysed at timepoints indicated following CID drug (50 n ), LPS (100 ng/mL), or vehicle treatment
- FIG. 14 Media From CID-treated ct3-cTLR4 Ceils Upregulate VCAM-1 and iCA -1 on Endothelial Ceils. Endothelial activation, determined by flow cytometry. Conditioned media from M -cTLR4 ceils treated for 6 hours with TNFa, CID, and vehicle was transferred to plated bEnd.3 endothelial cells and left to incubate for 12 hours. Following the 12 hour incubation, bEnd.3 ceils were then trypsinized and stained for both VCAM-1 and ICAM-1. (A & B)
- FIG. 16 Mid Low M S>-cTLR4 Cells Exhibit Highest Signal to Noise Ratio.
- An IL-6 EL!SA was performed on unsorted ceils and four groups of sorted cells from the lowest to the most intense GFP intensity of M£f> ⁇ cTLR4 cells. Cells were treated with CID drug (50 nM), LPS (100 ng/mL), or vehicle for 24 hours or left untreated for 24 hours.
- FIG. 1 Md -cTLR4 Cells are influenced by IL-4 Treatment, Expression of the IL-10 cytokine (M2 marker) following cocktail treatment of IL-4 (60 ng/mL) and CID drug (50 nM), LPS (100 ng/mL), or vehicle. Bar graph shows the levels of IL-10 for cocktail-treated ceils compared to controls. Cell medium was collected following 48 hour treatment.
- M2 marker IL-10 cytokine
- FIG. 8 Co-culture Angiogenesis Assay Results.
- Top left panel shows example of the angiogenesis analyzer, which uses different colors to distinguish branches, twigs, segments, master segments, meshes, nodes surrounded by junctions, master junctions, isolated elements, small isolated elements, and extremities.
- Bottom left panel shows network formation for vehicle-treated MO-cTLR4 cells co-cultured with RAECs.
- Top right panel shows network formation for CID-treated (50 nM) M t>-cTLR4 ceils co-cultured with RAECs.
- Bottom right panel shows network formation for LPS-treated (100 ng/mL) Md>-cTLR4 cells co-cultured with RAECs.
- Figure 19 Quantification of Co-culture Angiogenesis Assay.
- A Bar graph of quantification of master segments.
- B Bar graph of quantification of isolated segments.
- C Bar graph of quantification of branch number
- D Bar graph of quantification of branching interval.
- FIG. 20 Schematic illustration showing how M -cTLR4 cells were tested in vivo using a atrigel plug.
- Liquid atrigel with ⁇ t> ⁇ cTLR4 cells were s.c. injected into a mouse and left to solidify. Mice were injected with CID drug every other day with 2 mg/kg mouse weight. Matrigel plugs were then removed following 7 or 14 days and analyzed.
- Figure 21 14 Day CID-treated Plugs with GFP and INOS Positive Cells with Co- localization, image taken at 40X magnification. Top left panel shows Dapi staining of nuclei, top right panel shows GFP positive cells, bottom left panel shows iNOS positive cells, and bottom right panel shows the merged image.
- FIG. 22 ELISA for VEGF in the supernatant of TLR4 engineered cells.
- B ELISA for VEGF in the supernatant of TLR4 engineered cells.
- Untreated TLR4 engineered ceils with no treatment
- INF-gamma TLR4 engineered cells treated with INF-gamrna
- CID+ INF-gamma TLR4 engineered ceils treated with CID and INF- gamma
- LPS + INF-gamma TLR4 engineered ceils treated with LPS and INF- gamma
- CID TLR4 engineered ceils treated with CID.
- the invention is based on the surprising and unexpected discovery of a method of engineering a TLR4 receptor that is activated only in target cells.
- the invention provides a construct that exploits selected portions of the TLR4 receptor to which no extracellular ligand will bind.
- a dimerization domain is employed to allow for regulated activation when used in conjunction with a dimerizer drug.
- a myristoylation domain facilitates intracellular presentation.
- Constructs of the invention can be used to create engineered monocytes whose TLR4 receptors can be selectively activated to induce pro-inflammatory macrophages with administration of a dimerization agent.
- the engineered macrophages can be used to ameliorate conditions associated with excessive pro-repair macrophages, like cardiac fibrosis and solid tumor growth. Delivery of the engineered macrophages to sites of cardiac fibrosis can reduce the amount of fibrosis and scarring, and ameliorate cardiac function. Delivery of the engineered macrophages to solid tumors can reduce tumor growth and size. Definitions
- intracellular portion of a TLR4 receptor means a portion of the receptor that is sufficiently free of sequences encoding an extracellular portion of the TLR4 receptor that no extracellular iigands will bind.
- polypeptide includes proteins, fragments of proteins, and peptides, whether isolated from natural sources, produced by recombinant techniques or chemically synthesized.
- Peptides of the invention typically comprise at least about 6 amino acids,
- a “mutation” is an alteration of a polynucleotide sequence, characterized either by an alteration in one or more nucleotide bases, or by an insertion of one or more nucleotides into the sequence, or by a deletion of one or more nucleotides from the sequence, or a combination of these.
- promoter means a region of DNA, generally upstream (5') of a coding region, which controls at least in part the initiation and level of transcription.
- Reference herein to a "promoter” is to be taken in its broadest context and includes the transcriptional regulatory sequences of a classical genomic gene, including a TATA box or a non-TATA box promoter, as well as additional regulatory elements (i.e., activating sequences, enhancers and silencers) that alter gene expression in response to developmental and/or environmental stimuli, or in a tissue- specific or cell-type-specific manner.
- a promoter is usually, but not necessarily, positioned upstream or 5', of a structural gene, the expression of which it regulates.
- the regulatory elements comprising a promoter are usually positioned within 2 kb of the start site of transcription of the gene, although they may also be many kb away. Promoters may contain additional specific regulatory elements, located more distal to the start site to further enhance expression in a ceil, and/or to alter the timing or inducibiiity of expression of a structural gene to which it is operabiy connected.
- operbiy connected or "operabiy linked” and the like is meant a linkage of polynucleotide elements in a functional relationship.
- a nucleic acid is “operabiy linked” when it is placed into a functional relationship with another nucleic acid sequence.
- a promoter or enhancer is operabiy linked to a coding sequence if it affects the transcription of the coding sequence.
- Operabiy linked means that the nucleic acid sequences being linked are typically contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame, "Operabiy linking" a promoter to a transcribable
- polynucleotide is meant placing the transcribable polynucleotide (e.g., protein encoding polynucleotide or other transcript) under the regulatory control of a promoter, which then controls the transcription and optionally translation of that polynucleotide.
- transcribable polynucleotide e.g., protein encoding polynucleotide or other transcript
- nucleic acid or “polynucleotide” refers to a deoxyribonucieotide or ribonucleotide polymer in either single- or double-stranded form, and unless otherwise limited, encompasses known analogs of natural nucleotides that hybridize to nucleic acids in a manner similar to naturally-occurring nucleotides.
- identical means, with respect to amino acid sequences, that at any particular amino acid residue position in an aligned sequence, the amino acid residue is identical between the aligned sequences.
- similarity indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences.
- leucine may be substituted for an isoleucine or valine residue. This type of substitution can be referred to as a conservative substitution.
- a conservative substitution of any of the amino acid residues contained in a given amino acid sequence these changes have no effect on the binding specificity or functional activity of the resulting antibody when compared to the unmodified antibody.
- corresponding position refers to an amino acid residue that is present in a second sequence at a position corresponding to a specified amino acid residue in a first sequence which is the same position as the position in the first sequence when the two sequences are aligned to allow for maximum sequence identity between the two sequences.
- consists essentially of” or “consisting essentially of means that a polypeptide may have additional features or elements beyond those described, provided that such additional features or elements do not materially affect the ability of the antibody or antibody fragment to have the recited binding specificity.
- the antibody or antibody fragments comprising the polypeptides may have additional features or elements that do not interfere with the ability of the antibody or antibody fragments to bind to its target and exhibit its functional activity, e.g., disrupting or preventing bacterial adhesion to a mannose-coated surface. Such modifications may be introduced into the amino acid sequence in order to reduce the immunogenicity of the antibody.
- a polypeptide consisting essentially of a specified sequence may contain one, two, three, four, five or more additional, deleted or substituted amino acids, at either end or at both ends of the sequence provided that these amino acids do not interfere with, inhibit, block or interrupt the role of the antibody or fragment in binding to its target and exhibiting its biological activity.
- heterologous sequence or a “heterologous” molecule refers to a moiety not naturally occurring in conjunction with a recited sequence or molecule.
- heterologous molecule examples include, but are not limited to, a polypeptide, antibody, epitope, polynucleotide, small molecule or drug. Such heterologous moieties can be useful for improving solubility, delivery, immunogenicity, efficacy, detection, or identification of the recited sequence or molecule. In some embodiments, the heterologous sequence is inert or an unrelated sequence.
- pharmaceutically acceptable carrier includes any material which, when combined with an active ingredient, allows the ingredient to retain bioiogicai activity and is non-reactive with the subject's immune system.
- examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents.
- Preferred diluents for aerosol or parenteral administration are phosphate buffered saline or normal (0.9%) saline.
- compositions comprising such carriers are formulated by well-known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, (Remington and Gennaro 1990)).
- to "prevent” or “treat” a condition means to decrease or inhibit symptoms indicative of the condition or to delay the onset or reduce the severity of the condition.
- adjuvant includes those adjuvants commonly used in the art to facilitate an immune response.
- an adjuvant such as a helper peptide or cytokine can be provided via a polynucleotide encoding the adjuvant.
- the terms “comprise” or “include”, or variations such as “comprises” or “comprising”, “includes” or “including” mean the inclusion of a recited item or group of items, but not the exclusion of any other item or group of items.
- the invention provides, in one embodiment, a polynucleotide construct encoding a chimeric cellular receptor.
- the construct comprises nucleic acid sequences encoding, in operable linkage, a myristoylation sequence (Myr), a dimerizer domain, and an intracellular portion of the TLR4 receptor.
- the construct further comprises a sequence that enables expression of a separate reporter molecule controlled by the same promoter. Examples of such a sequence include, but are not limited to, a ribosome skipping sequence and a cleavage sequence.
- a reporter molecule is green fluorescent protein (GFP).
- the construct is free of sequences encoding an extracellular portion of the TLR4 receptor, in preferred embodiments, the construct is sufficiently free of sequences encoding an extracellular portion of the TLR4 receptor that no extracellular ligands will bind, in one embodiment, the dimerizer domain is phenylalanine 36 to valine point mutation (F36V) derived from a mutated version of the endogenous FKBP12 protein.
- F36V phenylalanine 36 to valine point mutation
- the nucleic acid sequences encoding the myristoylation sequence (Myr), the dimerizer domain, and the intracellular portion of the TLR4 receptor comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of:
- the nucleic acid sequences encoding the myristoylation sequence ( yr), the dimerizer domain, the intracellular portion of the TLR4 receptor, the ribosome skipping sequence, and the green fluorescent protein comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of:
- the intracellular portion of the TLR4 receptor comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of
- the intracellular portion of the TLR4 receptor includes one or more of the following mutations: P714A, S744A, R745A, C747S, Y751A, E752A, E775A, K776S, Q792A, N792 A, Y794A, E796A, and E798A.
- Representative examples of the intracellular portion of the TLR4 receptor include, but are not limited to, polypeptides comprising an amino acid sequence selected from:
- LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA A NIIHEGFHKSRKVIWVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVESTLLRQQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 14); [0069] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELV NLEEGVPPFQLCLHYRDFIPGVAIA A NI!HEGFHKSRKV!VVVSQHFiQSRWCIFEYE!AQTWQFLSSRAGilFIVLQKVEKTLLRAQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSi (SEQ ID NO: 15);
- TLR4 particularly amino acids 675-835; transmembrane helices underlined; TIR cytoplasmic domain in bold and highlighted; a linker sequence is added between them; the proline that is both bold and underlined is needed for signaling:
- the invention provides a composition comprising a construct of the invention, in one embodiment, the construct encodes the myristoylation domain, the F36V domain, and the cTLR4 domain.
- the construct further comprises the T2A sequence and copGFP, or reporter sequence, in another embodiment, the invention provides a composition comprising a cell transfected with a construct of the invention.
- the ceil is a monocyte.
- the composition is a pharmaceutical composition.
- the composition can comprise a therapeutically or prophylactically effective amount of construct, or engineered monocyte transfected with same, of the invention.
- An effective amount is an amount sufficient to achieve pro-inflammatory macrophage activation, or to alleviate symptoms of a condition, disease, or infection.
- the composition of the invention further comprises a carrier.
- the carrier can be a pharmaceutically acceptable carrier, or other carrier that facilitates use of the composition.
- any suitable carrier known to those of ordinary skill in the art may be employed in the pharmaceutical compositions of this invention, the type of carrier will vary depending on the mode of administration.
- compositions of the present invention may be formulated for any appropriate manner of administration, including for example, topical, oral, nasal, intravenous, intracranial, intraperitoneal, subcutaneous or intramuscular administration.
- the carrier preferably comprises water, saline, alcohol, a fat, a wax or a buffer.
- any of the above carriers or a solid carrier such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and magnesium carbonate, may be employed.
- compositions may also comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, chelating agents such as EDTA or glutathione, adjuvants (e.g., aluminum hydroxide) and/or preservatives.
- buffers e.g., neutral buffered saline or phosphate buffered saline
- carbohydrates e.g., glucose, mannose, sucrose or dextrans
- mannitol e.g., proteins, polypeptides or amino acids such as glycine
- antioxidants e.g., glycine
- chelating agents such as EDTA or glutathione
- adjuvants e.g., aluminum hydroxide
- compositions of the present invention may be formulated as a lyophilizate.
- Compounds may also be encapsulated within liposomes via known methods.
- Treatment includes prophylaxis and therapy.
- Prophylaxis or treatment can be accomplished by a single direct injection at a single time point or multiple time points.
- Patients or subjects include mammals, such as human, bovine, equine, canine, feline, porcine, and ovine animals as well as other veterinary subjects. Typical patients or subjects are human.
- compositions are typically administered in vivo via parenteral (e.g. intravenous, subcutaneous, and intramuscular) or other traditional direct routes, such as buccal/sublingual, rectal, oral, nasal, topical, (such as transdermal and ophthalmic), vaginal, pulmonary, intraarterial, intraperitoneal, intraocular, or intranasal routes or directly into a specific tissue, such as by implantation into a target organ, injection into a target tissue, or introduction of a scaffold to a target site.
- parenteral e.g. intravenous, subcutaneous, and intramuscular
- other traditional direct routes such as buccal/sublingual, rectal, oral, nasal, topical, (such as transdermal and ophthalmic), vaginal, pulmonary, intraarterial, intraperitoneal, intraocular, or intranasal routes or directly into a specific tissue, such as by implantation into a target organ, injection into a target tissue, or introduction of a scaffold to a target site
- compositions are administered in any suitable manner, often with pharmaceutically acceptable carriers. Suitable methods of administering cells in the context of the present invention to a patient are available, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.
- the dose administered to a patient should be sufficient to effect a beneficial therapeutic response in the patient over time, or to inhibit infection or disease due to infection.
- the composition is administered to a patient in an amount sufficient to alleviate, reduce, cure or at least partially arrest symptoms and/or complications from the disease or infection.
- An amount adequate to accomplish this is defined as a "therapeutically effective dose.”
- the dose will be determined by the activity of the composition produced and the condition of the patient, as well as the body weight or surface areas of the patient to be treated.
- the size of the dose also will be determined by the existence, nature, and extent of any adverse side effects that accompany the administration of a particular composition in a particular patient, in determining the effective amount of the composition to be administered in the treatment or prophylaxis of disease, the physician needs to evaluate the progression of the disease, and any treatment-related toxicity.
- the invention further provides a method of producing a genetically engineered monocyte.
- the method comprises the steps of: (a) contacting a monocyte with a construct as described herein under conditions sufficient to fransfect the construct into the monocyte; and (b) cuituring the monocyte transfected in step (a).
- the engineered monocytes express the chimeric cellular receptor able to dimerize upon addition of a Chemical inducer of Dimerization (CID) synthetic iigand, which dimerization activates signaling pathways independently of endogenous physiological ligands, thereby differentiating the transfected monocyte into a macrophage.
- CID Chemical inducer of Dimerization
- the CID synthetic iigand is a recombinant FK508 molecule.
