WO2016209036A2 - 타입 iii 에펙터 hopq1 및 lim 도메인 키나아제1(limk1)의 상호작용을 이용한 hopq1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물 - Google Patents

타입 iii 에펙터 hopq1 및 lim 도메인 키나아제1(limk1)의 상호작용을 이용한 hopq1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물 Download PDF

Info

Publication number
WO2016209036A2
WO2016209036A2 PCT/KR2016/006791 KR2016006791W WO2016209036A2 WO 2016209036 A2 WO2016209036 A2 WO 2016209036A2 KR 2016006791 W KR2016006791 W KR 2016006791W WO 2016209036 A2 WO2016209036 A2 WO 2016209036A2
Authority
WO
WIPO (PCT)
Prior art keywords
hopq1
type iii
limk1
iii effector
effector protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2016/006791
Other languages
English (en)
French (fr)
Other versions
WO2016209036A3 (ko
Inventor
박영준
류충민
윤성진
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Korea Research Institute of Bioscience and Biotechnology KRIBB
Original Assignee
Korea Research Institute of Bioscience and Biotechnology KRIBB
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Korea Research Institute of Bioscience and Biotechnology KRIBB filed Critical Korea Research Institute of Bioscience and Biotechnology KRIBB
Publication of WO2016209036A2 publication Critical patent/WO2016209036A2/ko
Publication of WO2016209036A3 publication Critical patent/WO2016209036A3/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/566—Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/21—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Pseudomonadaceae (F)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10—Transferases (2.)
    • C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/48—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving transferase
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/48—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving transferase
    • C12Q1/485—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving transferase involving kinase
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
    • C12Y207/11—Protein-serine/threonine kinases (2.7.11)
    • C12Y207/11001—Non-specific serine/threonine protein kinase (2.7.11.1), i.e. casein kinase or checkpoint kinase

Definitions

  • the present invention relates to inhibitor screening methods for immunosuppression by HopQ1 using the interaction of type III effector HopQ1 and LIM domain kinase, and compositions for the same.
  • Pseudomonas syringae pv. tomato is one of the models used for the interaction between pathogenic bacteria that cause disease in plants and susceptible plants (Xin XF, He SY (2013), Pseudomonas syringae pv. tomato DC3000: a model pathogen for probing disease susceptibility and hormone signaling in plants, Annu Rev Phytopathol . 51: 473-98).
  • Tomato is known to inject a variety of effector proteins into plant cytosols that induce and inhibit host defense mechanisms through type III secretion systems (Block A, Alfano JR (2011), Plant targets for Pseudomonas syringae type III effectors : virulence targets orguarded decoys Curr.Opin.Microbiol 14:. 39-46, Boller T, He SY (2009), innate immunity in plants: an arms race between pattern recognition receptors in plants and effectors in microbial pathogens Science 324:. 742-44 , Grant SR, Fisher EJ, Chang JH, Mole BM, Dangl JL (2006), subterfuge and manipulation:...
  • Non-Patent Document 1 Xin XF, He SY (2013), Pseudomonas syringae pv. tomato DC3000: a model pathogen for probing disease susceptibility and hormone signaling in plants, Annu Rev Phytopathol . 51: 473-98
  • Non-Patent Document 2 Block A, Alfano JR ( 2011), Plant targets for Pseudomonas syringae type III effectors: virulence targets orguarded decoys Curr.Opin.Microbiol. 14: 39-46
  • Non-Patent Document 3 Boller T, He SY (2009), Innate immunity in plants: an arms race between pattern recognition receptors in plants and effectors in microbial pathogens. Science 324: 742-44, Grant SR, Fisher EJ, Chang JH, Mole BM, Dangl JL (2006)
  • Non-Patent Document 4 Subterfuge and manipulation: type III effector proteins of phytopathogenic bacteria. Annu. Rev. Microbiol . 60: 425-49
  • Non-Patent Document 5 Mudgett MB (2005), New insights to the function of phytopathogenic bacterial type III effectors in plants. Annu. Rev. Plant Biol . 56: 509-31
  • Non-Patent Document 6 Cunnac S, Lindeberg M, Collmer A (2009), Pseudomonas syringae type III secretion system effectors: repertoires in search of functions. Curr.Opin.Microbiol . 12: 53-60
  • Non-Patent Document 7 Underhill DM, Goodridge HS (2012), Information processing during phagocytosis, Nat Rev Immunol . 15; 12 (7): 492-502
  • Non-Patent Document 8 Settembre C, Fraldi A, Medina DL, Ballabio A (2013), Signals from the lysosome: a control center for cellular clearance and energy metabolism, Nat Rev Mol Cell Biol . 14 (5): 283-96
  • HopQ1 an effector protein of the plant pathogenic bacterium Pseudomonas syringae , has a role in disrupting the mammalian immune system by inhibiting phagocytosis of macrophages through the regulation of LIMK1 activity in mammalian cells.
  • the invention was completed.
  • the present invention comprises the steps of (a) contacting a test substance to HopQ1, a type III effector protein, and LIM domain kinase 1 (LIMK1) as a binding partner thereof; And
  • test substance inhibits the interaction of the type III effector protein HopQ1 with LIMK1 as a binding partner thereof;
  • screening inhibitors for immunosuppression by HopQ1, a type III effector protein comprising selecting as an inhibitor candidate for immunosuppression by HopQ1, a type III effector protein, if the test substance inhibits the interaction Provide a method.
  • the type III effector protein HopQ1 may be represented by the peptide sequence of SEQ ID NO: 1.
  • nucleic acid sequence (mRNA sequence) of HopQ1, which is the type III effector protein may be represented by SEQ ID NO: 2.
  • the LIMK1 may be represented by the peptide sequence of SEQ ID NO.
  • nucleic acid sequence (mRNA sequence) of the LIMK1 may be represented by SEQ ID NO: 4.
  • Test substances analyzed by the screening methods of the invention are single compounds, mixtures of compounds (eg, natural extracts or cell or tissue cultures), antibodies or peptides.
  • Test substances can be obtained from libraries of synthetic or natural compounds. Methods of obtaining libraries of such compounds are known in the art. Synthetic compound libraries are commercially available from Maybridge Chemical Co. (UK), Comgenex (USA), Brandon Associates (USA), Microsource (USA), and Sigma-Aldrich (USA), and libraries of natural compounds are available from Pan Laboratories (USA). ) And MycoSearch (USA).
  • Test materials can be obtained by a variety of combinatorial library methods known in the art, for example, biological libraries, spatially addressable parallel solid phase or solution phase libraries, deconvolution By the required synthetic library method, “1-bead 1-compound” library method, and synthetic library method using affinity chromatography screening.
  • Methods of synthesizing molecular libraries are described in DeWitt et al., Proc. Natl. Acad. Sci. U.S.A. 90: 6909 (1993); Erb et al. Proc. Natl. Acad. Sci. U.S.A. 91: 11422 (1994); Zuckermann et al., J. Med. Chem.
  • peptide refers to a linear molecule formed by binding amino acid residues to each other by peptide bonds, and typically includes 4-40 amino acid residues.
  • the peptide as a inhibitor of interaction of LQK1 as a binding partner thereof with HopQ1, the type III effector protein of the present invention, is prepared by the solid-phase synthesis method commonly used in the art (Merrifield, RB, J.). Am. Chem. Soc., 85: 2149-2154 (1963), Kaiser, E., Colescot, RL, Bossinger, CD, Cook, PI, Anal.Biochem., 34: 595-598 (1970)).
  • natural extract means obtained by extracting from various organs or parts of natural products (eg, leaves, flowers, roots, stems, branches, shells and fruits, etc.), wherein the natural extracts refer to (a) water, (b) anhydrous or hydrous lower alcohol having 1 to 4 carbon atoms (methanol, ethanol, propanol, butanol, normal-propanol, iso-propanol and normal-butanol, etc.), (c) a mixed solvent of the lower alcohol with water, ( d) acetone, (e) ethyl acetate, (f) chloroform, (g) 1,3-butylene glycol, (h) hexane (i) diethyl ether can be obtained as an extraction solvent.
  • anhydrous or hydrous lower alcohol having 1 to 4 carbon atoms methanol, ethanol, propanol, butanol, normal-propanol, iso-propanol and normal-butanol, etc.
  • an antibody may be used as a test substance.
  • the antibody is an antibody that specifically binds to HopQ or LIMK1, a type III effector protein.
  • the antibody used as a test substance in the present invention includes a bispecific antibody.
  • antibodies having dual specificity to HopQ and LIMK1, which are type III effector proteins, can be used.