- the recombinant FK506 molecule is
- composition comprising a genetically engineered monocyte of the invention, in some embodiments, the composition further comprises a CID synthetic iigand.
- the CID synthetic Iigand is a
- FK506 molecule such as, for example, AP20187.
- the invention additionally provides a method of reversibly inducing pro-inflammatory macrophages in a subject.
- the method comprises: (a) administering the composition of claim 11 to a subject; and (b) administering a CID synthetic iigand to the subject.
- the CID synthetic Iigand activates the genetically engineered monocytes
- the method further comprises: (c) withdrawing administration of the CID synthetic Iigand and/or administering a washout iigand, thereby reversing the activation of the genetically engineered monocytes.
- a washout Iigand for use with AP20187 is B/B Washout Ligand (Clontech).
- step (a) can be via means suitable to the particular patient and treatment objective, such as by implantation into a target organ, injection into a target tissue, introduction of a scaffold to a target site, or intravenous administration.
- the genetically engineered monocyte is pre-treated with a CID synthetic Iigand prior to the administering of step (a).
- pre-polarized cells are administered to the subject, thereby jump-starting the process.
- the C!D synthetic ligand is administered
- the invention provides methods of treating conditions that would benefit from selective inducement of pro-inflammatory macrophages, in one embodiment, the invention provides a method of treating a fibrotic disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand.
- fibrotic disease include, but are not limited to, those selected from the group consisting of pulmonary fibrosis, cardiac fibrosis, and foreign body reaction.
- the invention provides a method of treating an inflammatory disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand.
- the inflammatory disease is a chronic inflammatory disease.
- chronic inflammatory disease include, but are not limited to, those selected from the group consisting of atherosclerosis and rheumatoid arthritis.
- the invention provides a method of treating cancer inflammation comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand.
- kits are also within the scope of the invention.
- Such kits can comprise a package or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements (e.g., constructs, ceils, dimerizing agent, matrigel, scaffold) to be used in the method.
- the kit comprises one or more constructs of the invention.
- the kit further comprises one or more containers, with one or more constructs stored in the containers.
- the kit of the invention will typically comprise the container described above and one or more other containers comprising materials desirable from a commercial and user standpoint, including buffers, diluents, filters, needles, syringes, and package inserts with instructions for use.
- a label can be provided on the container to indicate that the composition is used for a specific therapeutic or non-therapeutic application, and can also indicate directions for use.
- Example 1 Engineering macrophages to control the inflammatory response and angiogenesis
- the physiological innate inflammatory response requires a highly orchestrated series of events characterized by four basic phases: reaction, regrowth, remodeling, and resolution.
- ⁇ play an active role in secreting chemokines and cytokines that direct the recruitment and egress of various immune ceil types at the injured site.
- the functional ⁇ phenotype depends on the microenvironment of the injured site and alters accordingly during the normal process of healing.
- dysreguiation of the ⁇ phenotype can lead to a non-ideal healing outcome.
- Monocytes are the precursor ceils to ⁇ , which are a main inflammatory ceil type and are known to be key players in the inflammatory response. When activated, ⁇ are classified into two major phenotypes that can be broadly defined as: pro-inflammatory ⁇ and pro- healing ⁇ . in literature, pro-inflammatory ⁇ are often denoted as “classically activated” or “M1” and pro-healing ⁇ are denoted as “alternatively activated” or "M2.” However, these two major ⁇ phenotypes are the two extremes on the phenotype scale, as intermediate macrophage types also exist.
- M1 ⁇ are the first to arrive at the inflammation site and this ⁇ population subsequently shifts to a less inflammatory pro- healing M2 ⁇ population during the repair phase.
- Pro-inflammatory ⁇ release inflammatory cytokines, such as TNFa and IL-6 as well as produce reactive oxygen species (ROS).[4, 5]
- ROS reactive oxygen species
- the pro-healing ⁇ phenotype has been shown to produce cytokines, such as IL- 10 and ⁇ which are markers that can decrease the pro-inflammatory response and promote healing and fibrosis.
- Angiogenesis or the formation of new blood vessels, is a critical step in the wound healing process.
- pro-inflammatory ⁇ secrete TNFa and IFN- ⁇ , which regulate expression of adhesion molecules on EC.
- These cytokines promote leukocyte adhesion to EC and extravasation into tissues by increasing expression of both cell surface and soluble forms of vascular ceil adhesion protein 1 (VCAM-1) and intercellular adhesion molecule 1 (ICAM-1).[6-9]
- VCAM-1 vascular ceil adhesion protein 1
- IAM-1 intercellular adhesion molecule 1
- This study utilizes engineered pro-inflammatory M1-iike cells to investigate EC activation.
- the engineered cells were designed by using the chemical inducer of dimerization (CID) technology to induce activation of the TLR4 receptor independent of the
- LPS lipopolysaccharides
- the monoclonal anti-human/mouse/rat FKBP12 antibody was purchased from Thermo Scientific. The following antibodies were purchased from Ceil Signaling: p44/42 MARK, Phospho -p44/42 MARK, IRF3 and Phospho-IRF3.
- the anti-iNOS/NOS type II antibody was purchased from BD Biosciences.
- the anti-mouse CD106 (VCAM-1) PE, the anti-mouse CD54 (ICAM-1) PE, the rat lgG2b isotype, and the anti-mouse TNFa antibodies were purchased from eBioscience.
- the HRP-conjugated goaf-anti-rabbit antibody was obtained from Jackson ImmunoResearch Laboratories, Inc.
- LPS and recombinant mouse TNFa was purchased from Sigma and recombinant mouse IL-4 was purchased from eBioscience.
- AP20187 (CID drug) was purchased from Ciontech.
- Lipofectamine 2000 was purchased from invitrogen.
- the Dual- Luciferase ® reporter assay system was obtained from Promega Corporation.
- the mouse Sport6-TLR4 vector was purchased from Open Biosystems. The
- cytoplasmic portion of TLR4 (cTLR4) was amplified (mRNA base pairs 2207-2748) and inserted into a pBluescript II KS+ vector with an existing myristolation domain and engineered F36V domain (pBluescript-Myr-F36V) (55) following Bam HI and EcoRV restriction enzyme (RE) cuts.
- PGR products were gel purified using a QIAEX H gel extraction kit (Qiagen) before ligations were performed. This resulted in a pBluescript-Myr-F36V-cTLR4 construct.
- the pCDH-EF1 a- MCS-T2A-copGFP lentiviral cDNA and expression vector was purchased from System
- Virus supernatant was collected following an additional 48 hours by filtering through a 0.45 prn filter. Filtered virus supernatant was then added either directly or in concentrated form to previously plated RAW264.7 cells (5x105 cells per well) in 6-well plates. Ceils were then sorted for GFP expression to acquire >90% transduction efficiency.
- RAW264.7 and bEnd.3 cells were obtained from ATCC.
- RAW264.7 and bEnd.3 cells were cultured in DME medium from invitrogen containing 10% (v/v) heat-inactivated FBS and 100 U/m! pen/strep (Invitrogen) and incubated at 37°C with 5% C02.
- transfection reagents were replaced with fresh serum-free medium and treated with either vehicle (100% EtOH) or CID drug (50 nM) for 4 hours.
- Cell lysate was harvested and luciferase activity was measured using a Dual-Luciferase ® reporter assay kit (Promega) according to manufacturer's instructions. All groups were normalized to Reniila luciferase.
- 0-cTRL4 conditioned media following a 6 hour treatment in 6-well plates (1x106 cells/well), was transferred to plated bEnd.3 cells in a 12-well plate (0.2x108 cells/well). Before media transfer, TNFa neutralizing and IgG isotype antibody (1 Mg/mL) were incubated in media for 15 minutes. Media was then added to bEnd.3 cells for 12 hours. Following incubation, bEnd.3 ceils were trypsinized and stained for ICAM-1 and VCAM-1. Cell cytometry was performed on a FACSCanto II Cell Analyzer (BD Biosciences) equipped with 488 nm and 647 nm lasers. Typically, 10,000 cells were analyzed per sample. Experiments were repeated at least three times. Non-specific staining was evaluated using a monoclonal antibody for igG2b and igG2a (eBioscience).
- Results are expressed as mean ⁇ SE unless otherwise specified. Significance between groups was determined by ANOVA and p-vaiues less than 0.05 were considered significant.
- FIG. 1 With the goal of developing inducible M1 ⁇ cells, we have engineered the murine monocytic cell line RAW264.7 to express a fusion protein comprising the intracellular TLR4 signaling domain and F36V-dimerization domains that bind to a cell permeable CID drug (Figure 1A).
- the cTLR4 construct is in a pCDH expression system. The 5' end of the construct starts with a myristoylation domain (Myr), which allows targeting to the membrane to mirror the spatial localization of the endogenous full length TLR4 domain.
- the Myr domain is followed by the engineered F36V dimerization domain, which has a binding site for the CID drug.
- This domain is linked to the cTLR4 domain, which is only the cytoplasmic portion of the receptor that is necessary for proper signal transduction.
- This design allows dimerization via a F36V-F36V interaction with the homodimerization CID drug (AP20187).
- AP20187 homodimerization CID drug
- T2A ribosome skipping sequence that allows the separate expression of GFP at the 3 ! end of the construct.
- IL-6 levels are elevated in CID-treated cells when compared to controls.
- an IL-6 ELISA was performed to test for the maximum signal of this cytokine in a CID drug titration experiment.
- the optimal dose of CID drug corresponds to the lowest dose that induces the highest level of IL-6 expression.
- the IL-6 ELISA results are seen in Supplemental Figure . These results suggest that a dose of at least 50 nM, produces the maximum activation of -cTLR4 ceils in the range from 50 nM - 250 n .
- a withdrawal experiment was also performed to determine the time in which the cells would revert to a baseline state following CID drug withdrawal.
- M t*-cTLR4 ceils were seeded in a 6- well culture plate (1x106 ceils/well). Cells were treated with vehicle, CI D drug, or LPS for 24 hours. Timepoints were collected after complete CID drug withdrawal and IL-6 levels were measured at each timepoint to determine activation intensity. Results showed that ceils converged to their baseline state at approximately 18 hours ( Figure 4).
- MO-cTLR4 cells were optimized for maximal signal to baseline activation by sorting four different GFP intensity populations: dim, midlow, midhigh, and high.
- An IL-6 ELISA was performed to determine activation of these populations compared to unsorted ⁇ and ⁇ - T2A populations (Supplemental Figure 2).
- the baseline activation of 0-cTLR4 cells also increased.
- a potential explanation for the high baseline activation as GFP intensity increases might be that some ceils have more cTLR4 constructs integrated into their genome, thus resulting in higher GFP intensify.
- the TLR4 pathway leads to activation of NF- ⁇ and the three MAPK pathways through the D88-dependent pathway.
- Both N F-KB and MAPK pathways directly control the transcription of the IL-6 and iNOS inflammatory genes, as well as control the mRNA stability of those transcripts.
- ERK1/2 phosphorylation is expected if the MyD88 dependent pathway and subsequent downstream TRAF6 activation has occurred. Therefore, we performed a western blot to probe for phosphorylated-ERK (p-ERK) and total ERK and compare the p-ERK/total ERK ratio relative to the zero timepoint (Figure 6A).
- the ClD-treated M -cTLR4 ceils exhibit an upregulation of ERK1/2 phosphorylation at the 5 minute timepoint, a subsequent decrease for the 15 minute timepoint, and then a significant increase for the last two timepoints.
- the LPS-treated M t>-cTLR4 ceils exhibited a similar ERK1/2 phosphorylation pattern with lower maximum phosphorylation.
- the N F-KB transcription factor has also been shown to be activated following TLR4 dimerization.
- M0-cTLR4 ceils were tested for NF- ⁇ promoter activation via a Dual-Luciferase reporter assay.
- the CID drug-treatment group was very similar, with 93.7% of the EC being positive for VCAM-1 and 64.4% of the EC being positive for ICAM-1.
- the vehicle group had a baseline VCAM-1 and ICAM-1 expression when compared to the isotype control.
- M0-cTLR4 cells remained polarized in response to CID drug for at least 48 hours and CID drug withdrawal experiments suggest that the engineered cells became deactivated 18 hours after drug withdrawal.
- C!D-po!arized M -cTLR4 conditioned-media had the ability to activate EC by upregulating both VCAM-1 and ICAM-1 expression on the ceil surface, which are two cell adhesion molecules associated with angiogenic processes.
- the activation of EC by CID-treated M -cTLR4 was determined to be dependent on TNFa.
- the human engineered P450 ⁇ When delivered into an avascular spheroid model, the human engineered P450 ⁇ were able to induce tumor cell death following the addition of the prodrug.
- the success of this study was dependent on the hypoxia-driven expression of cytochrome P450 in MOs.
- the engineered -cTLR4 in our study can be controlled temporally and specifically with the addition or withdrawal of the CID drug and activation is independent of the local environment. Indeed, we observe an upregulation of key pro-inflammatory markers from these engineered ⁇ 8 as soon as 8 hours after CID drug addition and then we observe return to baseline conditions in 18 hours following drug withdrawal.
- the ability to tune the engineered MOs with respect to selective activation provides a large added benefit, since the engineered 0-cTLR4 ceils could be turned on or off when and if necessary.
- CID drug activated $>-cTLR4 cells may provide the required priming step for angiogenesis to initiate.
- IL-6 In addition to iNOS and TNFa, our CID-treated M0-cTLR4 cells also produce increased levels of IL-6.
- the !L-6 cytokine has been closely associated with promotion of angiogenesis.
- increased IL-6 mRNA levels correlated with the development of ovarian follicles and the uterine lining, which are two independent physiological angiogenic processes.
- IL-6 treatment has been shown to promote tubule formation in brain microvessel EC in an in vitro setting. This correlated with increased IL-6 and VEGF mRNA expression in the healing adult murine brain tissue following injury.
- IL-6 may play a role in normal physiological angiogenesis as well as angiogenesis related to inflammatory remodeling of tissue.
- Studies in IL-6 KO mice showed that the IL-6 deletion resulted in delayed wound healing, accompanied with both delayed angiogenesis and collagen deposition.
- the direct mechanism of IL-6 and its influence on pro-angiogenic behavior is still not completely understood, however, IL-6 seems to be a key player in this process.
- the present engineered 0-cTLR4 ceils produce IL-6, along with two other factors implicated with pro-angiogenic behavior. This strongly suggests that our M -cTLR4 cells may have the ability to aid in the priming of the endothelium for early stage angiogenesis.
- M ⁇ £> ⁇ cTLR4 cells as angiogenesis priming agents, in which a following 2 ⁇ response might need to be necessary
- these cells could also be used in certain diseases to skew the balance of a SV12 ⁇ -abundant process.
- diseases characterized by excessive fibrosis could benefit from this technology, as there is often a local abundance of M2 ⁇ present during fibrotic events. Fibrosis occurs due to the abundance of these M2 ⁇ over-producing TGF , which in turn recruits fibroblasts. The recruitment of fibroblasts then leads to the overproduction of collagen, thus leading to a fibrotic state.
- CID-activated ⁇ - cTLR4 cells may provide a tool to reestablish the proper M1 vs 2 ⁇ equilibrium and decrease the excessive collagen deposition.
- Another possible application of the IV ⁇ -cTLR4 cells could be tumor inhibition. Tumor-induced angiogenesis is essential for cancer cell survival, tumor growth and metastasis propagation.
- TAMs tumor-associated ⁇
- the IL-4 cocktail results showed that the ⁇ - cTLR4 cells had decreased IL-6 and iNOS levels when compared to CID drug or LPS treatment alone, however, IL-4 did not seem to affect TNF-a levels.
- the engineered cells are influenced by competing 2-iike ⁇ signals. These competing signals may be changing the phenotype of the engineered -cTLR4 cells into an intermediate phenotype or even skewing the cells toward a 2-iike ⁇ phenotype.
- engineered ⁇ 8 could potentially: 1) be primed to polarize into M2 pro-healing ⁇ 8, 2) remain in a pro-inflammatory ⁇ phenotype state due to the surrounding environment, 3) develop into an intermediate phenotype state due to 2 ⁇ competing signals, 4) undergo apoptosis or, 5) migrate out of the inflammation site. Future studies will determine the degree of plasticity of the engineered cells, as well as how precise we can control these cells in vivo.
- the CID-treated group differed from the LPS- treated group in isolated segment analysis, as LPS-treated ⁇ t>c-TLR4 ceils co-cultured with RAECs had the highest number of isolated segments and CID-treated MOc-TLR4 ceils co- cultured with RAECs had slightly more isolated segments than the untreated group.
- the number of branches and the branching interval for the CID- and LPS-treated groups were significantly different than the control. However, the number of master segments and isolated segments for the CID- and LPS-treated groups were not significantly different, when compared to the control ( Figure 19).
- mice Four groups of 4 week old female BALB/c mice (total of 16 mice) were used in this in vivo study. The four groups consisted of: 7 day non-treated mice, 7 day CID-treated mice, 14 day non-treated mice, and 14 day CID-treated mice. At day of injection, pre-piated Md>-cTLR4 cells were lifted off and counted. 0.5x106 ceils were s.c. injected mixed in with Mafrigel into the right back dorsal area of the mouse. Before placing mouse back in cage, mice were injected with the first intraperitoneal CID drug dose (2 mg/kg mouse weight). Treatment groups were given CID drug injections every other day during the course of the experiment (Figure 20).
- Example 5 Decreased Expression of VEGF in lVl t3-cTLR4 cells Treated with CID, LPS, and/or IFN-Y
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Zoology (AREA)
- Genetics & Genomics (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Wood Science & Technology (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Developmental Biology & Embryology (AREA)
- Virology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Microbiology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Dermatology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Constructs are provided that exploit selected portions of the TLR4 receptor to which no extracellular ligand will bind. A dimerization domain is employed to allow for regulated activation when used in conjunction with a dimerizer drug. In addition, a myristoylation domain facilitates intracellular presentation. Constructs of the invention can be used to create engineered monocytes whose TLR4 receptors can be selectively activated with administration of a dimerization agent. Engineered macrophages can be selectively induced to become pro-inflammatory, providing methods to ameliorate conditions associated with excessive pro-repair macrophages, such as cardiac fibrosis and solid tumor growth. Delivery of the engineered macrophages to sites of cardiac fibrosis can reduce the amount of fibrosis and scarring and ameliorate cardiac function. Delivery of the engineered macrophages to solid tumors can reduce tumor growth and size.
Description
COMPOSITIONS AND METHODS FOR PRODUCING PRO-INFLA MATORY
MACROPHAGES
[0001] This application claims benefit of United States provisional patent application number 82/195,725, filed July 22, 2015, the entire contents of which are incorporated by reference into this application.
REFERENCE TO A SEQUENCE LISTING SUBMITTED VIA EFS-WEB
[0002] The content of the ASCII text file of the sequence listing named "UW61 WOU1_SL", which is 50 kb in size, was created on July 20, 2016, and electronically submitted via EFS-Web herewith the application. The sequence listing is incorporated herein by reference in its entirety.
TECHNICAL FIELD OF THE INVENTION
[0003] This invention relates to methods, constructs and compositions that can be used to produce pro-inflammatory macrophages. Compositions comprising engineered monocytes can be administered to a subject in need of treatment with pro-inflammatory macrophages. The polarization of the engineered monocytes can be regulated using a iigand, allowing for both spatial and temporal control of the treatment.
BACKGROUND OF THE INVENTION
[0004] Macrophages, a main inflammatory ceil type, are known to be key players in the inflammatory response. When activated, they exist in two major phenotypes that can be broadly defined as: pro-inflammatory and pro-repair macrophages. Pro-inflammatory macrophages are the first to arise at the site of injury and propagate the initial response by releasing pro-inflammatory cytokines as well as by producing reactive oxygen species in order to destroy foreign material at the injury site (1). Pro-repair macrophages promote growth and regeneration and are present following the pro-inflammatory macrophage decline. These types of macrophages are present toward the end of the inflammatory response and mainly function to end and resolve inflammation, stimulate healing, and restore tissue homeostasis that is characterized by proper vascularization and little to no fibrosis or scarring (2).
[0005] In most inflammation scenarios, having a local overabundance of pro-inflammatory macrophages can potentially lead to chronic inflammatory diseases, like atherosclerosis and rheumatoid arthritis. Conversely, having a local overabundance of pro-repair macrophages can lead to fibrotic diseases, like pulmonary and cardiac fibrosis. Pro-repair macrophages are also found associated with solid tumors. Tumors ceils are thought to induce the pro-repair macrophage phenotype that in turn allows for tumor progression and tumor vascularization (1).
[0006] Experimental evidence suggests that pro-inflammatory and pro-repair macrophages have the ability to regulate one another and impact the state of inflammation, most likely depending on the expression of the cytokines present in the local environment. These notions strengthen the theory that it is necessary to have a balance of pro-inflammatory macrophages and pro-repair macrophages and any skewing of this balance could potentially lead to the dysregulation of inflammation and associated diseases (1-2).
[0007] There remains a need for effective means of selectively inducing and regulating proinflammatory macrophages.
SUMMARY OF THE INVENTION
[0008] The invention meets these needs and others by providing methods and compositions that mediate selective inducement of pro-inflammatory macrophages. The invention provides, in one embodiment, a polynucleotide construct encoding a chimeric cellular receptor, in one embodiment, the construct comprises nucleic acid sequences encoding, in operable linkage, a myristoyiation sequence (Myr), a dimerizer domain, and an intracellular portion of the TLR4 receptor. In some embodiments, the construct further comprises a sequence that enables expression of a separate reporter molecule controlled by the same promoter. Examples of such a sequence include, but are not limited to, a ribosome skipping sequence and a cleavage sequence. One example of a reporter molecule is green fluorescent protein (GFP). In one embodiment, the construct is free of sequences encoding an extracellular portion of the TLR4 receptor, in preferred embodiments, the construct is sufficiently free of sequences encoding an extracellular portion of the TLR4 receptor that no extracellular iigands will bind, in one embodiment, the dimerizer domain is phenylalanine 36 to valine point mutation (F38V) derived from a mutated version of the endogenous FKBP12 protein.
[0009] In one embodiment, the nucleic acid sequences encoding the myristoyiation sequence (Myr), the dimerizer domain, and the intracellular portion of the TLR4 receptor comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 1. in another embodiment, the nucleic acid sequences encoding the myristoyiation sequence (Myr), the dimerizer domain, the intracellular portion of the TLR4 receptor, the ribosome skipping sequence, and the green fluorescent protein comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 2.
[0010] In one embodiment, the intracellular portion of the TLR4 receptor comprises an amino acid sequence having at least 90% sequence identify to the amino acid sequence of
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA NIIHEGFHKSRKVIVWSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQ
VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ
ID NO: 6). In some embodiments, the intracellular portion of the TLR4 receptor includes one or more of the following mutations: P714A, S744A, R745A, C747S, Y751A, E752A, E775A, K776S, Q792A, N792 A, Y794A, E796A, and E798A, wherein amino acid numbering refers to the human TLR4 receptor protein, amino acid residues 861 -839 of which are shown in SEQ ID NO: 6. Representative examples of the intracellular portion of the TLR4 receptor include, but are not limited to, polypeptides comprising an amino acid sequence selected from those shown in SEQ ID NO: 7-19, or SEQ ID NO: 20, the latter of which includes each of the point mutations indicated above,
[001 1] The invention further provides a method of producing a genetically engineered monocyte, in one embodiment, the method comprises the steps of: (a) contacting a monocyte with a construct as described herein under conditions sufficient to transfect the construct into the monocyte; and (b) culturing the monocyte transfected in step (a). The genetically engineered monocytes express the chimeric cellular receptor able to dimerize upon addition of a Chemical Inducer of Dimerization (CID) synthetic ligand, which dimerization activates signaling pathways independently of endogenous physiological ligands, thereby differentiating the transfected monocyte into a macrophage. In one embodiment, the CID synthetic ligand is a recombinant FK506 molecule, in one embodiment, the recombinant FK506 molecule is
AP20187.
[0012] Also provided is a genetically engineered monocyte produced in accordance with the methods described herein, as well as a pharmaceutical composition comprising a genetically engineered monocyte of the invention, in some embodiments, the composition further comprises a CID synthetic ligand. In one embodiment, the CID synthetic ligand is a
recombinant FK506 molecule, such as, for example, AP20187.
[0013] The invention additionally provides a method of reversibly inducing pro-inflammatory macrophages in a subject. In one embodiment, the method comprises: (a)administering the composition of claim 1 to a subject; and (b) administering a CID synthetic ligand to the subject. The CID synthetic ligand activates the genetically engineered monocytes, in one embodiment, the method further comprises: (c) withdrawing administration of the CID synthetic ligand and/or administering a washout ligand, thereby reversing the activation of the genetically engineered monocytes. The administering of step (a) can be via means suitable to the particular patient and treatment objective, such as by implantation into a target organ, injection into a target tissue, introduction of a scaffold to a target site, or intravenous administration, in some embodiments, the genetically engineered monocyte is pre-treated with a CID synthetic ligand prior to the administering of step (a), in such embodiments, pre-polarized ceils are administered to the subject, thereby jump-starting the process. The CID synthetic ligand is administered subsequently to maintain the cells in a polarized state in vivo.
[0014] The invention provides methods of treating conditions that would benefit from selective inducement of pro-inflammatory macrophages. In one embodiment, the invention provides a method of treating a fibrotic disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand. Representative examples of fibrotic disease include, but are not limited to, those selected from the group consisting of pulmonary fibrosis, cardiac fibrosis, and foreign body reaction. In another embodiment, the invention provides a method of treating an inflammatory disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand. In one embodiment, the inflammatory disease is a chronic inflammatory disease. Representative examples of chronic inflammatory disease include, but are not limited to, those selected from the group consisting of atherosclerosis and rheumatoid arthritis. In yet another embodiment, the invention provides a method of treating cancer inflammation comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand. BRIEF DESCRIPTION OF THE DRAWINGS
[0015] Figure 1. Engineered ΜΦε utilizing the Chemically Induced Dimerization (CID) system. Schematic representation of the engineered macrophages and the activation by CID drug.
[0016] Figure 2. Diagram of cTLR4 Construct and Engineered Receptor and Confirmation of cTLR4 construct expression. (A) The cTLR4 construct contains: a myristolation domain (Myr), an engineered dimerization domain (F36V), the cytoplasmic portion of the TLR4 domain
(cTLR4), a T2A ribosome skipping sequence, and a GFP tag. (B) Western blot probing for the FKBP12/F36V domain (35.5 kDa) containing iysates from RAW264.7 cells, ΜΦ-Τ2Α negative control cells, O-cTLR4 cells, and F2 positive control ceils. Φ-Τ2Α cells have been transduced with a construct that contains only the T2A ribosome skipping sequence with the GFP tag. F2 ceils have been transduced with just two adjacent F36V domains. Schematic of the cTLR4 DNA construct inserted. Myr=myristolation sequence, F36V=dimerizer domain, cTLR4=infraceliular portion of the TLR4 receptor, T2A=cleavage sequence, GFP=Green Fluorescent Protein.
[0017] Figure 3. Mouse F36V-cTLR4 DNA sequence (SEQ ID NO: 5).
[0018] Figure 4. Mouse F36V-cTLR4 Amino Acid sequence (SEQ ID NO: 4).
[0019] Figure 5. Residues 661 to 839 human TLR4 cytoplasmic/intracellular portion of the receptor (SEQ ID NO: 6). Mutations in ail three possible binding sites abrogate TLR4 T1R-TLR4 TIR interactions. Only potential binding sites i and II in the TLR4 T!R domain are critical for LPS-induced NF- Β signaling. An iRF3/GAL4-based assay suggests that binding site 111 may be important for !RF-3 activation.
[0020] Figure 8. Proposed mutations in human TLR4 cytoplasmic/intracellular portion amino acid residues 861 to 839 include: P714A, S744A, R745A, C747S, Y751A, E752A, E775A, K776S, Q792A, N792 A, Y794A, E796A, and E798A (SEQ ID NO: 20).
[0021] Figure 7, Control macrophages transduced with the pCDH-EF1- CS-T2A-copGFP vector were also generated (T2A RAW264.7). The presence of the construct was confirmed for the Φ- cTLR4 engineered cells via western blot analysis for the FKBP12/F36V domain with a band visible at about 35.5 kDa.
[0022] Figure 8. CiD-treated M -cTLR4 Cells Exhibit Increased Expression of TNFa, IL-6, and iNOS. Expression of classical inflammatory ΜΦ phenotype markers, determined by sandwich ELISA assay. Bar graphs show the levels of (A) TNFa and (B) IL-6 of CID-treated (50 nM) ΜΦ- cTLR4 cells compared to untreated, vehicle (100% EtOH), and LPS-treated ceils (100 ng/mL). Cell media was collected following 24 h treatment. (C) Western blot shows intensity of iNOS expression (130 kDa) for CID and LPS-treated IV^-cTLR4 cells when compared to controls. Ceils were lysed following 24 h treatment.
[0023] Figure 9. ΜΦ-οΤί 4 Ceils are influenced by IL-4 Treatment. Expression of classical inflammatory Φ phenotype markers following cocktail treatment of IL-4 (60 ng/mL) and CID drug (50 nM), LPS (100 ng/mL) or vehicle. Bar graphs show the levels of (A) TNFa and (B) IL-6 of cocktail-treated cells compared to controls. Cell medium was collected following 24 hour treatment, (C) Western blot shows intensity of iNOS expression (130 kDa) for cocktail -treated !V^-cTLR4 cells when compared to controls. Ceils were lysed following 24 hour treatment.
[0024] Figure 10. !V^-cTLR4 Cells Return to Baseline Levels 48 Hours Following CID Drug Withdrawal. CID drug withdrawal experiment, determined by IL-6 expression. Ceils were treated with CID drug (50 nM), LPS (100 ng/mL), or vehicle for 24 hours or left untreated for 24 hours. Media was collected at the indicated timepoints after complete CID drug withdrawal and IL-6 levels were measured at each timepoinf to determine activation intensity.
[0025] Figure 1 1. CID-treated Φ-cTLR4 Ceils Remain Activated for At Least 48 Hours.
Longevity study determined by expression of (A) TNF-a, (B) IL-6, and (C) iNOS in -cTL 4 cells. Media containing CID drug (50 nM) was changed every 24. Ceil media was collected at time points indicated,
[0026] Figure 12. CID-treated Md>-cTLR4 Ceils Activate the MyD88-dependent Pathway. (A) Western blot probing for p-ERK and total ERK. Cells were lysed at the time points indicated following CID drug (50 nM), LPS (100 ng/mL), or vehicle (100% EtOH) treatment. Top panel shows phosphorylated over total ERK ratio relative to the zero timepoinf for each subsequent timepoint. Bottom panel shows corresponding blots. (B) A Dual-luciferase® assay was used to determine NF-κΒ activity in IV -cTLR4 cells. Luciferase activity was measured 4 hours
following treatment of M0-TLR4 cells with CID drug or vehicle treatment. Luciferase activity was normalized to baseline Renilia luciferase activity.
[0027] Figure 3. CID-treated MO-cTLR4 Ceils Activate the yD88-independent Pathway. Western blot for p-IRF3 and total 1RF3. Cells were lysed at timepoints indicated following CID drug (50 n ), LPS (100 ng/mL), or vehicle treatment
[0028] Figure 14. Media From CID-treated ct3-cTLR4 Ceils Upregulate VCAM-1 and iCA -1 on Endothelial Ceils. Endothelial activation, determined by flow cytometry. Conditioned media from M -cTLR4 ceils treated for 6 hours with TNFa, CID, and vehicle was transferred to plated bEnd.3 endothelial cells and left to incubate for 12 hours. Following the 12 hour incubation, bEnd.3 ceils were then trypsinized and stained for both VCAM-1 and ICAM-1. (A & B)
Histograms showing intensity of VCAM-1 and ICAM-1 expression on bEnd.3 cells incubated with M -TLR4 conditioned media treated with TNFa (20 ng/mL), CID (50 nM), or vehicle (C & D) Histograms showing intensity of VCAM-1 and ICAM-1 expression on bEnd.3 ceils incubated with M -TLR4 conditioned media treated with TNFa (20 ng/mL), CID (50nM), or vehicle, as well as with or without TNFa neutralizing antibody (a-TNFa).
[0029] Figure 5. Dose of 50 nM CID Drug Produces Maximum Activation of M<t>-cTLR4 Ceils. CID drug dosage optimization for M<t>-cTLR4 cells, determined by IL-6 expression. An IL-6 ELISA was performed to test for the maximum signal of this cytokine in a CID drug titration experiment. CID drug doses ranged from 50 nM to 250 nM and CID-treated M t>-eTLR4 ceils were compared to controls. Cells media was collected following 24 hour treatment.