  • the antibody is a polyclonal or monoclonal antibody, preferably a monoclonal antibody.
  • Antibodies may be commonly used in the art, for example, in fusion methods (Kohler and Milstein, European Journal of Immunology, 6: 511-519 (1976)), recombinant DNA methods (US Pat. No. 4,816,56) or phage Antibody library methods (Clackson et al, Nature, 352: 624-628 (1991) and Marks et al, J. Mol. Biol., 222: 58, 1-597 (1991)).
  • fusion methods Kellow and Milstein, European Journal of Immunology, 6: 511-519 (1976)
  • recombinant DNA methods US Pat. No. 4,816,56
  • phage Antibody library methods Click-binding of antibodies
  • the type III effector protein HopQ or LIMK1 is contained in one extracellular solution. That is, the method of the present invention can be carried out in one reaction solution in vitro.
  • the assay of the present invention can be performed using a reaction solution containing the purified type III effector proteins HopQ and LIMK1 and a test substance.
  • the type III effector protein HopQ or LIMK1 is contained in vivo. That is, the method of the present invention can be carried out using an intracellular reaction. For example, cells expressing HopQ and LIMK1, which are type III effector proteins, are treated with test material to analyze whether the interaction of TypeQ effector proteins, HopQ and LIMK1, is inhibited in the cell.
  • the cells used in the invention may be mammalian macrophages. According to one embodiment of the present invention, the cells used in the present invention may be mammalian macrophages excluding humans.
  • the protein identified as the binding partner of HopQ, a type III effector protein is LIMK1.
  • LIMK1 used in the method of the present invention is the N-terminal LIM1 domain of LIMK1.
  • the type III effector protein HopQ, its binding partner LIMK1 and a test substance are contacted, and then analyzed whether the test substance inhibits the interaction between the type III effector protein HopQ and its binding partner LIMK1.
  • step (b) comprises a two-hybrid method, a co-immunoprecipitation assay, a co-localization assay, a scintillation proximity assay (SPA) ), UV or chemical crosslinking methods, bimolecular interaction analysis (BIA), mass spectrometry (MS), nuclear magnetic resonance (NMR) or fluorescence polarization assays (FPA) do.
  • a two-hybrid method a co-immunoprecipitation assay, a co-localization assay, a scintillation proximity assay (SPA) ), UV or chemical crosslinking methods, bimolecular interaction analysis (BIA), mass spectrometry (MS), nuclear magnetic resonance (NMR) or fluorescence polarization assays (FPA) do.
  • two-hybrid method herein is based on the modular nature of the transcription factors composed of cleavable DNA-binding and activation domains.
  • LIMK1 may be used as a bait and HopQ, a type III effector protein, as a prey. You can also create a construction in reverse. According to this method, it is possible to screen a substance that inhibits the interaction of LQK1 with HopQ, a type III effector protein.
  • this analysis method uses two DNA constructs. For example, in one construct, LIMK1-encoding polynucleotides are fused to DNA binding domain-encoding polynucleotides of known transcription factors.
  • the DNA-binding and activation domains of the transcription factors are contiguous, which triggers transcription of the reporter gene (eg, LacZ). If the test substance inhibits the interaction of LQK1 with HopQ, a type III effector protein, it will interfere with the expression of the reporter gene, indicating that it can be used as an inhibitor of immunosuppression by HopQ1.
  • a three-hybrid method may be used (US Pat. No. 5,283,317; Zervos et al., Cell 72, 223-232, 1993; Madura et al., J. Biol. Chem. 268). , 12046-12054, 1993; Bartel et al., BioTechniques 14, 920-924, 1993; Iwabuchi et al., Oncogene 8, 1693-1696, 1993; and WO 94/10300).
  • Co-IP co-immunoprecipitation assay
  • 3H-lysine or the like is added to the culture medium to label the target substance and take the culture supernatant. If supernatant is added to the supernatant and non-labeled target substance of the same concentration that can form a specific antibody and antigen antibody complex, the sedimentation reaction occurs. Activity can be used to determine the target material.
  • Antibodies are selected that target a known protein known as a member of a large complex of proteins, and the total protein complex is precipitated in solution by targeting the known complex with the antibody to identify unknown proteins of the complex. This is impossible to measure directly when there is a small amount of unknown substance, so that the culture supernatant is labeled with the target substance in the culture medium, and the non-target material of the same concentration that can form a specific antibody and protein complex is added to the supernatant. In order to cause the settling reaction, the co-sedimentation reaction occurs with the microlabeled target. It is referred to as pull-down because of the concept that the protein complex comes out of solution. Co-immunoprecipitation is widely used to analyze protein-protein interactions.
  • the co-localization assay uses fluorescence staining to observe the spatial overlap between two or more different respective differentiated emission wavelengths under a fluorescence microscope, thereby An assay used to observe other targets in the same space or in close proximity to other cells.
  • Confocal microscopy of the other two fluorescently stained proteins can be performed to determine the location of the two proteins in one location by measuring the color at a particular location, indicating that they are interacting. In other words, it is also functionally coupled (Manders et al, Journal of Microscopy 169: 375-382 (1993); Pawley JB, Handbook of Biological Confocal Microscopy, (2006)).
  • the scintillation proximity assay refers to attaching antibodies to polyvinyl-toluene plastic scintillator beads that fluoresce by energy-bearing electrons, and readily energy on aqueous solution.
  • a radionuclide that emits low energy electrons that loses or dies off is labeled with an antigen that selectively binds to an antibody attached to beads to observe the degree of antigen-antibody binding through fluorescence measurement. (Alouani, Methods Mol. Biol. 138: 135-41 (2000)).
  • chemical cross-linking forms a chemical covalent bond to a biopolymer such as a protein or nucleic acid using a cross-linking reagent, so that the protein subunit structure, protein-nucleic acid interaction
  • a biopolymer such as a protein or nucleic acid using a cross-linking reagent
  • cross-linking reagent so that the protein subunit structure, protein-nucleic acid interaction
  • Crosslinking reagents generally react specifically with functional groups such as amine groups (-NH2), thiol groups (-SH), and carboxylic acid groups (-COOH) in the same molecule, or have functional groups capable of activation by light irradiation at both ends.
  • the bivalent crosslinking reagent which has is used. Although the binding force is very weak or temporary to observe the interaction between proteins, the chemical crosslinking method has the advantage of easy to capture and analyze the interaction between proteins.
  • bimolecular interaction analysis is a technique for analyzing specific interactions in real time, and refers to a method that can be performed without labeling of interactants (eg, BIAcore).
  • TM Surface plasmon resonance
  • SPR surface plasmon resonance
  • fluorescence polarization assay is a mixture of an antibody that binds specifically to CRP and a tracer that combines fluorescein, a fluorescent dye, to C reactive protein (CRP).
  • a method of adding a body fluid (particularly, blood) containing CRP as a measurement object to a solution refers to a method of measuring CRP based on the contention of a tracer and CRP against an antibody in a mixed solution (Degterev, et al. , Nature Cell Biology 3: 173-182 (2001)).
  • the interaction between the type III effector protein HopQ1 and LIMK1 may be an interaction through the N-terminal LIM1 domain of LQK1 with the type III effector protein HopQ1.
  • the immune suppression may inhibit phagocytosis in macrophages of isolated mammals.
  • the immune suppression may inhibit phagocytosis in macrophages of mammals except humans.
  • the inhibitor for immunosuppression by HopQ1 may be a substance for regulating intracellular toxin-induced shock.
  • the intracellular toxin induction may be due to sepsis.
  • the present invention provides a type III effector protein, HopQ1; And it provides a composition for screening inhibitors for immunosuppression by HopQ1, a type III effector protein comprising LIM domain kinase 1 (LIMK1) as a binding partner thereof.
  • LIMK1 LIM domain kinase 1
  • the present invention also provides a composition for inhibiting phagocytosis of macrophages comprising HopQ1, a type III effector.
  • the composition for inhibiting phagocytosis of macrophages comprising HopQ1, a type III effector according to the present invention has an effect of inhibiting phagocytosis of macrophages through the regulation of LIMK1 in animal cells.
  • the present invention relates to a method for screening inhibitors for immunosuppression by HopQ1 using the interaction of type III effector HopQ1 and LIM domain kinase, and a composition therefor, wherein the type III effector protein HopQ1 and LIMK1 as a binding partner thereof are disclosed.
  • Interaction inhibitors can be used as substances for controlling intracellular toxin-induced shock by regulating the inhibition of phagocytosis by HopQ1.