[0030] Figure 16. Mid Low M S>-cTLR4 Cells Exhibit Highest Signal to Noise Ratio. An IL-6 EL!SA was performed on unsorted ceils and four groups of sorted cells from the lowest to the most intense GFP intensity of M£f>~cTLR4 cells. Cells were treated with CID drug (50 nM), LPS (100 ng/mL), or vehicle for 24 hours or left untreated for 24 hours.
[0031] Figure 17. Md -cTLR4 Cells are influenced by IL-4 Treatment, Expression of the IL-10 cytokine (M2 marker) following cocktail treatment of IL-4 (60 ng/mL) and CID drug (50 nM), LPS (100 ng/mL), or vehicle. Bar graph shows the levels of IL-10 for cocktail-treated ceils compared to controls. Cell medium was collected following 48 hour treatment.
[0032] Figure 8. Co-culture Angiogenesis Assay Results. Top left panel shows example of the angiogenesis analyzer, which uses different colors to distinguish branches, twigs, segments, master segments, meshes, nodes surrounded by junctions, master junctions, isolated elements, small isolated elements, and extremities. Bottom left panel shows network formation for vehicle-treated MO-cTLR4 cells co-cultured with RAECs. Top right panel shows network formation for CID-treated (50 nM) M t>-cTLR4 ceils co-cultured with RAECs. Bottom right panel shows network formation for LPS-treated (100 ng/mL) Md>-cTLR4 cells co-cultured with RAECs.
[0033] Figure 19. Quantification of Co-culture Angiogenesis Assay. (A) Bar graph of quantification of master segments. (B) Bar graph of quantification of isolated segments. (C) Bar graph of quantification of branch number, (D) Bar graph of quantification of branching interval.
[0034] Figure 20. Schematic illustration showing how M -cTLR4 cells were tested in vivo using a atrigel plug. Liquid atrigel with <t>~cTLR4 cells were s.c. injected into a mouse and left to solidify. Mice were injected with CID drug every other day with 2 mg/kg mouse weight. Matrigel plugs were then removed following 7 or 14 days and analyzed.
[0035] Figure 21. 14 Day CID-treated Plugs with GFP and INOS Positive Cells with Co- localization, image taken at 40X magnification. Top left panel shows Dapi staining of nuclei, top right panel shows GFP positive cells, bottom left panel shows iNOS positive cells, and bottom right panel shows the merged image.
[0036] Figure 22. ELISA for VEGF in the supernatant of TLR4 engineered cells. (A) ELISA for VEGF in the supernatant using T2A = control ceil line, Untreated = TLR4 engineered cells with no treatment, EfOH = TLR4 engineered ceils treated with vehicle, + CID = TLR4 engineered cells treated with CID, + LPS = TLR4 engineered cells treated with LPS. (B) ELISA for VEGF in the supernatant of TLR4 engineered cells. Untreated = TLR4 engineered ceils with no treatment, INF-gamma = TLR4 engineered cells treated with INF-gamrna, CID+ INF-gamma = TLR4 engineered ceils treated with CID and INF- gamma, LPS + INF-gamma = TLR4 engineered ceils treated with LPS and INF- gamma, CID = TLR4 engineered ceils treated with CID.
DETAILED DESCRIPTION OF THE INVENTION
[0037] The invention is based on the surprising and unexpected discovery of a method of engineering a TLR4 receptor that is activated only in target cells. The invention provides a construct that exploits selected portions of the TLR4 receptor to which no extracellular ligand will bind. A dimerization domain is employed to allow for regulated activation when used in conjunction with a dimerizer drug. In addition, a myristoylation domain facilitates intracellular presentation. Constructs of the invention can be used to create engineered monocytes whose TLR4 receptors can be selectively activated to induce pro-inflammatory macrophages with administration of a dimerization agent. The engineered macrophages can be used to ameliorate conditions associated with excessive pro-repair macrophages, like cardiac fibrosis and solid tumor growth. Delivery of the engineered macrophages to sites of cardiac fibrosis can reduce the amount of fibrosis and scarring, and ameliorate cardiac function. Delivery of the engineered macrophages to solid tumors can reduce tumor growth and size.
Definitions
[0038] Ail scientific and technical terms used in this application have meanings commonly used in the art unless otherwise specified. As used in this application, the following words or phrases have the meanings specified,
[0039] As used herein, "intracellular portion of a TLR4 receptor" means a portion of the receptor that is sufficiently free of sequences encoding an extracellular portion of the TLR4 receptor that no extracellular iigands will bind.
[0040] As used herein, "polypeptide" includes proteins, fragments of proteins, and peptides, whether isolated from natural sources, produced by recombinant techniques or chemically synthesized. Peptides of the invention typically comprise at least about 6 amino acids,
[0041] A "mutation" is an alteration of a polynucleotide sequence, characterized either by an alteration in one or more nucleotide bases, or by an insertion of one or more nucleotides into the sequence, or by a deletion of one or more nucleotides from the sequence, or a combination of these.
[0042] As used herein, "promoter" means a region of DNA, generally upstream (5') of a coding region, which controls at least in part the initiation and level of transcription. Reference herein to a "promoter" is to be taken in its broadest context and includes the transcriptional regulatory sequences of a classical genomic gene, including a TATA box or a non-TATA box promoter, as well as additional regulatory elements (i.e., activating sequences, enhancers and silencers) that alter gene expression in response to developmental and/or environmental stimuli, or in a tissue- specific or cell-type-specific manner. A promoter is usually, but not necessarily, positioned upstream or 5', of a structural gene, the expression of which it regulates. Furthermore, the regulatory elements comprising a promoter are usually positioned within 2 kb of the start site of transcription of the gene, although they may also be many kb away. Promoters may contain additional specific regulatory elements, located more distal to the start site to further enhance expression in a ceil, and/or to alter the timing or inducibiiity of expression of a structural gene to which it is operabiy connected.
[0043] As used herein, "operabiy connected" or "operabiy linked" and the like is meant a linkage of polynucleotide elements in a functional relationship. A nucleic acid is "operabiy linked" when it is placed into a functional relationship with another nucleic acid sequence. For instance, a promoter or enhancer is operabiy linked to a coding sequence if it affects the transcription of the coding sequence. Operabiy linked means that the nucleic acid sequences being linked are typically contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame, "Operabiy linking" a promoter to a transcribable
polynucleotide is meant placing the transcribable polynucleotide (e.g., protein encoding
polynucleotide or other transcript) under the regulatory control of a promoter, which then controls the transcription and optionally translation of that polynucleotide.
[0044] The term "nucleic acid" or "polynucleotide" refers to a deoxyribonucieotide or ribonucleotide polymer in either single- or double-stranded form, and unless otherwise limited, encompasses known analogs of natural nucleotides that hybridize to nucleic acids in a manner similar to naturally-occurring nucleotides.
[0045] As used herein, "identical" means, with respect to amino acid sequences, that at any particular amino acid residue position in an aligned sequence, the amino acid residue is identical between the aligned sequences. The term "similarity" or "sequence similarity" as used herein, indicates that, at any particular position in the aligned sequences, the amino acid residue is of a similar type between the sequences. For example, leucine may be substituted for an isoleucine or valine residue. This type of substitution can be referred to as a conservative substitution. Preferably, a conservative substitution of any of the amino acid residues contained in a given amino acid sequence, these changes have no effect on the binding specificity or functional activity of the resulting antibody when compared to the unmodified antibody.
[0046] As used herein, "corresponding position" refers to an amino acid residue that is present in a second sequence at a position corresponding to a specified amino acid residue in a first sequence which is the same position as the position in the first sequence when the two sequences are aligned to allow for maximum sequence identity between the two sequences.
[0047] As used herein, "consists essentially of" or "consisting essentially of means that a polypeptide may have additional features or elements beyond those described, provided that such additional features or elements do not materially affect the ability of the antibody or antibody fragment to have the recited binding specificity. The antibody or antibody fragments comprising the polypeptides may have additional features or elements that do not interfere with the ability of the antibody or antibody fragments to bind to its target and exhibit its functional activity, e.g., disrupting or preventing bacterial adhesion to a mannose-coated surface. Such modifications may be introduced into the amino acid sequence in order to reduce the immunogenicity of the antibody. For example, a polypeptide consisting essentially of a specified sequence may contain one, two, three, four, five or more additional, deleted or substituted amino acids, at either end or at both ends of the sequence provided that these amino acids do not interfere with, inhibit, block or interrupt the role of the antibody or fragment in binding to its target and exhibiting its biological activity.
[0048] As used herein, a "heterologous" sequence or a "heterologous" molecule refers to a moiety not naturally occurring in conjunction with a recited sequence or molecule.
Representative examples of the heterologous molecule include, but are not limited to, a polypeptide, antibody, epitope, polynucleotide, small molecule or drug. Such heterologous
moieties can be useful for improving solubility, delivery, immunogenicity, efficacy, detection, or identification of the recited sequence or molecule. In some embodiments, the heterologous sequence is inert or an unrelated sequence.
[0049] As used herein, "pharmaceutically acceptable carrier" includes any material which, when combined with an active ingredient, allows the ingredient to retain bioiogicai activity and is non-reactive with the subject's immune system. Examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents. Preferred diluents for aerosol or parenteral administration are phosphate buffered saline or normal (0.9%) saline.
[0050] Compositions comprising such carriers are formulated by well-known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, (Remington and Gennaro 1990)).
[0051] As used herein, to "prevent" or "treat" a condition means to decrease or inhibit symptoms indicative of the condition or to delay the onset or reduce the severity of the condition.
[0052] As used herein, "adjuvant" includes those adjuvants commonly used in the art to facilitate an immune response. In some embodiments, such as with the use of a polynucleotide vaccine, an adjuvant such as a helper peptide or cytokine can be provided via a polynucleotide encoding the adjuvant.
[0053] As used herein, "a" or "an" means at least one, unless dearly indicated otherwise.
[0054] As used herein, the terms "comprise" or "include", or variations such as "comprises" or "comprising", "includes" or "including" mean the inclusion of a recited item or group of items, but not the exclusion of any other item or group of items.
Constructs and Compositions of the Invention
[0055] The invention provides, in one embodiment, a polynucleotide construct encoding a chimeric cellular receptor. In one embodiment, the construct comprises nucleic acid sequences encoding, in operable linkage, a myristoylation sequence (Myr), a dimerizer domain, and an intracellular portion of the TLR4 receptor. In some embodiments, the construct further comprises a sequence that enables expression of a separate reporter molecule controlled by the same promoter. Examples of such a sequence include, but are not limited to, a ribosome skipping sequence and a cleavage sequence. One example of a reporter molecule is green fluorescent protein (GFP). In one embodiment, the construct is free of sequences encoding an extracellular portion of the TLR4 receptor, in preferred embodiments, the construct is sufficiently free of sequences encoding an extracellular portion of the TLR4 receptor that no extracellular ligands will bind, in one embodiment, the dimerizer domain is phenylalanine 36 to
valine point mutation (F36V) derived from a mutated version of the endogenous FKBP12 protein.
[0058] In one embodiment, the nucleic acid sequences encoding the myristoylation sequence (Myr), the dimerizer domain, and the intracellular portion of the TLR4 receptor comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of:
[0057] MGSS SKPKDPSQRLEGVQVETISPGDGRTFPKRGQTC VHYTGMLEDGKKVDSSR DRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTiSPDYAYGATGHPGiiPPHATLVFDVEL LKLEGSIAGCKKYSRGESIYDAFVIYSSQNEDVWRNELVKNLEEGVPRFHLCLHYRDFIPGVAIA ANIIQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQVELY RLLSRNTYLEWEDNPLGRHIFWRRLKKALLDGKASNPEQTAEEEQETATWT (SEQ ID NO: 1).
[0058] In one embodiment, the nucleic acid sequences encoding the myristoylation sequence ( yr), the dimerizer domain, the intracellular portion of the TLR4 receptor, the ribosome skipping sequence, and the green fluorescent protein comprises a nucleotide sequence encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of:
[0059] GSSKSKPKDPSQR LEGVQVETISPGDG RTFPKRGQTCVV HYTG LEDGKKVDSSRDR KPFKF LGKQEVI RGWEEGVAQMS VGQRAKLT!SPDYAYGA TG H PG I I P P H ATLVF D V ELLKLEGS I AGC KKYSRGESIYDAFVIYSSQN E D WV R N ELVKN LEEGVPRFH LC LHY R DFI PGVAIAAN MQEGFH KSR KV!VVVSR H F!QSRWC! FEYE!AQT WQFLSSRSGI I FIVLEKVEKSLLRQQVELYRLLSRNTYLEWEDN PL GRH I FWRRLKKALLDGKASN PEQTAEEEQETATWTEFEGSAAAE GRGSLLTCG DVEENPG PSG ESDESGLPA E! ECRITGTLNGVE FELVGGGEGTPKQG RMTN KM KSTKGALTFSPYLLSHVMGYG FY H FGTYPSGYEN PFLHAI N NGGYTNTRI EKYEDGGVLHVSFSYRYEA GRV! GDFKVVGTGFPEDSVi FTDKI !RSNATVEH LHP GDNVLVG SFARTFSLRDGGYYSFVVDSH M H FKSAI H PSI LQNGGPM FAFRRV EELHSNTELGIVEYQHAFKTPIAF (SEQ ID NO: 2).
[0060] In one embodiment, the intracellular portion of the TLR4 receptor comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of
LAGCIKYGRGENIYDAFVIYSSQDEDVWRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA NIIHEGFHKSRKVIVWSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQ
VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSi (SEQ ID NO: 6). In some embodiments, the intracellular portion of the TLR4 receptor includes one or more of the following mutations: P714A, S744A, R745A, C747S, Y751A, E752A, E775A,
K776S, Q792A, N792 A, Y794A, E796A, and E798A. Representative examples of the intracellular portion of the TLR4 receptor include, but are not limited to, polypeptides comprising an amino acid sequence selected from:
[0061] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIAGVAIA ANiiHEGFHKSRKViVVVSQHFiQSRWC!FEYEiAQTWQFLSSRAGi!FIVLQKVEKTLLRQ
QVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 7);
[0062] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
A NHHEGFHKSRKVIVVVSQHFIQARWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSW PEGTVGTGCNWQEATSI (SEQ ID NO: 8);
[0063] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELV NLEEGVPPFQLCLHYRDFIPGVAIA A NilHEGFHKSRKVlVVVSQHFIQSAWCIFEYEIAQTWQFLSSRAGIIFiVLQKVEKTLLRQQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 9);
[0064] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA A NIIHEGFHKSRKVIWVSQHFIQSRWSIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 10);
[0065] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
A NiiHEGFHKSRKViVVVSQHFIQSRWCIFEAEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 1 1);
[0066] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA A NIIHEGFHKSRKVIWVSQHFIQSRWCIFEYAIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQ
VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSi (SEQ ID NO: 12);
[0067] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
A NilHEGFHKSRKVIVVVSQHFIQSRWClFEYEIAQTWQFLSSRAGilFIVLQKVAKTLLRQQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 13);
[0068] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA A NIIHEGFHKSRKVIWVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVESTLLRQQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 14);
[0069] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELV NLEEGVPPFQLCLHYRDFIPGVAIA A NI!HEGFHKSRKV!VVVSQHFiQSRWCIFEYE!AQTWQFLSSRAGilFIVLQKVEKTLLRAQ VELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSi (SEQ ID NO: 15);
[0070] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA A NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQ VELYRLLSRATYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 16);
[0071] LAGCIKYGRGENiYDAFVIYSSQDEDVlA/RNELVKNLEEGVPPFQLCLHYRDFIPGVAIA A N II H EGFH KSRKVI VVVSQH FIQSRWCI FEYEI AQTWQFLSSRAGI I Fl VLQKVEKTLLRQQ VELYRLLSRNTALEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSi (SEQ ID NO: 17);
[0072] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
A Nl I HEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGI I Fl VLQKVEKTLLRQQ VELYRLLSRNTYLAWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 18); and
[0073] LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIA
A Nl I HEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGI I Fl VLQKVEKTLLRQQ VELYRLLSRNTYLEWADSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI (SEQ ID NO: 19).