  • FIG. 1 is a graph summarizing the flow cytometry results
  • Pta is GFP-expressing P. syringae pv. tabaci
  • Pto is P. syringae pv. tomato
  • E. coli represent E. coli DH5 ⁇
  • the left graph of B of FIG. 1 is a graph showing the flow cytometry results
  • the right is a diagram showing the flow cytometry results
  • FIG. 1D shows gentamiin protection assay results As P. syringae pv. tabaci ( Pta ), P.
  • Figure 2 is a diagram showing the cytokine cytokine after the inoculation of Pto , Pta or E. coli
  • A, B and C are respectively TNF- ⁇
  • C is a diagram showing the amount of IL-6 expression
  • D is a diagram showing the result of protein blotting showing MAPK signal and NF- ⁇ B activity after inoculation of Pto , Pta or E. coli .
  • FIG. 3A is a graph summarizing the flow cytometry results and the right is a diagram showing the flow cytometry results, and the image of B of FIG. 3 is peritoneal macrophages infected with Pto DC3000 or ⁇ hrpL (green) for 1 and 2 hours.
  • Fig. 3C shows the results of gentamiin protection assay, showing the results for Pto DC3000 ( Pto ) or ⁇ hrpL , respectively. It is a graph showing the survival rate when infected with Pto DC3000 ( Pto ) or ⁇ hrpL mutant.
  • Figure 4A is a diagram showing the flow cytometry results showing the degree of infection of bacteria after infection with Pto DC3000 ( Pto ) or ⁇ hrpL mutant
  • Figure 4B is an early endosomal marker ( Pto and Pta for This figure shows the results of western blotting measuring the markers of early endosome marker, Eea1, pleckstrin and Rab 5 and late endosome, Rab7 and Lamp1.
  • FIG. 5 is a diagram showing cytokine cytokine after the inoculation of Pto or ⁇ hrpL mutant, in Figure 2 A, B and C is TNF- ⁇ , B is IL-1 ⁇ , after inoculation of the virus Pto or ⁇ hrpL mutant, respectively C is a diagram showing the amount of IL-6 expression, D is a diagram showing the result of western blotting showing MAPK signal and NF- ⁇ B activity after inoculation of Pto or ⁇ hrpL mutant.
  • Figure 6 shows the results of gentamiin protection assay.
  • FIG. 7A is a diagram showing the results of western blotting to confirm that plant HopQ1 interacts with mammalian LIMK1
  • FIG. 7B is phosphorylation of cofilin1 and LIMK1 in 293T cells.
  • FIG. 7C is a GST pull-down assay showing that HopQ1 interacts with LIMK1 via the N-terminal LIM1 domain of LIMK1.
  • the left image of D of 7 is a diagram showing the co-localization of both LIMK1 and HopQ1 in 3T3-L1 cells, and the right D of FIG. 7 is in HopQ1-transfected 3T3-L1 cells.
  • Fig. 7E is a diagram showing the results of protein blotting showing whether phosphorylation of LIMK1 and cofilin1 during peritoneal macrophage infection by HopQ1-expressing P. fluorescens.
  • FIG. 8A is a diagram showing the number of bacteria in the peritoneal cavity, blood, spleen and liver from Pto DC3000 or Pto ⁇ hprL -inoculated mice
  • FIG. 8B is a phagocytic cup after infecting Pto or ⁇ hprL with a RAW 264.7 cell line.
  • Figure 8 C is a diagram showing the flow cytometry results of GFP-expressing E.cloacae or DsRed and HopQ-expressing E.cloacae
  • the left side of D of Figure 8 is a plasmid containing HopQ1 E.cloacae with or without E.cloacae shows bacterial colony formation in the peritoneal cavity, blood, spleen and liver from 10-12 week old mice and the right or with E.cloacae with or without plasmid containing HopQ1 10-12
  • Figure 8 C is a diagram showing the flow cytometry results of GFP-expressing E.cloacae or DsRed and HopQ-expressing E.cloacae
  • the left side of D of Figure 8 is a plasmid containing HopQ1 E.cloacae with or without E.cloacae shows bacterial colony formation in the peritoneal cavity, blood, spleen and liver from 10-12 week old mice and the right or with E.cloacae with or without
  • 9 is a microscopic image showing whether phagocytic cups were formed after infection with Pto or ⁇ hprL in RAW 264.7 cell line.
  • Figure 10 shows the results of flow cytometry of GFP-expressing E.cloacae or DsRed and HopQ-expressing E.cloacae .
  • FIG. 11 is a micrograph showing flow cytometry results of GFP-expressing E.cloacae or DsRed and HopQ-expressing E.cloacae .
  • mice To obtain peritoneal macrophages from mice, 3% thioglycollate was injected into the abdominal cavity of C57BL / 6 mice, and 4 days later, 10 ml of RPMI media was added to the abdominal cavity of mice to obtain peritoneal macrophages. After culturing in a 37 ° C., 5% CO 2 incubator, cells which did not adhere to the culture dish were removed and prepared by incubating 37 ° C., 5% CO 2 incubator with RPMI medium containing 10% FBS.
  • GFP-expressing plasmid was introduced P. syringae pv. tabaci, P. syringae pv. tomato, or E. coli Preparation of DH5 ⁇
  • P. syringae pv. tabaci and P. syringae pv. Tomato strains were cultured at 200 ° C. in 200 ml of King's B medium and E. coli DH5 ⁇ was incubated at 37 ° C. in 200 ml of LB medium. After culturing the strain only from 0.4 to 0.6 at absorbance at 600 nm, centrifugation was carried out for 15 minutes at 3,000 rpm at 4 ° C. to remove the bacterial medium, and 200 ml of cold 300 mM sucrose was added to mix the precipitates. After centrifugation again, excess bacterial medium was removed.
  • tomato DC3000 (NCPPB 4369) were obtained from the National Collection of Plant Pathogenic Bacteria, York, UK) were 50 ug / ml of kanamycin. 1 ml of King's B medium containing kanamycin was added and incubated at 30 ° C. for 2 hours.
  • E. coli DH5 ⁇ ( E. coli DH5 ⁇ (KCTC 2466)) was prepared using KCTC (Korean Collection for Type Cultures, Daejeon, 1 ml of LB medium containing 50 ug / ml of kanamycin was also incubated at 37 ° C.
  • P. syringae pv. In which GFP-expressing plasmid was introduced by electroporation into peritoneal macrophages obtained from the abdominal cavity of mice. tabaci, P. syringae pv.
  • RPM medium with 10% FBS peritoneal macrophage culture medium
  • MOI multiplelicity of infection
  • the cells were washed with phosphate buffered saline and scraped off. More specifically, intraperitoneal macrophages were cultured in 12-well petri dishes on a 1 ⁇ 10 6 cell basis, and then P. syringae tabaci, P.
  • GFP-expressing P. syringae pv. tabaci ( Pta ), P. syringae pv. tomato ( Pto ) or E. coli DH5 ⁇ ( E. coli ) was mixed with macrophage culture medium (RPM medium containing 10% FBS) and then treated with macrophages isolated from mouse abdominal cavity for 1 hour. After infection, the bacteria were washed with phosphate buffered saline to remove uninfected bacteria.
  • Phagocytosis levels in peritoneal macrophages were determined by performing immunofluorescence.
  • GFP-expressing P. syringae pv prepared in the same manner as in FIG. tabaci, P. syringae pv. tomato, or E. coli DH5 ⁇ -treated macrophages were fixed with 4% formaldehyde, stained with cell nuclei with DAPI, a nuclear staining reagent with cell membrane permeability, followed by confocal laser microscopy. (Carl Zeiss, LSM510) was used to analyze bacteria showing GFP fluorescence in peritoneal macrophages.
  • the cells were cultured with 2.0 ⁇ 10 5 cell numbers, and then P. syringae tabaci , P. syringae tomato and E. coli DH5 ⁇ expressing GFP were 2.0 ⁇ 10 6. Infected hourly with CFU count. After infection, the culture medium was removed, followed by washing three times 1 ml of cold phosphate-buffered saline (PBS) to remove bacteria remaining around the cells. Next, PBS containing 4% paraformaldehyde was added and fixed at room temperature for 20 minutes, followed by DAPI dye addition for 5 minutes, followed by cold staining of phosphate buffered saline (PBS). Three washes were performed to remove the remaining DAPI, thereby preparing an immunostained sample. The prepared immunostaining samples were analyzed by fluorescence image using a confocal microscope LSM510 confocal microscope (Carl Zeiss).
  • the image of C of FIG. 1 shows the macrophages pattern in mouse peritoneal macrophages infected with each bacterium (green) for the indicated times (1 h, 2 h, 4 h).
  • the reference is 20 ⁇ m.