[0074] The construct described herein was made using a TLR4-Sport6 Vector (Open
Biosystems):
[0075] The construct begins with TLR4 (particularly amino acids 675-835; transmembrane helices underlined; TIR cytoplasmic domain in bold and highlighted; a linker sequence is added between them; the proline that is both bold and underlined is needed for signaling):
[0076] MMPPWLLARTLIMALFFSCL PGSLNPCIEVVPNITYQCMDQKL
SKVPDDI PSSTKNIDLSFNPL ILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHH LSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLI LKKLNVAHNF IHSCKLPAYFSNL NLVHVDLSY YIQTIT NDLQFLRENPQV LSLDISLNPIDFIQ DQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIM EGLCDV IDEFRLTHTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLS
11P.CQLKOFPTLDLPFLKSLTLTMNKGSI SFK VALPSLSYLDLSRNALSFSGCCSYS
DLGTNSLRHLDLSFNGAIIMSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYL DISYTNTKIDFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQ ISWGVFDTLHRLQLLNMSHNNLLFLDSSHYNQLYSLSTLDCSFNRIETSKGILQHFPK SLAFFNLTNNSVACICEHQKFLQ VKDQKQFLVNVEQMTCATPVEMNTSLVLDFNNST CYMYKT11 SVSVISVIWSTVAFLIYHFYFHLILIAGCKKYSRGESXYDA V YSSQK
ED RtTELV l<iLEEGVPRFHLC^
QSRWCI EYEIAQTWQFLSSl^GIIFIVLE VEKSLLl^VELYRLLSRNTXLEWEDN
PLGRHXF RRL ALLDG ASNPEQTAEEEQE A W| (SEQ ID NO: 21} . [0077] Nucleotide sequence for cTLR4 (by uniprot.org; 2207-2738; Xho 1 is underlined):
[0078] 5 ' -ATTGCTGGCTGTAAAAAGTACAGCAGAGGAGAAAGCATCTATGATGCATTTGTGAT
CTACTCGAGTCAGAATGAGGAGTGGGTGAGAAATGAGCTGGTAAAGAATT AGAAGAAGGAGTGCCCCGCTTTCACC TCTGCCTTCACTACAGAGACTTTATTCCTGGTGTAGCCIATTGCTGCCAACATCATCCAGGAAGGCTTCCACAAGAGC CGGAAGGTTATTGTGGTAGTGTCTAGACACTTTATTCAGAGCCGTTGGTGTATCTTTGAATATGAGATTGCTCAAAC ATGGCAGTTTCTGAGGAGCCGCTCTGGCA CATCTTCA TGTCCTTGAGAAGGT GAGAAGTCCCTGCTGAGGCAGC AGGTGGAATTGTATCGCCTTCTTAGCAGAAACACCTACCTGGAATGGGAGGACAATCCTCTGGGGAGGCACATCTTC TGGAGAAGACT AAAAATGCCCTATTGGATGGAAAAGCCTCGAATCCTGAGCAAACAGCAGAGGAAGAACAAGAAAC GGCAACTTGGACC-3' (SEQ ID NO: 22) . [0079] Final engineered construct DNA sequence (initial lowercase sequence is EF1 promoter; followed by, in uppercase, Kozak sequence, myristoyiation domain (underlined), F36V domain (underlined), cTLR4 sequence (underlined), and in lowercase and underlined, T2A sequence and copGFP; SEQ ID NO: 3):
[0080] aaggatctgcgatcgctccggtgcccgtcagtgggcagagcgcacatcgcccacagtccccgagaagttggggggagg ggtcggcaattgaacgggtgcctagagaaggtggcgcggggtaaactgggaaagtgatgtcgtgtactggctccgcctttttcccga gggtgggggagaaccgtatataagtgcagtagtcgccgtgaacgttctttttcgcaacgggtttgccgccagaacacagctgaagctt cgaggggctcgcatctctccttcacgcgcccgccgccctacctgaggccgccatccacgccggttgagtcgcgttctgccgcctcccg cctgtggtgcctcctgaactgcgtccgccgtctaggtaagtttaaagctcaggtcgagaccgggcctttgtccggcgctcccttggagcc tacctagactcagccggctctccacgctttgcctgaccctgcttgctcaactctacgtctttgtttcgttttctgttctgcgccgttacagatcc aaqctgtgaccggcgcctactctagagctagcGCCACCATGGGGAGTAGCAAGAGCAAGCCTAAGGACC CCAGCCAGCGCCTCGAGGGCGTGCAGGTGGAGACTATCTCCCCAGGAGACGGGCGCAC CTTCCCCAAGCGCGGCCAGACCTGCGTGGTGCACTACACCGGGATGCTTGAAGATGGAA AGAAAGTTGATTCCTCCCGGGACAGAAACAAGCCCTTTAAGTTTATGCTAGGCAAGCAGG AGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGTCAGAGAGCCAAA CTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCAC ATGCCACTCTCGTCTTCGATGTGGAGCTTCTAAAACTGGAAGGATCCATTGCTGGCTGTAA AAAGTACAGCAGAGGAGAAAGCATCTATGATGCATTTGTGATCTACTCGAGTCAGAATGAG GACTGGGTGAGAAATGAGCTAGTAAAGAATTTAGAAGAAGGAGTGCCCCGCTTTCACCTC TGCCTTCACTACAGAGACTTTATTCCTGGTGTAGCCATTGCTGCCAACATCATCCAGGAAG GCTTCCACAAGAGCCGGAAGGTTATTGTGGTAGTGTCTAGACACTTTATTCAGAGCCGTTG GTGTATCTTTGAATATGAGATTGCTCAAACATGGCAGTTTCTGAGCAGCCGCTCTGGCATC ATCTTCATTGTCCTTGAGAAGGTTGAGAAGTCCCTGCTGAGGCAGCAGGTGGAATTGTATC
GCCTTCTTAGCAGAAACACCTACCTGGAATGGGAGGACAATCCTCTGGGGAGGCACATCT
TCTGGAGAAGACTTAAAAAGGCCCTATTGGATGGAAAAGCCTCGAATCCTGAGCAAACAG
CAGAGGAAGAACAAGAAACGGCAACTTGGACCgaaticgaaqgatccgcqgccqcigagggcagaqgaag tcttctaacatgcgqtgacqtgqaggagaatcccggcccttccggaatgqagagcgacgagagcgqcctgcccgccatggagatc gagtgccgcatcaccggcaccctgaacggcgtggagttcgagctggtgggcggcggagagggcacccccaagcagggccgcat gaccaacaagatgaagagcaccaaaggcgccctgaccttcagcccctacctgctgagccacgtgatgggctacggcttctaccact tcggcacctaccccagcggctacgagaaccccttcctgcacgccatcaacaacggcggctacaccaacacccgcatcgagaagt acqaggacgqcqgcgtqctgcacgtgaqcttcagctaccgctacgagqccqqccqcqigaicggcgacttcaaggtggtgggcac cqgcttccccqaggacagcgtgatcttcaccgacaaqatcatccgcagcaacgccaccgtggaqcacctgcaccccaiqqgcgat aacgtgctggtgggcagcttcgcccgcaccttcagcctgcgcgacggcggctactacagcttcgtggtggacagccacatgcacttc aagagcgccatccaccccagcatcctgcagaacgggggccccatgttcgccttccgccgcgtggaggagctgcacagcaacacc gaqctggqcaicgtggaqtaccagcacgccttcaagacccccatcgccttcgcc.
[0081] The protein sequence translated and labeled (SEQ ID NO: 4):
[0082] MGSSKSKPKDPSQRL (myristoy!ation domain)
EGVQVETISPGDGRTFPKRGQTCWHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWE EGVAQ SVGQRA LTISPDYAYGATGHPGIIPPHATLVFDVELLKLE (F38V domasn)
GSIAGCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFHLCLHYRDFIPGVAIAANII QEGFHKSRKVIWVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQVELYRLL SRNTYLEWEDNPLGRH!FWRRLKKALLDGKASNPEQTAEEEQETATWT (cTLR4 domain) EFEGSAAA (spacer) EGRGSLLTCGDVEENPGP (T2A sequence) SGMESDESG (spacer) L PAMEIECRITGTLNGVEFELVGGGEGTPKQGRMTNKMKSTKGALTFSPYLLSHVMGYGFYHF GTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKWGTGFPEDSVI FTDKIIRSNATVEHLHPMGDNVLVGSFARTFSLRDGGYYSFWDSHMHFKSAIHPSILQNGGP FAFRRVEELHSNTELGIVEYQHAFKTPIAF (copGFP) A.
[0083] In one embodiment, the invention provides a composition comprising a construct of the invention, in one embodiment, the construct encodes the myristoylation domain, the F36V domain, and the cTLR4 domain. Optionally, the construct further comprises the T2A sequence and copGFP, or reporter sequence, in another embodiment, the invention provides a composition comprising a cell transfected with a construct of the invention. Typically, the ceil is a monocyte.
[0084] In one embodiment, the composition is a pharmaceutical composition. The composition can comprise a therapeutically or prophylactically effective amount of construct, or engineered monocyte transfected with same, of the invention. An effective amount is an amount sufficient to achieve pro-inflammatory macrophage activation, or to alleviate symptoms of a condition, disease, or infection. In some embodiments, the composition of the invention further comprises a carrier. The carrier can be a pharmaceutically acceptable carrier, or other carrier that facilitates use of the composition.
[0085] While any suitable carrier known to those of ordinary skill in the art may be employed in the pharmaceutical compositions of this invention, the type of carrier will vary depending on the mode of administration. Compositions of the present invention may be formulated for any appropriate manner of administration, including for example, topical, oral, nasal, intravenous, intracranial, intraperitoneal, subcutaneous or intramuscular administration. For parenteral administration, such as subcutaneous injection, the carrier preferably comprises water, saline, alcohol, a fat, a wax or a buffer. For oral administration, any of the above carriers or a solid carrier, such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and magnesium carbonate, may be employed.
[0086] Such compositions may also comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, chelating agents such as EDTA or glutathione, adjuvants (e.g., aluminum hydroxide) and/or preservatives.
Alternatively, compositions of the present invention may be formulated as a lyophilizate.
Compounds may also be encapsulated within liposomes via known methods.
Administration of the Compositions
[0087] Treatment includes prophylaxis and therapy. Prophylaxis or treatment can be accomplished by a single direct injection at a single time point or multiple time points.
Administration can also be nearly simultaneous to multiple sites. Patients or subjects include mammals, such as human, bovine, equine, canine, feline, porcine, and ovine animals as well as other veterinary subjects. Typical patients or subjects are human.
[0088] Compositions are typically administered in vivo via parenteral (e.g. intravenous, subcutaneous, and intramuscular) or other traditional direct routes, such as buccal/sublingual, rectal, oral, nasal, topical, (such as transdermal and ophthalmic), vaginal, pulmonary, intraarterial, intraperitoneal, intraocular, or intranasal routes or directly into a specific tissue, such as by implantation into a target organ, injection into a target tissue, or introduction of a scaffold to a target site.
[0089] The compositions are administered in any suitable manner, often with pharmaceutically acceptable carriers. Suitable methods of administering cells in the context of the present invention to a patient are available, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective reaction than another route.
[0090] The dose administered to a patient, in the context of the present invention should be sufficient to effect a beneficial therapeutic response in the patient over time, or to inhibit infection or disease due to infection. Thus, the composition is administered to a patient in an amount sufficient to alleviate, reduce, cure or at least partially arrest symptoms and/or
complications from the disease or infection. An amount adequate to accomplish this is defined as a "therapeutically effective dose."
[0091] The dose will be determined by the activity of the composition produced and the condition of the patient, as well as the body weight or surface areas of the patient to be treated. The size of the dose also will be determined by the existence, nature, and extent of any adverse side effects that accompany the administration of a particular composition in a particular patient, in determining the effective amount of the composition to be administered in the treatment or prophylaxis of disease, the physician needs to evaluate the progression of the disease, and any treatment-related toxicity. Methods and Uses of the Invention
[0092] The invention further provides a method of producing a genetically engineered monocyte. In one embodiment, the method comprises the steps of: (a) contacting a monocyte with a construct as described herein under conditions sufficient to fransfect the construct into the monocyte; and (b) cuituring the monocyte transfected in step (a). The genetically
engineered monocytes express the chimeric cellular receptor able to dimerize upon addition of a Chemical inducer of Dimerization (CID) synthetic iigand, which dimerization activates signaling pathways independently of endogenous physiological ligands, thereby differentiating the transfected monocyte into a macrophage. In one embodiment, the CID synthetic iigand is a recombinant FK508 molecule. In one embodiment, the recombinant FK506 molecule is
AP20187.
[0093] Also provided is a genetically engineered monocyte produced in accordance with the methods described herein, as well as a pharmaceutical composition comprising a genetically engineered monocyte of the invention, in some embodiments, the composition further comprises a CID synthetic iigand. in one embodiment, the CID synthetic Iigand is a
recombinant FK506 molecule, such as, for example, AP20187.
[0094] The invention additionally provides a method of reversibly inducing pro-inflammatory macrophages in a subject. In one embodiment, the method comprises: (a) administering the composition of claim 11 to a subject; and (b) administering a CID synthetic iigand to the subject. The CID synthetic Iigand activates the genetically engineered monocytes, in one embodiment, the method further comprises: (c) withdrawing administration of the CID synthetic Iigand and/or administering a washout iigand, thereby reversing the activation of the genetically engineered monocytes. One example of a washout Iigand for use with AP20187 is B/B Washout Ligand (Clontech). The administering of step (a) can be via means suitable to the particular patient and treatment objective, such as by implantation into a target organ, injection into a target tissue, introduction of a scaffold to a target site, or intravenous administration. In some embodiments, the genetically engineered monocyte is pre-treated with a CID synthetic Iigand prior to the
administering of step (a). In such embodiments, pre-polarized cells are administered to the subject, thereby jump-starting the process. The C!D synthetic ligand is administered
subsequently to maintain the cells in a polarized state in vivo,
[0095] The invention provides methods of treating conditions that would benefit from selective inducement of pro-inflammatory macrophages, in one embodiment, the invention provides a method of treating a fibrotic disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand. Representative examples of fibrotic disease include, but are not limited to, those selected from the group consisting of pulmonary fibrosis, cardiac fibrosis, and foreign body reaction. In another embodiment, the invention provides a method of treating an inflammatory disease comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand. In one embodiment, the inflammatory disease is a chronic inflammatory disease. Representative examples of chronic inflammatory disease include, but are not limited to, those selected from the group consisting of atherosclerosis and rheumatoid arthritis. In yet another embodiment, the invention provides a method of treating cancer inflammation comprising administering to a subject in need thereof the pharmaceutical composition of the invention and a CID synthetic ligand.
Kits
[0098] For use in the methods described herein, kits are also within the scope of the invention. Such kits can comprise a package or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements (e.g., constructs, ceils, dimerizing agent, matrigel, scaffold) to be used in the method. Typically, the kit comprises one or more constructs of the invention. The kit further comprises one or more containers, with one or more constructs stored in the containers. The kit of the invention will typically comprise the container described above and one or more other containers comprising materials desirable from a commercial and user standpoint, including buffers, diluents, filters, needles, syringes, and package inserts with instructions for use. in addition, a label can be provided on the container to indicate that the composition is used for a specific therapeutic or non-therapeutic application, and can also indicate directions for use.
Directions and or other information can also be included on an insert which is included with the kit.
EXAMPLES
[0097] The following examples are presented to illustrate the present invention and to assist one of ordinary skill in making and using the same. The examples are not intended in any way to otherwise limit the scope of the invention.
Example 1 : Engineering macrophages to control the inflammatory response and angiogenesis
[0098] The physiological innate inflammatory response requires a highly orchestrated series of events characterized by four basic phases: reaction, regrowth, remodeling, and resolution. [1] During the course of this healing process, ΜΦ play an active role in secreting chemokines and cytokines that direct the recruitment and egress of various immune ceil types at the injured site. The functional ΜΦ phenotype depends on the microenvironment of the injured site and alters accordingly during the normal process of healing. [2] However, dysreguiation of the ΜΦ phenotype can lead to a non-ideal healing outcome.