  • P. syringae pv. In peritoneal macrophages isolated from the abdominal cavity to C57BL / 6 mice prepared in the same manner as in FIG. tabaci, P. syringae pv. Infecting tomato or E. coli DH5 ⁇ 50% of bacteria in peritoneal macrophages are mixed in macrophage medium (RPM medium with 10% FBS) and treated for 1 hour. Internalized bacterial levels were measured by gentamiin protection assays.
  • the gentamiin protection assay infects peritoneal macrophages for 1 hour (specifically, incubating the peritoneal macrophages in a 12-well petri dish based on 1 x 10 6 cells and then placing the bacteria in 5.0 ⁇ 10 7 CFU water). Infected cells for 1 hour, and then washed uninfected bacteria around the periphery of the peritoneal macrophage and treated with gentamiin at a concentration of 100ug / ml for 1 hour After elution of the bacteria remaining in the peritoneal macrophages with 2% Triton X-100 (phosphate buffered saline), plated on Agar plate and incubated for 24 hours at 30 °C The number of bacteria was checked.
  • Triton X-100 phosphate buffered saline
  • the primary capture antibody was reacted in a 96-well plate for 12 hours at room temperature, and then phosphate buffered saline (PBS) containing 1% BSA was added for 1 hour at room temperature to prevent nonspecific binding. Proceeded. After washing three times with phosphate buffered saline (PBS) containing 0.1% Tween20, the sample to be measured was halved for 2 hours at room temperature. After completion of the sample reaction, washing with PBS containing 0.1% Tween20 three times, adding a secondary detection antibody and reacting at room temperature for 2 hours, followed by phosphate buffered physiology containing 0.1% Tween20 Washed three times with saline (phosphate bufffered saline, PBS).
  • PBS phosphate buffered saline
  • the Streptavidin-HRP solution was added and reacted at room temperature for 20 minutes. After washing three times in the same manner as before, the microtiter plate reader (Emax; Molecular Devices) was added. The absorbance was measured at 450 nm at and the amount of cytokine was analyzed.
  • MAPK signaling and NF- ⁇ B activity were performed by adding a lysis buffer (RIPA lysis buffer) to infected macrophages to harvest macrophage proteins followed by antibody sequencing of each protein indicated using protein blotting (western blotting).
  • Pto uses a type III secretion system that secretes a viral effector into plant cells.
  • a type III secretion system that secretes a viral effector into plant cells.
  • the inventors of the wild type Pto DC3000 lacking the sigma factor of the type III secretion system resulting in abolishment of effector secretion. Wild type Pto DC3000 was analyzed as compared to the ⁇ hrpL mutant.
  • Peritoneal macrophages obtained from mouse abdominal cavity were inoculated with GFP-expressing Pto DC3000 or ⁇ hrpL (MOI, 20: 1) in macrophage medium ( RPM medium with 10% FBS) for the indicated times (30 minutes, 1 hour and 2 hours). Infected by mixing, washed with phosphate buffered saline and scraped off. In order to identify bacteria that are infected and removed in abdominal macrophages, 4% formaldehyde (fixed) was used to indicate the extent to which bacteria were removed using flow cytometry as shown in FIG. Measured and analyzed over time. The cells were fixed and the remaining bacteria analyzed by flow cytometry.
  • 3A is a graph summarizing the flow cytometry results and the right graph shows the flow cytometry results. Data is mean ⁇ standard deviation calculated from three wells for each time point (** P ⁇ 0.01). 3A, it was confirmed that the phagocytosis level was dramatically increased in mouse peritoneal macrophages infected with ⁇ hrpL .
  • Phagocytosis levels in peritoneal macrophages from mice were fixed with 4% formaldehyde in peritoneal macrophages treated with plant bacteria and phosphate buffered saline containing 0.2% Triton X-100. Induced cell membrane permeabilization with phosphate buffered saline, followed by staining of actin-specific antibodies (conjugated with the red dye Alexa Fluor 546 (Alexa 546)), followed by nuclear staining to stain cell nuclei Cell nuclei were stained by treatment with the reagent DAPI to measure and analyze bacteria having GFP fluorescence in peritoneal macrophages using a confocal laser microscope (Carl Zeiss, LSM510). The image of B of FIG.
  • FIG. 3 shows phagocytic inhibition in peritoneal macrophages infected with Pto DC3000 or ⁇ hrpL (green) for 1 and 2 hours.
  • the reference is 1 ⁇ m. 3B, it was confirmed that the phagocytosis level was dramatically increased in mouse peritoneal macrophages infected with ⁇ hrpL .
  • the bacteria were treated by the time indicated in the RAW264.7 cells, and then fixed with 4% formaldehyde to fix the remaining GFP fluorescence of 1 A flow cytometry such as A was used to measure the degree of bacterial infection.
  • Figure 4 a graph of A is a summary graph of flow cytometry results, with the results of the A of Figure 4, after the infection with respect to the observed results phagocytosis as measured by phagocytosis levels in RAW264.7 cells Pto DC3000 It was confirmed that the decrease in ⁇ hrpL significantly compared to ( Pto ).
  • the present inventors collected the supernatant by collecting the supernatant by collecting the medium of infected macrophages to determine the cytokine of macrophages after inoculation of either wild type Pto DC3000 or ⁇ hrpL, and then the enzyme-linked immunosorbent assay ( enzyme-linked immunosorbent assay (ELISA) method was used.
  • ELISA enzyme-linked immunosorbent assay
  • TNF- ⁇ , IL-1 ⁇ and IL-6 were identified using DuoSet antibody pairs (R & D Systems) to measure the levels of cytokines in cell culture media, mouse blood and tissues.
  • the primary capture antibody was reacted in a 96-well plate for 12 hours at room temperature, and then phosphate buffered saline (PBS) containing 1% BSA was added for 1 hour at room temperature to prevent nonspecific binding. Proceeded. After washing three times with phosphate buffered saline (PBS) containing 0.1% Tween20, the sample to be measured was halved for 2 hours at room temperature. After completion of the sample reaction, washing with PBS containing 0.1% Tween20 three times, adding a secondary detection antibody and reacting at room temperature for 2 hours, followed by phosphate buffered physiology containing 0.1% Tween20 Washed three times with saline (phosphate bufffered saline, PBS).
  • PBS phosphate buffered saline
  • the Streptavidin-HRP solution was added and reacted at room temperature for 20 minutes. After washing three times in the same manner as before, the microtiter plate reader (Emax; Molecular Devices) was added. The absorbance was measured at 450 nm at and the amount of cytokine was analyzed.
  • MAPK signaling and NF- ⁇ B activity were performed by adding a lysis buffer (RIPA lysis buffer) to infected macrophages to harvest macrophage proteins followed by antibody sequencing of each protein indicated using protein blotting (western blotting).
  • the Pseudomonas syringae Hrp pathogenicity island has a tripartite mosaic structure composed of a cluster of type III secretion genes bounded by exchangeable effector and conserved effector loci that contribute to parasitic fitness and pathogenicity in plants.Proc.Natl.Acad.Sci.USA 97: 4856.61, Kvitko BH, Park DH, Velasquez AC, Wei CF, Russell AB, et al. 2009. Deletions in the repertoire of Pseudomonas syringae pv. tomato DC3000 type III secretion effector genes reveal functional overlap among effectors.PLoS Pathog. 5: e1000388).
  • the gentamiin protection assay completely infects the peritoneal macrophages for 1 hour and then washes off the uninfected bacteria around the peritoneal macrophages. To remove the gentamicin for 1 hour at a concentration of 100 ug / ml, bacteria remaining in the peritoneal macrophages with phosphate buffered saline containing 2% Triton X-100 were removed. Elution confirmed the number of bacteria.
  • HopQ1 limits phagocytosis
  • flag-tagged HopQ1 was introduced into the 293T cell line to find binding partner proteins in mammalian cells.
  • pBICEP vector 1 ⁇ g was cut using the restriction enzymes NotI and BamHI, loaded onto agarose gel to check the size, purified from the gel, and quantified by DNA quantification to 50ng.
  • the flagged HopQ1 expression system was prepared by performing ligation of the prepared HopQ 100ng and the cut pBICEP vector with INFUSION HD enzyme (Clontech Laboratories).
  • mCherry-labeled HopQ1 was prepared using pLVX-mCherry-N1 vcetor, a vector expressing mCherry fluorescence.