[0099] Monocytes are the precursor ceils to ΜΦ, which are a main inflammatory ceil type and are known to be key players in the inflammatory response. When activated, ΜΦ are classified into two major phenotypes that can be broadly defined as: pro-inflammatory ΜΦ and pro- healing ΜΦ. in literature, pro-inflammatory Φ are often denoted as "classically activated" or "M1" and pro-healing ΜΦ are denoted as "alternatively activated" or "M2." However, these two major ΜΦ phenotypes are the two extremes on the phenotype scale, as intermediate macrophage types also exist. [3] During the inflammatory reaction, M1 ΜΦ are the first to arrive at the inflammation site and this ΜΦ population subsequently shifts to a less inflammatory pro- healing M2 ΜΦ population during the repair phase. Pro-inflammatory ΜΦ release inflammatory cytokines, such as TNFa and IL-6 as well as produce reactive oxygen species (ROS).[4, 5] In comparison, the pro-healing ΜΦ phenotype has been shown to produce cytokines, such as IL- 10 and ΤΘΡβΙ which are markers that can decrease the pro-inflammatory response and promote healing and fibrosis. [3]
[0100] Angiogenesis, or the formation of new blood vessels, is a critical step in the wound healing process. In the course of the inflammation response, pro-inflammatory ΜΦ secrete TNFa and IFN-γ, which regulate expression of adhesion molecules on EC. These cytokines promote leukocyte adhesion to EC and extravasation into tissues by increasing expression of both cell surface and soluble forms of vascular ceil adhesion protein 1 (VCAM-1) and intercellular adhesion molecule 1 (ICAM-1).[6-9] These two adhesion molecules belong to the immunoglobulin superfamily group and have been implicated, along with integrins, in pro- angiogenic processes. [10, 11]
[0101] This study utilizes engineered pro-inflammatory M1-iike cells to investigate EC activation. The engineered cells were designed by using the chemical inducer of dimerization (CID) technology to induce activation of the TLR4 receptor independent of the
lipopolysaccharides (LPS) exogenous ligand, which is a well-established inducer of the M1 ΜΦ phenotype. [12] The CID technology has been used in several other groups to control a variety of cell signaling pathwa s. [13- 17] For this system to function, the intracellular domain of a desired receptor is fused to a F36V protein, which is a mutated version of the FKBP12 protein.
This F36V version has a binding site for a cell permeable CID drug. When CID drug is present two F38V proteins will dimerize, bringing the desired intracellular domains in close enough proximity to activate receptor-specific pathways. These cells can be activated by the exposure to CID drug and be deactivated by the withdrawal of CID drug. Currently in literature there have been no cellular engineering approaches to control or modulate Φ polarization to determine ideal healing conditions. Having the ability to control Φ polarization during and after an inflammatory response could potentially allow for the manipulation of the host response and the optimal healing of multiple inflammatory conditions.
Methods and Materials:
Reagents and antibodies
[0102] The monoclonal anti-human/mouse/rat FKBP12 antibody was purchased from Thermo Scientific. The following antibodies were purchased from Ceil Signaling: p44/42 MARK, Phospho -p44/42 MARK, IRF3 and Phospho-IRF3. The anti-iNOS/NOS type II antibody was purchased from BD Biosciences. The anti-mouse CD106 (VCAM-1) PE, the anti-mouse CD54 (ICAM-1) PE, the rat lgG2b isotype, and the anti-mouse TNFa antibodies were purchased from eBioscience. The HRP-conjugated goaf-anti-rabbit antibody was obtained from Jackson ImmunoResearch Laboratories, Inc. and the HRP-conjugated goat-anti-mouse antibody was obtained from Life Technologies. LPS and recombinant mouse TNFa was purchased from Sigma and recombinant mouse IL-4 was purchased from eBioscience. AP20187 (CID drug) was purchased from Ciontech. Lipofectamine 2000 was purchased from invitrogen. The Dual- Luciferase ® reporter assay system was obtained from Promega Corporation.
P!asm d construction of cTLR4
[0103] The mouse Sport6-TLR4 vector was purchased from Open Biosystems. The
cytoplasmic portion of TLR4 (cTLR4) was amplified (mRNA base pairs 2207-2748) and inserted into a pBluescript II KS+ vector with an existing myristolation domain and engineered F36V domain (pBluescript-Myr-F36V) (55) following Bam HI and EcoRV restriction enzyme (RE) cuts. PGR products were gel purified using a QIAEX H gel extraction kit (Qiagen) before ligations were performed. This resulted in a pBluescript-Myr-F36V-cTLR4 construct. The pCDH-EF1 a- MCS-T2A-copGFP lentiviral cDNA and expression vector was purchased from System
Biosciences. This vector was cut in the CS with both Nhei and EcoRI, and a PGR amplified portion of the Myr-F38V-cTLR4 sequence was iigated into this site within the pCDH-EF1a- CS-T2A-copGFP vector (7.26 kb). This resulted in the final cTLR4 lentiviral plasmid: pCDH- EF1 a- yr-F36V-cTLR4-T2A-copGFP (8.18 kb).
Cell transduction of cTLR4 fentivira! constructs
[0104] We utilized a 3rd generation lentiviral vector, pCDH (System Biosciences), carrying the cTLR4 gene under the control of the EF-1a promoter. For stable lentiviral transductions, 5x106
HEK293T packaging ceiis were seeded in 10-cm cell culture dishes that were previously coated with 50 ug/mL poly-D-lysine hydrobromide (Sigma). Culture medium was changed just prior to transduction. In total, 12 xg piasmid DNA was used for each 10-cm dish (2.8 ig transfer vector (cTLR4), 0.9 g pSL3 (vesicular stomatitis virus G envelope), 5.4 pSL4 (HIV-1 gag/poi packing genes), and 2.8 pSL5 (rev gene required for HIV-1 envelope protein expression). DNA and Lipofectamine 2000™ (Life Technologies) were diluted in Opti-MEM® medium
(Gibco) separately. After a 5 minute incubation, DNA and lipofectamine were combined and incubated for 20 minutes at room temperature. The complexes were then added, drop-wise, to cell dishes with 8 mL growth media and medium was replaced after 14-16 hours. Virus supernatant was collected following an additional 48 hours by filtering through a 0.45 prn filter. Filtered virus supernatant was then added either directly or in concentrated form to previously plated RAW264.7 cells (5x105 cells per well) in 6-well plates. Ceils were then sorted for GFP expression to acquire >90% transduction efficiency.
Cell culture
[0105] RAW264.7 and bEnd.3 cells were obtained from ATCC. RAW264.7 and bEnd.3 cells were cultured in DME medium from invitrogen containing 10% (v/v) heat-inactivated FBS and 100 U/m! pen/strep (Invitrogen) and incubated at 37°C with 5% C02.
Western Blotting
[0106] Protein from RAW264.7, ΜΦ-Τ2Α (vector control cells), and O-cTLR4 cell monolayers were extracted by lysis in Laemmii buffer containing 1x Halt Protease inhibitor cocktail (Thermo Scientific). Following lysis, samples were boiled and protein concentration was determined by performing a BCA assay from Thermo Scientific. Samples (10-30 g of lysates) were run on 4- 20% Mini-PROTEAN® TGX precast polyacrylamide gels (Bio-Rad). Protein from gels were transferred onto PVDF membranes and probed with the appropriate primary antibody overnight. Membranes were washed between each antibody incubation and subsequently probed with the appropriate HRP-conjugated secondary antibody (Life Technologies). The Clarity Western ECL Substrate (Bio-Rad) was used to detect bands.
Cytokine Profile
[0107] We tested IL-6 and TNFa concentrations in supernatants of transduced RAW264.7 cells in vitro. Briefly, -cTLR4 cells (1 χ 106) were plated in each well of a 6-well plate and treated with vehicle (100% EtOH), LPS (100 ng/mL), CI D drug (50 nM), or left untreated in DMEM without serum. Supernatants were collected and tested using the mouse I L-6 EL!SA Ready- SET-Gol and the mouse TNFa ELISA Ready-SET-Go! Kits (eBioscience) according to the manufacturers instructions. Plates were read at 450 nM with a 570 nM wavelength subtraction, normalized to standard solutions, and concentrations (pg/mL) were calculated.
Luciferase Assay
[0108] Two hundred thousand cells/well were seeded in 24-weli plates. The following day each well was transfected with a total of 0.8 μg p!asmid DNA, which consisted of a 20: 1 ratio of pB!IX-LUC (N FKB reporter construct):pRL (Renil!a luciferase construct). The promoterless pGL4.10 vector was also transfected in a 20:1 ratio of pGL4.10:pRL, as a control. Transfections of each well were performed with 2 μΙ_ Lipofectamine 2000 (invitrogen). The following morning transfection reagents were replaced with fresh serum-free medium and treated with either vehicle (100% EtOH) or CID drug (50 nM) for 4 hours. Cell lysate was harvested and luciferase activity was measured using a Dual-Luciferase ® reporter assay kit (Promega) according to manufacturer's instructions. All groups were normalized to Reniila luciferase.
Endothelial Cell Activation
[0109] 0-cTRL4 conditioned media, following a 6 hour treatment in 6-well plates (1x106 cells/well), was transferred to plated bEnd.3 cells in a 12-well plate (0.2x108 cells/well). Before media transfer, TNFa neutralizing and IgG isotype antibody (1 Mg/mL) were incubated in media for 15 minutes. Media was then added to bEnd.3 cells for 12 hours. Following incubation, bEnd.3 ceils were trypsinized and stained for ICAM-1 and VCAM-1. Cell cytometry was performed on a FACSCanto II Cell Analyzer (BD Biosciences) equipped with 488 nm and 647 nm lasers. Typically, 10,000 cells were analyzed per sample. Experiments were repeated at least three times. Non-specific staining was evaluated using a monoclonal antibody for igG2b and igG2a (eBioscience).
Statistical Analysis
[0110] Results are expressed as mean ± SE unless otherwise specified. Significance between groups was determined by ANOVA and p-vaiues less than 0.05 were considered significant.
Results
Engineering IVI -cTLR4 pro-inflammatory macrophages
[01 1] With the goal of developing inducible M1 Φ cells, we have engineered the murine monocytic cell line RAW264.7 to express a fusion protein comprising the intracellular TLR4 signaling domain and F36V-dimerization domains that bind to a cell permeable CID drug (Figure 1A). The cTLR4 construct is in a pCDH expression system. The 5' end of the construct starts with a myristoylation domain (Myr), which allows targeting to the membrane to mirror the spatial localization of the endogenous full length TLR4 domain. The Myr domain is followed by the engineered F36V dimerization domain, which has a binding site for the CID drug. This domain is linked to the cTLR4 domain, which is only the cytoplasmic portion of the receptor that is necessary for proper signal transduction. This design allows dimerization via a F36V-F36V
interaction with the homodimerization CID drug (AP20187). Lastly, there is a T2A ribosome skipping sequence that allows the separate expression of GFP at the 3! end of the construct.
[0112] Delivery of the cTLR4 engineered constructs to RAW284.7 cells was achieved via lentivirai methods. Control Φ ceils were also generated. These ceils were transfected with constructs lacking the cytoplasmic and engineered domain (ΜΦ-Τ2Α). Confirmation that the whole engineered construct was being transcribed was validated by the expression of the GFP reporter marker in the IV^-cTLR4 cell line. Protein expression of the cTLR4 construct in the IV^~cTLR4 engineered cells was verified by western blot analysis for the FKBP12/F38V domain. A corresponding 35.5 kDa band can be seen in Figure B.
Pro-inffamrnatory activation of -cTLR4 ceils
[01 13] Polarized classical inflammatory ΜΦ are known to have increased levels of TNFa, IL-6, and iNOS.[8] Therefore the IV^-cTLR4 cells were tested for the presence and levels of these markers. Engineered fv^-cTLR4 cells were seeded in 6-weii culture plates overnight and then treated for 24 hours with CID drug, vehicle, or LPS as a positive control. Polarization was confirmed by ELISA and western blot analyses. CID-treated IV^-cTLR4 cells expressed increased TNFa and IL-6 levels when compared to uninduced controls (Figure 2A & 2B).
However, the CID-treated !V^-cTLR4 cell levels were not as high as the LPS-treated cells. We also tested for iNOS via a western blot and observed similar results with this marker. The positive control LPS-treated cells had a substantial increase in iNOS expression and there is a band evident at 130 kDa in the CID-treated lane, however, it has much lower intensity than the LPS-treated ceils (Figure 2C). The difference in LPS-treated groups and CID-treated groups can be attributed to the fact that LPS also acts on other receptors, such as CD14 and the Macrophage Scavenger Receptor, in which both of these receptor pathways can lead to N F-KB responses. Thus, there is potentially more input signal from LPS than our CID drug, which only activates through TLR4.
[0114] Diversity and plasticity are hallmarks of cells from the Φ lineage and they can change phenotype depending on the surrounding microenvironment.[18] Thus, we tested how the expression of classical ΜΦ markers in the !V^~cTLR4 cells were influenced by a M2 ΜΦ activator. Engineered cells were treated with a cocktail of either vehicle/! L-4, CID/IL-4, or LPS/1 L-4, as well as the appropriate controls. The degree of polarization was assessed by EL!SA and western blot analyses for IL-6, TNFa, and iNOS (Figure 3). Both CID- and LPS- treated groups responded similarly to the I L-4 cocktail treatment and exhibited about half the expression of IL-6 and iNOS when compared to treatment groups without I L-4. However, TNFa levels for both CID drug and LPS with and without I L-4 were not significantly different.
TO-cTLR4 cells response to CID drug dose, withdrawal, and length of treatment
[01 5] For IV1 -cTLR4 cells, IL-6 levels are elevated in CID-treated cells when compared to controls. In order to find the optimal in vitro dosage, an IL-6 ELISA was performed to test for the maximum signal of this cytokine in a CID drug titration experiment. The optimal dose of CID drug corresponds to the lowest dose that induces the highest level of IL-6 expression. The IL-6 ELISA results are seen in Supplemental Figure . These results suggest that a dose of at least 50 nM, produces the maximum activation of -cTLR4 ceils in the range from 50 nM - 250 n .
[0116] A withdrawal experiment was also performed to determine the time in which the cells would revert to a baseline state following CID drug withdrawal. M t*-cTLR4 ceils were seeded in a 6- well culture plate (1x106 ceils/well). Cells were treated with vehicle, CI D drug, or LPS for 24 hours. Timepoints were collected after complete CID drug withdrawal and IL-6 levels were measured at each timepoint to determine activation intensity. Results showed that ceils converged to their baseline state at approximately 18 hours (Figure 4).
[01 7] In order to determine how long the engineered M0-cTLR4 cells would stay "on" or activated, we performed a longevity study for TNFa, IL-6, and iNOS, With constant CID drug presence in the media, we found that the -cTLR4 ceils maintain considerable elevated levels of ail three pro-inflammatory markers for at least 48 hours (Figure 5A-5C). The IL-6 levels stayed activated the longest for 72 hours.
[01 18] Lastly, the MO-cTLR4 cells were optimized for maximal signal to baseline activation by sorting four different GFP intensity populations: dim, midlow, midhigh, and high. An IL-6 ELISA was performed to determine activation of these populations compared to unsorted ΜΦ and Φ- T2A populations (Supplemental Figure 2). As signal intensity increased, the baseline activation of 0-cTLR4 cells also increased. A potential explanation for the high baseline activation as GFP intensity increases might be that some ceils have more cTLR4 constructs integrated into their genome, thus resulting in higher GFP intensify. This higher integration will yield a greater concentration of the engineered cTLR4 construct on the cell surface and might result in self- dimerizafion, if the constructs are in close enough proximity. Ultimately, we determined that the midlow M -cTLR4 population had similar CID and LPS activation, as well as the highest signal to noise ratio, so we used this sorted population for the remaining experiments.
IVSyD88-dependent and !V]yD88~indeperident signaling pathway activation in TO-cTLR4 cefis
[0119] Following LPS stimulation and subsequent TNFa production, the TLR4 pathway leads to activation of NF- Β and the three MAPK pathways through the D88-dependent pathway. Both N F-KB and MAPK pathways directly control the transcription of the IL-6 and iNOS inflammatory genes, as well as control the mRNA stability of those transcripts. For the activated 0-cTLR4 ceils, ERK1/2 phosphorylation is expected if the MyD88 dependent pathway and
subsequent downstream TRAF6 activation has occurred. Therefore, we performed a western blot to probe for phosphorylated-ERK (p-ERK) and total ERK and compare the p-ERK/total ERK ratio relative to the zero timepoint (Figure 6A). As time increases from 0 minutes to 60 minutes, the ClD-treated M -cTLR4 ceils exhibit an upregulation of ERK1/2 phosphorylation at the 5 minute timepoint, a subsequent decrease for the 15 minute timepoint, and then a significant increase for the last two timepoints. The LPS-treated M t>-cTLR4 ceils exhibited a similar ERK1/2 phosphorylation pattern with lower maximum phosphorylation. The N F-KB transcription factor has also been shown to be activated following TLR4 dimerization. Thus, M0-cTLR4 ceils were tested for NF- Β promoter activation via a Dual-Luciferase reporter assay. Cells were transduced with a NF-κΒ responsive promoter element driving the luciferase gene. Measurement of the luciferase activity following CID treatments (Figure 8B) shows that ClD-treated M<£>~cTLR4 cells have increased NF-κΒ promoter activation when compared to the vehicle. These results suggest that the ClD-treated cells signal through the MyD88 dependent pathway.