  • Mouse LIMK1 (full), forward 5'-GCGTGGATCCACTAGTATGAGGTTGACGCTACTTT-3 '(SEQ ID NO: 9) (SpeI) and reverse 5'-TCTAGAGTCGCGGCCTCAGTCAGGGACCTCGGG-3' (SEQ ID NO: 10) (NotI); Mouse LIMK1 ( ⁇ Lim1), forward 5'-GCGTGGATCCACTAGTGGCGAGTCTTGCCACGG-3 '(SEQ ID NO: 11) (SpeI) and reverse 5'-TCTAGAGTCGCGGCCTCAGTCAGGGACCTCGGG-3' (SEQ ID NO: 12) (NotI); Mouse LIMK1 ( ⁇ Lim2) forward 5'-GCGTGGATCCACTAGTGAACAGATCCTACCTGAC-3 '(SEQ ID NO: 13) (SpeI) and reverse 5'-TCTAGAGTCGCGGCCTCAGTCAGGGACCTCGGG-3' (SEQ ID NO: 14) (NotI); Mouse LIMK1 ( ⁇
  • 100 ng of Limk1 was prepared using the same method as HopQ1, and 50 ng of pEBG vector was also prepared by the same method as pBCIEP vector, followed by ligation with INFUSION HD enzyme (Clontech Laboratories) to prepare a GST-labeled Limk1 expression system.
  • the 293T cell line was cultured in a 6-well culture dish (DMEM medium containing 10% FBS) based on 1 x 10 6 cells, and then DMEM medium containing 10% FBS without antibiotics. 2 ml were fed to the culture dish.
  • the prepared vector was mixed with 250 ⁇ l of opti-MEM medium in a ratio of 1: 3 with a reagent of TransIT-X2Dynamic Delivery System (Mirus) at a ratio of 1: 3 and reacted at room temperature (24 ° C) for about 30 minutes, and then added to the prepared 293T cell line for 24 hours. After that, the expression amount was confirmed and used for the experiment.
  • a reagent of TransIT-X2Dynamic Delivery System Mirus
  • 293 cells were transfected with a pBICEP vector expressing only control anti-DYKDDDDK ⁇ Flag ⁇ or pBICEP containing an anti-DYKDDDDK ⁇ Flag ⁇ tagged HopQ1 gene. Twenty four hours after transfection, cells were eluted with a RIPA lysis buffer and the same amount of protein with anti-DYKDDDDK ⁇ Flag ⁇ tagged magnetic beads for 2 hours at 4 ° C. on a rotating device.
  • LIM domain kinase 1 is a serine / threonine kinase that is phosphorylated by various kinases and then activated. Phosphorylated LIMK1 induces phosphorylation and inactivation of cofilin1, which regulates the polymerization and depolymerization of actin (Bravo-Cordero JJ, Magalhaes MA, Eddy RJ, Hodgson L, Condeelis J (2013), Functions of cofilin in cell locomotion and invasion, Nat Rev Mol Cell Biol. 14 (7): 405-15).
  • 293 cells were transfected with a pBICEP vector expressing only control anti-DYKDDDDK ⁇ Flag ⁇ or pBICEP containing an anti-DYKDDDDK ⁇ Flag ⁇ tagged HopQ1 gene. 24 hours after transfection, cells were harvested with a RIPA lysis buffer and the same amount of protein was expressed by pLimk1, Limk1, pCofilin1, Cofilin1, Ssh1, chronophin and ⁇ -actin by HopQ1 expression. The level of was determined by detecting with antibodies to each using protein blotting as shown in Figure 7A.
  • the antibody information used was as follows (Rabbit IgG anti pLimk1 antibody, Rabbit IgG anti Limk1 antibody, Rabbit IgG anti pCofilin1 antibody, Rabbit IgG anti Cofilin1 antibody, Rabbit IgG anti Ssh1 antibody, Rabbit IgG anti chronophin antibody and Rabbit IgG anti ⁇ -actin antibody, purchased from Cell signaling).
  • LIMK1 consists of two LIM domains, a PDZ domain, and a kinase domain. To reveal how HopQ1 interacts with LIMK1, we generated domain deletion mutants of LIMK1. HopQ1 (flag expressing pBICEP)-and Limk1 (GST expressing pEBG) -encoding vectors were cotransfected into 293T. To confirm protein complexes using GST pull-down assay, 294T cells were harvested with RIPA lysis buffer, followed by protein quantification using BCA method. After adding the same amount of glutathione-agarose beads to the amount of protein and incubating at 4 ° C.
  • 3T3-L1 cells were transfected with either GST-Limk1 (green) or mCherry-HopQ1 (red), which is endogenous red fluorescence intracellularly, fixed with 4% formaldehyde and then 0.2% Triton X- After inducing cell membrane permeabilization with phosphate buffered saline containing 100 (Triton X-100) and incubating the anti-GST antibody for 12 hours, the anti-GST antibody was specifically LIMK1 (green) was stained by incubating for 1 hour (DMEM medium with 10% FCS (fetal calf serum)) with a recognized secondary antibody (conjugated with green dye Alexa Fluor 488 (Alexa 488)).
  • the cell nuclei were stained with DAPI, a nuclear staining reagent, and GFP (green) fluorescence and mCherry (red) fluorescence in peritoneal macrophages using a confocal laser microscope (Carl Zeiss, LSM510). Proteins were measured and analyzed.
  • the left image of D in FIG. 7 shows co-localization of both LIMK1 and HopQ1 in 3T3-L1 cells.
  • the reference ruler is 10 ⁇ m.
  • HopQ1 expression was determined by Western blot analysis in cells.
  • the diagram on the right side of FIG. 7 shows HopQ1 levels in HopQ1-transfected 3T3-L1 cells.
  • intracellular proteins were harvested by adding the RIPA lysis buffer at the indicated time, followed by Limk1, pLimk1, pCofilin1, Cofilin1, and Chronopin ( chronophin), Ssh1, and ⁇ -actin levels were determined by detection with antibodies to each using protein blotting as shown in FIG.
  • the antibody information used at this time is as follows ( rabbit IgG anti pLimk1 antibody, Rabbit IgG anti Limk1 antibody, Rabbit IgG anti pCophylline 1 antibody and Rabbit IgG anti CoColin1 antibody, purchased from Cell signaling).
  • mice are injected with Pto DC3000 or ⁇ hrpL.
  • Pto DC3000 or Pto ⁇ hrpL (10 8 CFU live bacteria) 10-12 weeks old C57BL / 6 mice were dissolved in phosphate buffered saline and 0.2 ml injected into the mouse intraperitoneally. After 24 hours, the liver and the spleen of the mouse were weighed and weighed. Then, 70 ⁇ m strainer was added to King's Media, and the tissue was crushed.
  • Phagocytic cup formation for remodeling actin cytoskeleton was analyzed by a time-lapse microscope.
  • Pto DC3000 or ⁇ hrpL mutants were processed into RAW 264.7 cells and then monitored over a period of 30 minutes by capturing images every 15 seconds.
  • the RAW 264.7 cell line was incubated in RPMI medium containing 10% FBS for 24 hours at 1 ⁇ 10 5 cell number in a 35mm dish ( ⁇ -dish), followed by fluorescence microscope (Olympus, IX81-).
  • Enterobacter cloacae which is a member of many human normal gut floras and contains a type III secretion system (Kvitko BH, Park DH, Velasquez). AC, Wei CF, Russell AB, et al. 2009. Deletions in the repertoire of Pseudomonas syringae pv. Tomato DC3000 type III secretion effector genes reveal functional overlap among effectors.PLoS Pathog. 5: e1000388).
  • E.cloacae pDSK-GFPuv vector and HopQ cloned, transforming each vector to express green fluorescence
  • E.cloacae KCTC 2361
  • DsRed and HopQ-expressing E.cloacae cloning HopQ in the same vector as pBBRBB-DsRED vector and then hemochromating each vector to red fluorescence.
  • 8 10 have a plasmid containing a HopQ1 as CFU / ml or no E.cloacae a phosphate buffer to a 10 to 12-week-old mice 0.2 ml of the solution was dissolved in saline (phosphate buffered saline) and injected intraperitoneally. After 24 hours, blood, spleen and liver samples were harvested and then homogenized and plated on agar plates and then incubated for 24 hours. After 24 hours, the liver and the spleen of the mouse were weighed and weighed.
  • saline phosphate buffered saline
  • FIG. 12A shows early on occurrence of normal phagocytosis by macrophages Co-localization of EEA1 and bacteria involved in phagosome maturation can be identified, but P. syringae pv . Tomato did not show this phenomenon.
  • the result of B of FIG. 12 is a diagram showing degradation of bacteria by seamless binding with lysosomes, which is the final stage of phagocytosis, P. syringae pv . Tomato showed that only a small amount of bacteria enter macrophages due to the inhibition of early phagocytosis.