[0120] To determine if the M -cTLR4 cells were signaling through the MyD88-independent pathway, we tested for phosphorylated IRF3. This protein is downstream of the MyDSS- independent pathway and has been shown to translocate into the nucleus and regulate type I interferon responses. [19] Western blot analysis of the p-IRF3/total IRF3 ratio relative to the zero timepoint (Figure 7) shows a pronounced activation peak at 2 hours for both CID- and LPS- treated O-cTLR4 cells when compared to vehicle. The IRF3 phosphorylation of the CID- and LPS-treated Md -cTLR4 cells starts to decrease following the 2 hour timepoint and
subsequently reaches similar levels as vehicle at the 6 and 12 hour timepoints.
M ~cTLR4 endothelial cell activation
[0121] Better wound healing outcomes have been correlated with increased angiogenesis, [20] Furthermore, areas containing almost entirely pro-inflammatory Φ have been shown to correlate with angiogenesis, in specific cases. [20, 21 ] Thus, we tested whether engineered ΜΦ- cTLR4 cells-derived factors were able to induce EC activation by measuring the expression of the VCAM-1 and ICAM-1 adhesion molecules. EC incubated with media from M ~cTLR4 treated with TNFa and CID drug both had increased expression of VCAM-1 and ICAM-1 (Figure 8A & 8B) when compared to vehicle alone. For the TN Fa-treatment group, 93.5% of EC were positive for VCAM-1 and 57.2% of EC were positive for ICAM-1. The CID drug-treatment group was very similar, with 93.7% of the EC being positive for VCAM-1 and 64.4% of the EC being positive for ICAM-1. The vehicle group had a baseline VCAM-1 and ICAM-1 expression when compared to the isotype control.
[0122] To determine if the TNFa was the main driver of the EC activation, we repeated the experiment with a neutralizing antibody for TNFa (Figure 8C & 8D). Before adding the ΜΦ-
cTLR4 conditioned media to the EC, a TNFa neutralizing antibody was incubated in the media for 15 minutes. The C!D and the TNFa groups with the neutralizing antibody had severely decreased levels of both VCA - and ICAM-1 when compared to the IgG control. The VCAM-1 expression was decreased by a factor of three and the ICAM-1 expression was decreased by a factor of two and fell below vehicle/baseline treatment, thus indicating that some of the activity at baseline is TN Fa-dependent.
Discussion
[0123] In this study we engineered RAW264.7 cells to have the ability to polarize into proinflammatory ΜΦ, by using the CID system for the TLR4 receptor. We confirmed that the engineered cTLR4 receptor was being expressed in the stably transduced RAW264.7 cell line. Additionally we determined that both MyD88-dependent and MyD88-independent pathways were activated by CID drug treatment in M t>-cTLR4 ceils. The CID-treated M -cTLR4 cells displayed M1-iike ΜΦ characteristics, such as increased IL-6, TNFa, and iNOS expression. MO-CTLR4 cells were influenced by IL-4 cocktail treatment, however, the engineered cells still displayed 1 ΜΦ characteristics, albeit at lower expression levels. The M0-cTLR4 cells remained polarized in response to CID drug for at least 48 hours and CID drug withdrawal experiments suggest that the engineered cells became deactivated 18 hours after drug withdrawal. Lastly, we showed that these engineered cells have functional properties by performing a M0-cTLR4 conditioned-media experiment with EC. C!D-po!arized M -cTLR4 conditioned-media had the ability to activate EC by upregulating both VCAM-1 and ICAM-1 expression on the ceil surface, which are two cell adhesion molecules associated with angiogenic processes. [22, 23] Further, the activation of EC by CID-treated M -cTLR4 was determined to be dependent on TNFa.
[0124] The CID system has been successfully used in literature to trigger a variety of signal transduction cascades. In vitro immunology studies using this system have been mostly focused on downstream effects of a specific engineered receptor's signaling pathway. [24-28] For instance, Kuenzel et al. transfected HeLaSS ceils with a nucleotide-binding oligomerization domain-like receptor 5 (NLRC5)-FKBP fusion protein and determined that induced
oligomerization of this receptor activated certain IFN signaling pathways that contributed to an antiviral defense mechanism. [25] In another study, Fooksman et ai. transiently transfected T2 cell lines with a dimerizable mouse class I H2-Kb H chain-FKBP fusion protein and determined that induced dimerization, and thus clustering of this class I MHC construct, enhanced lymphoblast recognition by T cells. [26] In contrast to using the CID system to examine cause and effect relationships within a specific pathway, the present study is the first to use this system to regulate the phenotype of a cell by polarizing RAW284.7 cells into a specific proinflammatory ΜΦ. Further, our lab has previously demonstrated that this system can be used to
engineer inducible bone resorbing osteoclasis from the monocyte-macrophage RAW284.7 ceil line, in which it is important to note that monocytes are a common precursor to both
macrophages and osteoclasts. [27]
[0125] Other groups have attempted to engineer macrophages to control the inflammatory response. For example, Wu et al. transduced Φε in vitro with the IFN-γ gene and delivered them intratrachealiy to immunodeficient mice. [28] These Φε restored immune function in the lungs of the immunodeficient mice. However, these constitutiveiy active IFNy-expressing proinflammatory ΜΦε probably have limited applications, since the cells were not engineered to be tunable. Additionally, Oxford BioMedica has engineered human ΜΦβ to express cytochrome P450, which can convert a cancer prodrug into its active form during hypoxic tumor conditions. When delivered into an avascular spheroid model, the human engineered P450 Φε were able to induce tumor cell death following the addition of the prodrug. [29] The success of this study was dependent on the hypoxia-driven expression of cytochrome P450 in MOs. The engineered -cTLR4 in our study, on the other hand, can be controlled temporally and specifically with the addition or withdrawal of the CID drug and activation is independent of the local environment. Indeed, we observe an upregulation of key pro-inflammatory markers from these engineered Φ8 as soon as 8 hours after CID drug addition and then we observe return to baseline conditions in 18 hours following drug withdrawal. The ability to tune the engineered MOs with respect to selective activation provides a large added benefit, since the engineered 0-cTLR4 ceils could be turned on or off when and if necessary.
[0128] Several studies have elucidated that temporal expression of key angiogenic cytokines, such as TNFa, is necessary for tip formation in EC, [30] Sainson et ai. showed that 2- to 3-day pulses of T Fa in vitro and in vivo stimulates angiogenesis, as opposed to the inhibition of angiogenesis with continuous administration. We observe robust TNFa expression in our engineered pro-inflammatory ΜΦ-οΤίΚ4 cells, which may possibly be utilized to promote angiogenesis, if controlled in a time-based manner, indeed, the M -cTLR4 engineered cells may be tailored to exhibit pulse behavior with the simple addition and withdrawal of CID drug at certain timepoints. in addition, we do observe that the -cTLR4-conditioned media stimulates EC activation by increasing VCAM- and ICAM-1 adhesion molecule expression in an in vitro setting and in a TNFa-dependent manner, which suggests that our engineered ΜΦ may be able to promote angiogenesis. Further, iNOS levels directly correlate with VCAM-1 expression. [31] We do see similar activation patterns with both TNFa and iNOS in our M -cTLR4 ceils, so both of these factors could be working in concert to upregulate adhesion molecule expression.
Activation of VCAM-1 and ICAM-1 has been shown to destabilize endothelial junctions resulting in leaky vessels, a first step in the angiogenesis process. It has been suggested that a subsequent 2 ΜΦ phase may be necessary for the process of angiogenesis to continue and come to completion, as the M2 ΜΦ phenofype has been hypothesized to bridge and stabilize
newly formed vessels. [32] Thus, CID drug activated $>-cTLR4 cells may provide the required priming step for angiogenesis to initiate.
[0127] In addition to iNOS and TNFa, our CID-treated M0-cTLR4 cells also produce increased levels of IL-6. The !L-6 cytokine has been closely associated with promotion of angiogenesis. increased IL-6 mRNA levels correlated with the development of ovarian follicles and the uterine lining, which are two independent physiological angiogenic processes. [33] Moreover, IL-6 treatment has been shown to promote tubule formation in brain microvessel EC in an in vitro setting. This correlated with increased IL-6 and VEGF mRNA expression in the healing adult murine brain tissue following injury. [34] These studies suggest that IL-6 may play a role in normal physiological angiogenesis as well as angiogenesis related to inflammatory remodeling of tissue. Studies in IL-6 KO mice showed that the IL-6 deletion resulted in delayed wound healing, accompanied with both delayed angiogenesis and collagen deposition. [35] The direct mechanism of IL-6 and its influence on pro-angiogenic behavior is still not completely understood, however, IL-6 seems to be a key player in this process. The present engineered 0-cTLR4 ceils produce IL-6, along with two other factors implicated with pro-angiogenic behavior. This strongly suggests that our M -cTLR4 cells may have the ability to aid in the priming of the endothelium for early stage angiogenesis.
[0128] Despite the possible use of the M<£>~cTLR4 cells as angiogenesis priming agents, in which a following 2 ΜΦ response might need to be necessary, these cells could also be used in certain diseases to skew the balance of a SV12 Φ-abundant process. For example, diseases characterized by excessive fibrosis could benefit from this technology, as there is often a local abundance of M2 ΜΦε present during fibrotic events. Fibrosis occurs due to the abundance of these M2 ΜΦε over-producing TGF , which in turn recruits fibroblasts. The recruitment of fibroblasts then leads to the overproduction of collagen, thus leading to a fibrotic state. This dysregulated process is often associated with the dense collagen fibrous capsule that surrounds an implanted material, as well as with cardiac fibrosis that plagues congestive heart failure patients. [36] A few studies have suggested that a proper balance of M1 and M2 Φ is necessary to achieve a reduction in the extent of fibrosis. [37, 38] Thus, CID-activated ΜΦ- cTLR4 cells may provide a tool to reestablish the proper M1 vs 2 Φ equilibrium and decrease the excessive collagen deposition. Another possible application of the IV^-cTLR4 cells could be tumor inhibition. Tumor-induced angiogenesis is essential for cancer cell survival, tumor growth and metastasis propagation. An abundance of pro-angiogenic, anti-inflammatory 2 Φ8, known as tumor-associated Φ (TAMs), is normally present in the tumor environment thus aiding tumor progression, in contrast, very few M1 ΜΦε able to activate NK cells and TH1 responses are present in and around the growing tumor mass[39]. Thus, the delivery of tunable MΦ-cTLR4 ceils to the tumor may halt progression by activating a more pro-inflammatory immune response.
[0129] We have shown thai the -cTLR4 cells become activated with the addition of C!D drug and conversely that these engineered cells return to baseline conditions once CID drug has been withdrawn in an in vitro environment. However, it is still not known what will occur in vivo with the addition or withdrawal of CID drug. The IL-4 cocktail results showed that the Φ- cTLR4 cells had decreased IL-6 and iNOS levels when compared to CID drug or LPS treatment alone, however, IL-4 did not seem to affect TNF-a levels. This suggests that the engineered cells are influenced by competing 2-iike ΜΦ signals. These competing signals may be changing the phenotype of the engineered -cTLR4 cells into an intermediate phenotype or even skewing the cells toward a 2-iike Φ phenotype. These results are not completely surprising, as ΜΦ are known to be very plastic cells and can change phenotypes depending on the surrounding microenvironmenf. Future in vivo studies will be necessary to determine if elevated TNF-a levels, or other increased pro-inflammatory ΜΦ markers, are adequate enough to maintain a pro-infiammatory surrounding environment with M2 ΜΦ competing signals present. In a physiological setting, the C!D-treated and subsequently CID-withdrawn
engineered ΜΦ8 could potentially: 1) be primed to polarize into M2 pro-healing ΜΦ8, 2) remain in a pro-inflammatory ΜΦ phenotype state due to the surrounding environment, 3) develop into an intermediate phenotype state due to 2 Φ competing signals, 4) undergo apoptosis or, 5) migrate out of the inflammation site. Future studies will determine the degree of plasticity of the engineered cells, as well as how precise we can control these cells in vivo.
[0130] It has been shown previously that ΜΦ drive the wound healing response. [1 1 , 40, 41] in this study, we have engineered tunable pro-infiammatory ΜΦ that could possibly be used to better regulate inflammation. By utilizing these -cTLR4 cells to control the host response, it might be possible to increase angiogenesis for better healing outcomes. Additionally, these engineered ceils could be used as a tool to better understand and better regulate M1 ΜΦ-like dynamics. While RAW264.7 cells are suitable to use during in vitro inflammation studies, future investigations will focus on using a more physiological engineered primary cell type, such as bone marrow derived Μ . [42] While ongoing studies continue to unravel IV^-cTLR4 cell possibilities in both in vitro and in vivo settings, currently these engineered cells serve as a platform technology that could be applied to various inflammatory diseases including the FBR, fibrosis, atherosclerosis, and cancer.
Example 2: Plasticity of M -cTLR4 Cells
[0131] Diversity and plasticity are hallmarks of ceils from the Φ lineage and they can change phenotype depending on the surrounding microenvironment. As described in Example 1 above and in Figure 9, we tested how the expression of classical Φ markers in the M0-cTLR4 cells were influenced by a 2 ΜΦ activator. Engineered ceils were treated with a cocktail of either vehicle/! L~4, C!D/IL-4, or LPS/IL-4, as well as the appropriate controls. The degree of
polarization was assessed by ELISA and western blot analyses for IL-6, TNFa, and iNOS (Figure 9). Both CID- and LPS~treated groups responded similarly to the I L-4 cocktail treatment and exhibited about half the expression of IL-6 and iNOS when compared to treatment groups without I L-4. However, TNFa levels for both CID drug and LPS with and without I L-4 were not significantly different. Similar results to iNOS and IL-6 were observed with IL-10 cytokine expression (Figure 17), which is a canonical pro-healing 2 Φ marker. Cocktail treatment of C ID/I L-4 and LPS/IL-4 displayed increased levels of IL-10, when compared to controls without I L-4 present.
Example 3: Co-Culture of -cTLR4 Cells and Endothelial Cells in Tube Formation Assay
[0132] Since cell-ceil interactions have been shown to be important for endothelial ceils (ECs) and macrophages (M<t>s), a co-culture tube formation assay was performed (Figure 18), Untreated M -cTLR4 ceils co-cultured with rat aortic ECs (RAECs), with no added factors to the medium, had the least amount of isolated segments, the least amount of branches, and the most amount of branching interval. CID-treafed and LPS-treated M<t>-cTLR4 cells co-cultured with RAECs, with CID or LPS added to the medium, had much more branches than untreated co-cultures with a smaller branching interval. The CID-treated group differed from the LPS- treated group in isolated segment analysis, as LPS-treated <t>c-TLR4 ceils co-cultured with RAECs had the highest number of isolated segments and CID-treated MOc-TLR4 ceils co- cultured with RAECs had slightly more isolated segments than the untreated group. The number of branches and the branching interval for the CID- and LPS-treated groups were significantly different than the control. However, the number of master segments and isolated segments for the CID- and LPS-treated groups were not significantly different, when compared to the control (Figure 19).
Example 4: In vivo Analysis of -cTLR4 Cells and Their Co-localization with iNOS
inflammation Regions in Tissue
[0133] Four groups of 4 week old female BALB/c mice (total of 16 mice) were used in this in vivo study. The four groups consisted of: 7 day non-treated mice, 7 day CID-treated mice, 14 day non-treated mice, and 14 day CID-treated mice. At day of injection, pre-piated Md>-cTLR4 cells were lifted off and counted. 0.5x106 ceils were s.c. injected mixed in with Mafrigel into the right back dorsal area of the mouse. Before placing mouse back in cage, mice were injected with the first intraperitoneal CID drug dose (2 mg/kg mouse weight). Treatment groups were given CID drug injections every other day during the course of the experiment (Figure 20).
[0134] The existence of GFP positive -cTLR4 cells and iNOS co-localization indicates that the 0-cTLR4 cells remain functional within the Matrigel plug and also indicates the potential influence of the «J>~cTLR4 ceils on the local environment. As most cells were dead in the 14 day untreated Matrigel plugs, there were no regions of co-localization of GFP M0-cTLR4 ceils
and iNOS regions. However, the 14 day CiD-freafed plugs had occurrences of GFP/iNOS co- localization (Figure 21 , 14 day).