  • P. syringae pv . tabaci and E. coli are co-localized (marked in yellow), as indicated by the white arrows, but P. syringae pv . Tomato was found to reduce the number of bacteria itself (or green).
  • Limk1 phosphorylation by HopQ1 maintains cofilin phosphorylation, regulates the assembly and degradation of actin filaments, and inhibition of cophylline by excessive phosphorylation results in protrusion, cell polarity and chemistry Causes defects in chemotaxis (Bravo-Cordero JJ, Magalhaes MA, Eddy RJ, Hodgson L, Condeelis J (2013), Functions of cofilin in cell locomotion and invasion, Nat Rev Mol Cell Biol. 14 (7) ): 405-15).
  • the present inventors have identified a special role of the HopQ1 effector of Pseudomonas syringae to limit host phagocytosis through phosphorylation of cophylline by directly targeting LIMK1 involved in cell migration.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biophysics (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Cell Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Investigating Or Analysing Biological Materials (AREA)

Abstract

본 발명은 타입 III 에펙터 HopQ1 및 LIM 도메인 키나아제의 상호작용을 이용한 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물에 관한 것으로, 상기 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIMK1의 상호작용 억제제는 HopQ1에 의한 식균작용의 억제를 조절함으로써 세포내 독소 유발 쇼크 조절용 물질로 이용될 수 있다.

Description

타입 III 에펙터 HOPQ1 및 LIM 도메인 키나아제1(LIMK1)의 상호작용을 이용한 HOPQ1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물
본 발명은 타입 III 에펙터 HopQ1 및 LIM 도메인 키나아제의 상호작용을 이용한 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물에 관한 것이다.
Pseudomonas syringae pv. tomato는 식물과 감수성 식물에 질환을 야기하는 병원성 세균 사이의 상호작용에 사용되는 모델 중 하나이다(Xin XF, He SY (2013), Pseudomonas syringae pv. tomato DC3000: a model pathogen for probing disease susceptibility and hormone signaling in plants, Annu Rev Phytopathol. 51:473-98). P. syringae pv. tomato (Pto)는 타입 III 분비 시스템을 통하여 숙주 방어 기전을 유도해내고 억제하는 식물 사이토졸(cytosol) 내로 다양한 에펙터(effector) 단백질을 주입하는 것으로 알려져 있다(Block A, Alfano JR (2011), Plant targets for Pseudomonas syringae type III effectors: virulence targets orguarded decoys Curr.Opin.Microbiol. 14:39-46, Boller T, He SY (2009), Innate immunity in plants: an arms race between pattern recognition receptors in plants and effectors in microbial pathogens. Science 324:742-44, Grant SR, Fisher EJ, Chang JH, Mole BM, Dangl JL (2006), Subterfuge and manipulation: type III effector proteins of phytopathogenic bacteria. Annu. Rev. Microbiol. 60:425-49, Mudgett MB (2005), New insights to the function of phytopathogenic bacterial type III effectors in plants. Annu. Rev. Plant Biol. 56:509-31). Pto DC3000에 있어서, 적어도 28개의 에펙터는 완전히 활성이고 충분히 발현되어 애기장대(Arabidopsis) 및 토마토 식물에 있어서의 타입 III 에펙터 전위(translocation) 어세이에 의해 검출되는 것으로 입증되었다(Cunnac S, Lindeberg M, Collmer A (2009), Pseudomonas syringae type III secretion system effectors: repertoires in search of functions. Curr.Opin.Microbiol. 12:53-60).
그런데, 특정 에펙터의 동물세포로의 전위는 계 장벽(kingdom barrier)으로 인하여 조사되지 않았다. 식물 세포와는 달리, 동물 세포는 복잡한 기전 예컨대 식세포 작용에 의해 병원균 및 세포 잔해를 깨끗이 하는데 사용되는 특정 기전인 대식세포를 가져온다. 식세포 작용에 있어서의 필수적인 진행은 대식세포의 표면 수용체에 의한 병원균을 인식하고 그리고 나서 병원균인 포식리소좀(phagolysosome)으로 융합되고 대식세포에 의해 소화되는 것이다(Underhill DM, Goodridge HS (2012), Information processing during phagocytosis, Nat Rev Immunol. 15;12(7):492-502, Settembre C, Fraldi A, Medina DL, Ballabio A (2013), Signals from the lysosome: a control centre for cellular clearance and energy metabolism, Nat Rev Mol Cell Biol. 14(5):283-96).
[선행기술문헌]
[비특허문헌]
(비특허문헌 1) Xin XF, He SY (2013), Pseudomonas syringae pv. tomato DC3000: a model pathogen for probing disease susceptibility and hormone signaling in plants, Annu Rev Phytopathol. 51:473-98
(비특허문헌 2) Block A, Alfano JR (2011), Plant targets for Pseudomonas syringae type III effectors: virulence targets orguarded decoys Curr.Opin.Microbiol. 14:39-46
(비특허문헌 3) Boller T, He SY (2009), Innate immunity in plants: an arms race between pattern recognition receptors in plants and effectors in microbial pathogens. Science 324:742-44, Grant SR, Fisher EJ, Chang JH, Mole BM, Dangl JL (2006)
(비특허문헌 4) Subterfuge and manipulation: type III effector proteins of phytopathogenic bacteria. Annu. Rev. Microbiol. 60:425-49
(비특허문헌 5) Mudgett MB (2005), New insights to the function of phytopathogenic bacterial type III effectors in plants. Annu. Rev. Plant Biol. 56:509-31
(비특허문헌 6) Cunnac S, Lindeberg M, Collmer A (2009), Pseudomonas syringae type III secretion system effectors: repertoires in search of functions. Curr.Opin.Microbiol. 12:53-60
(비특허문헌 7) Underhill DM, Goodridge HS (2012), Information processing during phagocytosis, Nat Rev Immunol. 15;12(7):492-502
(비특허문헌 8) Settembre C, Fraldi A, Medina DL, Ballabio A (2013), Signals from the lysosome: a control centre for cellular clearance and energy metabolism, Nat Rev Mol Cell Biol. 14(5):283-96
이에 본 발명자들은 식물 병원성 박테리아인 Pseudomonas syringae의 에펙터 단백질인 HopQ1이 포유동물 세포에 있는 LIMK1의 활성 조절을 통해 대식세포의 식균작용 억제함으로써 포유동물의 면역체계를 교란시키는 역할을 나타냄을 확인함으로써 본 발명을 완성하였다.
따라서 본 발명의 목적은 타입 III 에펙터 HopQ1 및 LIM 도메인 키나아제의 상호작용을 이용한 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물을 제공하는 데에 있다.
또한 본 발명의 목적은 타입 III 에펙터인 HopQ1을 포함하는 대식세포의 식균 작용 억제용 조성물을 제공하는 데에 있다.
상기 목적을 달성하기 위하여, 본 발명은 (a) 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIM 도메인 키나아제 1(LIMK1)에 시험물질을 접촉시키는 단계; 및
(b) 상기 시험물질이 상기 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIMK1의 상호작용을 억제하는 지 여부를 분석하는 단계;
(c) 상기 시험물질이 상기 상호작용을 억제하면 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 저해제 후보로 선별하는 단계를 포함하는 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝 방법을 제공한다.
본 발명에서 상기 타입 III 에펙터 단백질인 HopQ1은 서열번호 1의 펩티드 서열로 표시될 수 있다.
HopQ1의 펩티드 서열 (서열번호 1)
MHRPITAGHTTSRLILDQSKQISRTPSESSAQSALSQQASMSSPVLERSKSAPALLTAAQRTMLAQVGACNAHLTSDENMAINELRSHKPLLPKDTWFFTDPNKDPDDVVTYTLGKQLQAEGFVHITDVVATLGDAEVRSQRAEMAKGVFNKLELHDVHVSRGRDYAMNSLQSKEHAKFLLEGHALRAGPGEIHRDSLQDMSRRLARAPHGVGIVVIAGMSDINALITTCPDMVRERVDDITIMGGVEPLKDADGFVQPDARAYNNATDMDAARSLYRKAQELGIPLRIVTKEAAYKTAVSPSFYEGIAGSGHPVGHYLRDVQKSALKGLWEGIQAGLLPGLDDSWFFRTFMPNAQIEAAQLDKNKESSFEDIWPKVTKLNLYDPLTLLASVPGAAKLLFKPKAIHTEGFGVVEQVGPDDVTHPEKAKLLMSALAKSALVQSTVAPD
본 발명에서 상기 타입 III 에펙터 단백질인 HopQ1의 핵산서열(mRNA 서열)은 서열번호 2로 표시될 수 있다.
HopQ1의 핵산분자 서열 (서열번호 2)
ATGCATCGTCCTATCACCGCAGGCCATACCACCTCACGTCTCATCCTAGATCAGTCAAAACAAATATCACGTACCCCATCGGAAAGTAGCGCGCAATCAGCGCTTTCTCAGCAAGCAAGCATGAGCAGCCCAGTTTTGGAGCGGTCGAAAAGTGCGCCAGCTTTATTGACTGCGGCACAGCGCACGATGCTTGCACAAGTGGGAGCCTGTAACGCTCATCTGACCTCAGATGAAAACATGGCCATCAACGAACTGAGATCACACAAGCCCCTTTTACCTAAGGATACGTGGTTTTTCACTGATCCTAACAAGGACCCAGATGATGTCGTGACCTACACCTTGGGCAAGCAATTGCAGGCTGAGGGCTTTGTGCACATCACGGATGTAGTGGCGACACTGGGTGATGCTGAAGTTCGCTCTCAACGTGCCGAGATGGCCAAAGGCGTGTTCAACAAGCTTGAGTTGCATGACGTGCATGTGTCGCGTGGTCGGGATTACGCAATGAATTCGCTTCAGTCGAAGGAACATGCCAAATTTTTACTGGAAGGTCATGCTTTAAGGGCTGGACCTGGTGAAATACACCGCGACAGCTTGCAGGACATGAGCAGGCGCCTGGCCCGTGCGCCACATGGAGTCGGTATTGTCGTAATTGCAGGCATGAGTGATATCAATGCGCTCATCACTACCTGCCCGGATATGGTGCGCGAACGGGTTGATGACATCACCATCATGGGCGGCGTCGAGCCTTTAAAGGACGCAGATGGTTTTGTACAGCCTGATGCACGCGCTTACAACAATGCGACCGACATGGACGCTGCGCGCAGTCTTTATCGGAAAGCGCAGGAGCTTGGCATTCCACTTCGTATAGTGACAAAGGAGGCGGCCTATAAAACGGCGGTTTCGCCTTCATTTTACGAAGGGATAGCGGGGAGCGGACATCCAGTAGGCCACTACCTGAGAGACGTTCAGAAGAGTGCGTTGAAAGGCCTCTGGGAAGGTATTCAAGCTGGATTGCTTCCCGGGTTGGATGACTCATGGTTCTTTCGGACGTTCATGCCGAATGCACAGATTGAAGCAGCACAACTGGATAAAAATAAAGAGAGTTCGTTTGAAGATATCTGGCCTAAGGTGACGAAGCTAAACCTGTATGATCCTCTGACATTACTGGCCTCAGTGCCAGGGGCGGCAAAACTGCTATTTAAACCAAAAGCTATACACACAGAAGGATTTGGTGTTGTAGAGCAAGTAGGTCCAGATGATGTGACGCATCCAGAGAAAGCAAAGTTATTGATGTCCGCTTTAGCCAAATCTGCGCTTGTCCAGTCGACGGTAGCCCCAGATTGA
본 발명에서 상기 LIMK1은 서열번호 3의 펩티드 서열로 표시될 수 있다.
LIMK1 펩티드 서열 (서열번호 3)
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSVSLSHQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLACGNFIGDGDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLSSPVHTPSGQAASSARQKPVLRSCSIDTSPGTSSLASPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKNMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLMIDEKNQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLSGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD
본 발명에서 상기 LIMK1의 핵산서열(mRNA 서열)은 서열번호 4로 표시될 수 있다.
Limk1 핵산 서열 (서열번호 4)
ATGAGGTTGACGCTACTTTGTTGCACCTGGAGGGAAGAACGTATGGGAGAGGAAGGAAGCGAGTTGCCTGTGTGTGCGAGCTGTGGCCAGAGGATCTATGACGGCCAGTACCTCCAGGCCCTGAATGCTGACTGGCATGCAGACTGCTTCAGGTGCTGCGAGTGTAGCGTCTCCCTTTCACACCAGTACTACGAGAAGGATGGACAGCTCTTCTGCAAGAAGGACTACTGGGCCCGCTATGGCGAGTCTTGCCACGGGTGCTCCGAGCACATCACCAAAGGGCTGGTCATGGTGGCTGGGGAGCTGAAGTACCACCCTGAGTGTTTCATCTGCCTCGCCTGTGGAAACTTCATTGGCGATGGGGACACCTACACACTGGTGGAGCACTCCAAGCTGTACTGTGGCCAGTGCTACTACCAGACCGTGGTAACTCCAGTCATCGAACAGATCCTACCTGACTCACCCGGCTCCCACCTGCCCCACACAGTCACCCTCGTGTCTATCCCAGCCTCTGCCCATGGCAAACGAGGCCTGTCTGTCTCCATCGACCCCCCTCACGGCCCACCAGGATGTGGCACGGAGCATTCGCACACTGTCCGAGTCCAAGGAGTGGACCCAGGCTGCATGAGCCCAGATGTGAAGAATTCCATCCACGTTGGAGACCGGATCTTGGAAATCAATGGCACGCCCATCCGGAATGTGCCGCTGGACGAGATCGACTTGCTGATCCAGGAGACCAGCCGCCTGCTCCAGCTGACCCTCGAGCACGACCCCCATGACTCACTGGGCCATGGGCCCGTGTCGGATCCCAGCCCCCTGAGCTCCCCGGTGCACACTCCCAGCGGACAGGCAGCCAGCTCTGCCCGGCAGAAACCTGTCTTGAGGAGCTGCAGTATTGACACGTCCCCGGGTACCAGCTCACTAGCCTCTCCAGCCTCCCAGCGCAAGGACCTGGGTCGCTCCGAATCCCTCCGAGTGGTCTGCCGACCACACCGAATCTTCCGGCCATCTGATCTCATCCATGGGGAAGTGCTGGGCAAGGGCTGTTTTGGCCAGGCCATCAAGGTGACACACCGAGAAACAGGCGAGGTGATGGTGATGAAGGAACTTATCCGGTTTGATGAGGAGACCCAGAGGACATTCCTCAAGGAGGTAAAGGTCATGCGCTGCCTGGAGCACCCTAACGTGCTCAAGTTCATCGGAGTGCTCTACAAGGACAAGCGGCTAAACTTCATCACAGAGTACATCAAGGGCGGCACCCTGCGGGGCATCATCAAGAACATGGACAGCCAGTACCCGTGGAGTCAGAGGGTCAGCTTTGCCAAGGACATTGCATCAGGGATGGCCTACCTCCATTCGATGAACATCATCCACCGAGACCTCAACTCCCACAACTGTCTGGTCCGTGAGAATAGGAACGTGGTGGTGGCCGACTTTGGGCTGGCTCGACTCATGATCGATGAAAAGAATCAGTCTGAAGACTTACGCAGCCTTAAGAAGCCGGACCGCAAGAAGCGGTACACAGTGGTGGGCAACCCCTACTGGATGGCGCCAGAGATGATCAATGGTCGTAGTTATGATGAAAAGGTGGACGTGTTTTCCTTTGGAATTGTCCTCTGTGAGATTATCGGGCGTGTGAATGCAGACCCTGACTATCTGCCCCGCACTATGGACTTTGGCCTCAATGTAAGGGGTTTCCTGGACCGCTACTGTCCACCAAACTGTCCCCCAAGTTTCTTCCCCATCACTGTGCGCTGCTGTGACCTGGATCCTGAAAAGAGACCCTCTTTTGTAAAGCTGGAACAATGGCTAGAAACACTTCGCATGCACTTGTCTGGTCACCTGCCACTGGGCCCACAACTGGAACAACTGGAGCGGGGCTTCTGGGAGACCTACCGGCGGGGCGAGAGCTCACTGCCTGCCCACCCCGAGGTCCCTGACTGA
본 발명의 스크리닝 방법에 의해 분석되는 시험 물질은 단일 화합물, 화합물들의 혼합물(예컨대, 천연 추출물 또는 세포 또는 조직 배양물), 항체 또는 펩타이드이다. 시험 물질은 합성 또는 천연 화합물의 라이브러리로부터 얻을 수 있다. 이러한 화합물의 라이브러리를 얻는 방법은 당업계에 공지되어 있다. 합성 화합물 라이브러리는 Maybridge Chemical Co.(UK), Comgenex(USA), Brandon Associates(USA), Microsource(USA) 및 Sigma-Aldrich(USA)에서 상업적으로 구입 가능하며, 천연 화합물의 라이브러리는 Pan Laboratories(USA) 및 MycoSearch(USA)에서 상업적으로 구입 가능하다.