Example 5: Decreased Expression of VEGF in lVl t3-cTLR4 cells Treated with CID, LPS, and/or IFN-Y
[0135] In order to determine if the M t>-cTLR4 cells were expressing the key angiogenic molecule VEGF-A, an EL!SA was performed to test for VEGF-A levels in M<t>-cTLR4 medium following various treatments (Figure 22A). C!D-treated and LPS-treated M i>-cTLR4 cells expressed significantly decreased amounts of VEGF, when compared to controls. Since studies have shown human and rat Os express increased VEGF with !FN-γ treatment, the response was also tested with this factor. Figure 22B shows cocktail treatment of IFN-γ treatment with CID or LPS, or IFN-γ alone. All groups also show a significant decrease in VEGF when compared to the control.
[0136] A significant decrease in VEGF expression was observed when M -cTLR4 ceils were treated with either CID, LPS, IFN-γ, or a combination of the treatments, when compared to controls. The down-regulation of VEGF could be maintaining the angiogenesis process at the first stage, which is the destabilization step. The second and third step involve sprouting and branching, respectively, which necessitates increases in VEGF expression. Since M«t»-cTLR4 cells are actively down-regulating this factor, this might play a large role in the anti-angiogenic behavior of the activated engineered ceils. References
[0137] 1. G.L. Larsen, P.M. Henson, Annual review of immunology 1 (1983) 335-359.
[0138] 2. B.M. Delavary, et al., Immunobio!ogy 216 (2011) 753-762.
[0139] 3. D.M. IVIosser, J. P. Edwards, Nature Reviews immunology 8 (2008) 958-969.
[0140] 4. A. Rodriguez, et al., J. Biomedical Materials Research Part A 89 (2009) 152-159.
[0141] 5. R.J. Schutte, et al., Biomaterials 30 (2009) 160-168.
[0142] 6. S. Nakao, et al., The Journal of Immunology 170 (2003) 5704-571 .
[0143] 7. R.J. Stewart, et al., The Journal of Immunology 156 (1996) 1221 -1228.
[0144] 8. A. antovani, et al., Trends in immunology 25 (2004) 677-686.
[0145] 9. F. ackay, et al., The Journal of experimental medicine 177 (1993) 1277-1286.
[0146] 10. B. Garmy-Susini, et al., The Journal of clinical investigation 1 15 (2005) 1542-1551.
[0147] 11. B. Behm, et al., J. European Acad. Dermatol, and Venereol. 26 (2012) 812-820.
[0148] 12. F.O. Martinez, et al., Frontiers in bioscience: a journal and virtual library 13 (2008) 453.
[0149] 13. C.A. Blau, et al., Proceedings of the National Academy of Sciences 94 (1997) 3076.
[0150] 14. L. Jin, et al., Proceedings of the National Academy of Sciences 95 (1998) 8093.
[0151] 15. L. Jin, et al., Blood 91 (1998) 890-897.
[0152] 16. H. Zeng, et al., Blood 98 (2001) 328-334.
[0153] 17. S. Zhao, et al., The EMBO journal 21 (2002) 2159-2167.
[0154] 18. A. Sica, et al., The Journal of clinical investigation 122 (2012) 787-795.
[0155] 19. A. Garcia-Sastre, et al., Science 312 (2006) 879-882.
[0156] 20. S. Guo, LA. DiPietro, Journal of dental research 89 (2010) 219-229.
[0157] 21. E.M. Sussman, et al., Annals of biomedical engineering (2013) 1-9.
[0158] 22. Y. Wu, et al., Circulation Research 99 (2006) 315-322.
[0159] 23. A.E. Koch, et al.. Angiogenesis mediated by soluble forms of E~seiectin and vascular cell-adhesion moiecuie-1 , (1995).
[0160] 24. M. Sun, et al., The Journal of immunology 177 (2006) 1481 -1491.
[0161] 25. S. Kuenzel, et al., The journal of immunology 184 (2010) 1990-2000.
[0162] 26. D.R. Fooksman, et al., The Journal of immunology 176 (2006) 6673-6680.
[0163] 27. C.W. Rementer, et al., PloS one 8 (2013) e84465.
[0164] 28. M. Wu, et al., Proc. National Academy of Sciences 98 (2001) 14589-14594
[0165] 29. L. Griffiths, et al., Gene therapy 7 (2000) 255-262.
[0166] 30. R.C. Sainson, D.A. et al., Blood 11 1 (2008) 4997-5007.
[0167] 31. F. Klug, et al., Cancer cell 24 (2013) 589-602.
[0168] ■59 T. Schmidt, et al., Nature 465 (2010) 697-699.
[0169] 33. B. Motro, et al., Proc. National Academy of Sciences 87 (1990) 3092-3096.
[0170] 34. D. Fee, et al., Cytokine 12 (2000) 655-665.
[0171] 35. Z.-Q. Lin, et al., Journal of leukocyte biology 73 (2003) 713-721.
[0172] 36. A. Stempien-Otero, et al., J Biol Chem 281 (2006) 15345-15351.
[0173] 37. A. Meneghin, et a!., Journal of Clinical investigation 1 17 (2007) 530.
[0174] 38. H.-J. Anders, et al. Kidney international 80 (201 1) 915-925.
[0175] 39. P. A!iavena, et aL, Critical reviews in oncology/hematology 88 (2008) 1 -9.
[0176] 40. T. Hunt, et al., Surgery 96 (1984) 48-54.
[0177] 41. T.J. Koh, et al., Expert reviews in molecular medicine 13 (2011 ) e23.
[0178] 42. L.M. Chamberlain, et al., Journal of Biomedical Materials Research Part A 88A (2009) 858-871.
[0179] Throughout this application various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to describe more fully the state of the art to which this invention pertains.
[0180] From the foregoing it will be appreciated that, although specific embodiments of the invention have been described herein for purposes of illustration, various modifications may be made without deviating from the spirit and scope of the invention. Accordingly, the invention is not limited except as by the appended claims.
Claims
1. A polynucleotide construct encoding a chimeric cellular receptor, the construct comprising nucleic acid sequences encoding, in operable linkage, a myristoylation sequence (Myr), a dimerizer domain, and an intracellular portion of the TLR4 receptor.
2, The construct of claim 1 , further comprising a ribosome skipping sequence or a cleavage sequence, and nucleic acid sequence encoding a green fluorescent protein.
3, The construct of claim 1 , which is free of sequences encoding an extracellular portion of the TLR4 receptor.
4. The construct of claim 1 , wherein the dimerizer domain is phenylalanine 36 to valine point mutation (F38V) derived from a mutated version of the endogenous FKBP12 protein.
5. The construct of claim 1 , wherein the myristoylation sequence (Myr), the dimerizer domain, and the intracellular portion of the TLR4 receptor have the amino acid sequence of SEQ ID NO: 1.
6. The construct of claim 1 , wherein the intracellular portion of the TLR4 receptor comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 8, wherein SEQ ID NO: 6 is amino acid residues 661-839 of human TLR4 receptor.
7. The construct of claim 6, wherein the intracellular portion of the TLR4 receptor comprises an amino acid sequence selected from SEQ ID NOs: 7-20, or at least two mutations selected from P714A, S744A, R745A, C747S, Y751A, E752A, E775A, 776S, Q792A, N792 A, Y794A, E796A, and E798A.
8. A method of producing a genetically engineered monocyte comprising the steps of:
(a) contacting a monocyte with the construct of any one of claims 1 -7 under conditions sufficient to transfect the construct into the monocyte; and
(b) cuituring the monocyte transfected in step (a),
wherein the genetically engineered monocytes express the chimeric cellular receptor able to dimerize upon addition of a Chemical Inducer of Dimerization (CID) synthetic ligand, which dimerization activates signaling pathways independently of endogenous physiological ligands, thereby differentiating the transfected monocyte into a macrophage.
9. The method of claim 8, wherein the CID synthetic ligand is a recombinant FK506 molecule.
10. The method of claim 9, wherein the recombinant FK508 molecule is AP20187.
11. A genetically engineered monocyte produced in accordance with the method of any one of claims 8-10.
12. A pharmaceutical composition comprising the genetically engineered monocyte of claim 11.
13. The pharmaceutical composition of claim 12, further comprising a CID synthetic ligand.
14. The pharmaceutical composition of claim 13, wherein the CID synthetic ligand is a recombinant FK506 molecule.
15. The pharmaceuticai composition of claim 14, wherein the recombinant FK508 molecule is AP20187.
16. A method of reversibly inducing pro-inflammatory macrophages in a subject, the method comprising:
(a) administering the composition of claim 11 to a subject; and
(b) administering a CID synthetic ligand to the subject;
whereby the CID synthetic ligand activates the genetically engineered monocytes.
17. The method of claim 16, further comprising:
(c) withdrawing administration of the CID synthetic ligand and/or administering a washout ligand, thereby reversing the activation of the genetically engineered monocytes.
18. The method of claim 16, wherein the administering of step (a) is by implantation into a target organ, injection into a target tissue, introduction of a scaffold to a target site, or intravenous administration.
19. The method of claim 16, wherein the genetically engineered monocyte is pre-freated with a CID synthetic ligand prior to the administering of step (a).
20. A method of treating a fibrotic disease comprising administering to a subject in need thereof the pharmaceutical composition of any one of claims 12-15 and a CID synthetic ligand.
21. The method of claim 20, wherein the fibrotic disease is selected from the group consisting of pulmonary fibrosis, cardiac fibrosis, and foreign body reaction.
22. A method of treating an inflammatory disease comprising administering to a subject in need thereof the pharmaceutical composition of any one of claims 12-15 and a CID synthetic ligand.
23. The method of claim 22, wherein the inflammatory disease is a chronic inflammatory disease.
24. The method of claim 23, wherein the chronic inflammatory disease is selected from the group consisting of atherosclerosis and rheumatoid arthritis,
25. A method of treating cancer inflammation comprising administering to a subject in need thereof the pharmaceutical composition of any one of claims 12-15 and a CID synthetic ligand.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/746,780 US20190008897A1 (en) | 2015-07-22 | 2016-07-22 | Compositions and methods for producing pro-inflammatory macrophages |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562195725P | 2015-07-22 | 2015-07-22 | |
| US62/195,725 | 2015-07-22 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017015553A1 true WO2017015553A1 (en) | 2017-01-26 |
Family
ID=57834579
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/043540 Ceased WO2017015553A1 (en) | 2015-07-22 | 2016-07-22 | Compositions and methods for producing pro-inflammatory macrophages |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20190008897A1 (en) |
| WO (1) | WO2017015553A1 (en) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20170151281A1 (en) | 2015-02-19 | 2017-06-01 | Batu Biologics, Inc. | Chimeric antigen receptor dendritic cell (car-dc) for treatment of cancer |
| EP4054602A4 (en) * | 2019-11-08 | 2023-12-06 | Mayo Foundation for Medical Education and Research | CAR T CELLS DIRECTED TOWARDS EPHA3 FOR THE TREATMENT OF TUMORS |
| US10980836B1 (en) | 2019-12-11 | 2021-04-20 | Myeloid Therapeutics, Inc. | Therapeutic cell compositions and methods of manufacturing and use thereof |
| EP4240367A4 (en) | 2020-11-04 | 2024-10-16 | Myeloid Therapeutics, Inc. | MANIPULATED CHIMERIC FUSION PROTEIN COMPOSITIONS AND METHODS OF USE THEREOF |
| WO2022197949A2 (en) | 2021-03-17 | 2022-09-22 | Myeloid Therapeutics, Inc. | Engineered chimeric fusion protein compositions and methods of use thereof |
| BR112023023642A2 (en) | 2021-05-11 | 2024-01-30 | Myeloid Therapeutics Inc | METHODS AND COMPOSITIONS FOR GENOMIC INTEGRATION |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100004213A1 (en) * | 2007-11-29 | 2010-01-07 | Abbas Alexander R | Gene expression markers for inflammatory bowel disease |
| US20130136734A1 (en) * | 2011-04-04 | 2013-05-30 | The Trustees Of Dartmouth College | ANTI-CD154 ANTIBODIES HAVING IMPAIRED FcR BINDING AND/OR COMPLEMENT BINDING PROPERTIES AND RELATED THERAPIES |
| US20140023647A1 (en) * | 2010-04-16 | 2014-01-23 | Bellicum Pharmaceuticals, Inc. | Method for treating solid tumors |
| WO2014142984A1 (en) * | 2013-03-15 | 2014-09-18 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Coincidence reporter gene system |
| WO2015123527A1 (en) * | 2014-02-14 | 2015-08-20 | Bellicum Pharmaceuticals, Inc. | Methods for activating t cells using an inducible chimeric polypeptide |
-
2016
- 2016-07-22 WO PCT/US2016/043540 patent/WO2017015553A1/en not_active Ceased
- 2016-07-22 US US15/746,780 patent/US20190008897A1/en not_active Abandoned
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100004213A1 (en) * | 2007-11-29 | 2010-01-07 | Abbas Alexander R | Gene expression markers for inflammatory bowel disease |
| US20140023647A1 (en) * | 2010-04-16 | 2014-01-23 | Bellicum Pharmaceuticals, Inc. | Method for treating solid tumors |
| US20130136734A1 (en) * | 2011-04-04 | 2013-05-30 | The Trustees Of Dartmouth College | ANTI-CD154 ANTIBODIES HAVING IMPAIRED FcR BINDING AND/OR COMPLEMENT BINDING PROPERTIES AND RELATED THERAPIES |
| WO2014142984A1 (en) * | 2013-03-15 | 2014-09-18 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Coincidence reporter gene system |
| WO2015123527A1 (en) * | 2014-02-14 | 2015-08-20 | Bellicum Pharmaceuticals, Inc. | Methods for activating t cells using an inducible chimeric polypeptide |
Also Published As
| Publication number | Publication date |
|---|---|
| US20190008897A1 (en) | 2019-01-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20190008897A1 (en) | Compositions and methods for producing pro-inflammatory macrophages | |
| EP1519957B1 (en) | Use of hmgb1 in the treatment of tissue damage and/or to promote tissue repair | |
| JP2016520614A (en) | Antibody lockers for protein drug inactivation | |
| CA2736929C (en) | Inhibition of plgf to treat philadelphia chromosome positive leukemia | |
| JP6750018B2 (en) | Anti-S100A8 for leukemia treatment | |
| US20090069227A9 (en) | Use of HMGB1 to promote stem cell migration and/or proliferation | |
| US20210077554A1 (en) | Methods of Neoplasm Treatment Utilizing Complementary Oncolytic Viruses and CAR T-Cells | |
| US11236147B2 (en) | Methods and compositions for the inhibition of TRPV4 | |
| JP5294344B2 (en) | Pharmaceutical composition for leukemia treatment | |
| Zhang et al. | S100A4 blockage alleviates agonistic anti-CD137 antibody-induced liver pathology without disruption of antitumor immunity | |
| JP2020503841A (en) | Non-cytotoxic modified cells and uses thereof | |
| CN114920841B (en) | Anti-CD87 antibody and its specific chimeric antigen receptor | |
| Agoulnik et al. | Engineering a long acting, non-biased relaxin agonist using Protein-in-Protein technology | |
| KR101694909B1 (en) | Composition for treating bone diseases or inhibiting osteoclast formation comprising TSPAN7 inhibitor | |
| US20030077757A1 (en) | Method of treating aging-related disorders | |
| Koutsokeras et al. | Generation of an efficiently secreted, cell penetrating NF‐κB inhibitor | |
| US12589141B2 (en) | DNA vaccine capable of effectively treating and/or preventing type 1 diabetes and use thereof | |
| Zhang et al. | IL-16 exerts anti-rabies virus effects through CD9 on the surface of viral particles | |
| JP5646732B2 (en) | Pharmaceutical composition using connective tissue growth factor | |
| US11596655B2 (en) | Activation of natural cytotoxicity receptor 2 (NCR2) | |
| CN118638237B (en) | A single-chain antibody targeting human PDGFRβ and its application in CAR-T immunotherapy | |
| JP2002529516A (en) | Methods of affecting angiogenesis using CD66a | |
| US20250066420A1 (en) | Pd-l1 inhibitory peptide for cancer immunotherapy | |
| KR20240124222A (en) | Use of dkk1 protein in a regulatory t cell | |
| WO2022210802A1 (en) | Therapeutic agent for muscular atrophy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16828603 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16828603 Country of ref document: EP Kind code of ref document: A1 |