시험 물질은 당업계에 공지된 다양한 조합 라이브러리 방법에 의해 얻을 수 있으며, 예를 들어, 생물학적 라이브러리, 공간 어드레서블 패러럴 고상 또는 액상 라이브러리(spatially addressable parallel solid phase or solution phase libraries), 디컨볼루션이 요구되는 합성 라이브러리 방법, “1-비드 1-화합물” 라이브러리 방법, 그리고 친화성 크로마토그래피 선별을 이용하는 합성 라이브러리 방법에 의해 얻을 수 있다. 분자 라이브러리의 합성 방법은, DeWitt et al., Proc. Natl. Acad. Sci. U.S.A. 90: 6909 (1993); Erb et al. Proc. Natl. Acad. Sci. U.S.A. 91: 11422 (1994); Zuckermann et al., J. Med. Chem. 37: 2678 (1994); Cho et al., Science261: 1303 (1993); Carell et al., Angew. Chem. Int. Ed. Engl. 33: 2059 (1994); Carell et al., Angew. Chem. Int. Ed. Engl. 33, 2061; Gallop et al., J. Med. Chem. 37: 1233 (1994) 등에 개시되어 있다.
본 명세서에서, 용어 “펩타이드”는 펩타이드 결합에 의해 아미노산 잔기들이 서로 결합되어 형성된 선형의 분자를 의미하며, 통상적으로 아미노산 잔기 4-40개를 포함한다.
본 발명의 상기 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIMK1의 상호작용 억제제로서의 펩타이드는 당업계에서 통상적으로 사용하는 고체상(solid-phase) 합성 방법에 의해 제조된다 (Merrifield, R. B., J. Am. Chem. Soc. , 85:2149-2154 (1963), Kaiser, E., Colescot, R. L., Bossinger, C. D., Cook, P. I., Anal. Biochem., 34:595-598 (1970)). 즉, α-아미노 및 측쇄 작용기가 보호화된 아미노산을 레진에 결합시킨 후, α-아미노 보호기를 제거하고 남은 α-아미노 및 측쇄 작용기가 보호화된 아미노산을 원하는 순서로 단계적으로 커플링하여 중간체를 얻는다. 상기 본 발명의 상기 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIMK1의 상호작용 억제제 펩타이드를 제조하기 위한 아미노산 서열은 종래의 방법을 참조하였다(Chen L, Hahn H, Wu G, Chen CH, Liron T, Schechtman D, Cavallaro G, Banci L, Guo Y, Bolli R, Dorn GW, Mochly-Rosen D., Proc. Natl. Acad. Sci., 98, 11114-9 (2001); Phillipson A, Peterman EE, Taormina P Jr, Harvey M, Brue RJ, Atkinson N, Omiyi D, Chukwu U, Young LH., Am. J. Physiol. HeartCirc. Physiol.,289, 898-907 (2005); 및 Wang J, Bright R, Mochly-Rosen D, Giffard RG., Neuropharmacology.,47, 136-145 (2004)).
본 명세서에서, 용어 “천연 추출물”은 천연물의 다양한 기관 또는 부분 (예: 잎, 꽃, 뿌리, 줄기, 가지, 껍질 및 과실 등)으로부터 추출하여 얻은 것을 의미하며, 천연 추출물은 (a) 물, (b) 탄소수 1-4의 무수 또는 함수 저급 알코올 (메탄올, 에탄올, 프로판올, 부탄올, 노말-프로판올, 이소-프로판올 및 노말-부탄올 등), (c) 상기 저급 알코올과 물과의 혼합용매, (d) 아세톤, (e) 에틸 아세테이트, (f) 클로로포름, (g) 1,3-부틸렌글리콜, (h) 헥산 (i) 디에틸에테르를 추출 용매로 하여 얻을 수 있다.
본 발명에서 시험물질로서 항체가 이용될 수도 있다. 상기 항체는 타입 III 에펙터 단백질인 HopQ 또는 LIMK1과 특이적으로 결합하는 항체이다. 또는, 본 발명에서 시험물질로서 이용되는 항체는 이중특이성 항체(bispecific antibody)를 포함한다. 예컨대, 타입 III 에펙터 단백질인 HopQ과 LIMK1에 이중적으로 특이성을 갖는 항체가 이용될 수 있다. 항체는 폴리클로날 또는 모노클로날 항체이며, 바람직하게는 모노클로날 항체이다.
항체는 당업계에서 통상적으로 실시되는 방법들, 예를 들어, 융합 방법(Kohler and Milstein, European JournalofImmunology, 6:511-519 (1976)), 재조합 DNA 방법(미국 특허 제4,816,56호) 또는 파아지 항체 라이브러리 방법(Clackson et al, Nature, 352:624-628 (1991) 및 Marks et al, J. Mol. Biol., 222:58, 1-597 (1991))에 의해 제조될 수 있다. 항체 제조에 대한 일반적인 과정은 Harlow, E. and Lane, D., UsingAntibodies: A LaboratoryManual, Cold Spring Harbor Press, New York, 1999; Zola, H., MonoclonalAntibodies: A ManualofTechniques, CRC Press, Inc., Boca Raton, Florida, 1984; 및 Coligan, CURRENTPROTOCOLSINIMMUNOLOGY, Wiley/Greene, NY, 1991에 상세하게 기재되어 있으며, 상기 문헌들은 본 명세서에 참조로서 삽입된다. 예를 들어, 단일클론 항체를 생산하는 하이브리도마 세포의 제조는 불사멸화 세포주를 항체-생산 림프구와 융합시켜 이루어지며, 이 과정에 필요한 기술은 당업자에게 잘 알려져 있으며 용이하게 실시할 수 있다. 폴리클로날 항체는 항원을 적합한 동물에게 주사하고, 이 동물로부터 항혈청을 수집한 다음, 공지의 친화성(affinity) 기술을 이용하여 항혈청으로부터 항체를 분리하여 얻을 수 있다.
본 발명의 일 구현예에 따르면, 타입 III 에펙터 단백질인 HopQ 또는 LIMK1은 세포 외(invitro) 하나의 용액에 포함되어 있다. 즉, 본 발명의 방법은 인 비트로에서 하나의 반응용액으로 실시할 수 있다. 예를 들어, 정제된 타입 III 에펙터 단백질인 HopQ 및 LIMK1과 시험물질을 포함하는 반응용액을 이용하여 본 발명의 분석을 할 수 있다.
본 발명의 일 구현예에 따르면, 타입 III 에펙터 단백질인 HopQ 또는 LIMK1은 세포 내(in vivo)에 포함되어 있다. 즉, 본 발명의 방법은 세포내에서의 반응을 이용하여 실시할 수 있다. 예를 들어, 타입 III 에펙터 단백질인 HopQ 및 LIMK1을 발현하는 세포에 시험물질을 처리하여 세포 내에서 타입 III 에펙터 단백질인 HopQ와 LIMK1의 상호작용이 억제되는 지 분석한다. 본 발명의 일 구현예에 따르면, 본 발명에서 이용되는 세포는 포유류 대식세포일 수 있다. 본 발명의 일 구현예에 따르면, 본 발명에서 이용되는 세포는 인간을 제외한 포유류 대식세포일 수 있다.
본 발명에서 타입 III 에펙터 단백질인 HopQ의 결합파트너로서 규명된 단백질은 LIMK1이다. 바람직하게는, 본 발명의 방법에서 이용되는 LIMK1은 LIMK1의 N-말단 LIM1 도메인이다.
타입 III 에펙터 단백질인 HopQ, 그의 결합파트너인 LIMK1 및 시험물질을 접촉시킨 다음, 상기 시험물질이 타입 III 에펙터 단백질인 HopQ와 그의 결합파트너 LIMK1 사이의 상호작용을 억제하는지 여부를 분석한다.
이러한 상호작용 분석은, 당업계에 공지된 다양한 방법을 통하여 수행할 수 있다. 본 발명의 일 구현예에 따르면, 단계 (b)는 투-하이브리드 방법, 공동면역침강 방법(co-immunoprecipitation assay), 공동-국소화 분석(co-localization assay), 섬광 근접 측정법(scintillation proximity assay; SPA), UV 또는 화학적 가교 결합 방법, 이분자 상호작용 분석(bimolecular interaction analysis; BIA), 질량 분석법(mass spectrometry; MS), NMR(nuclear magnetic resonance) 또는 형광 편광 분석법(fluorescence polarization assays; FPA)에 의해 수행된다.
본 명세서에서의 용어, “투-하이브리드 방법”은 분할 가능한 DNA-결합 및 활성화 도메인으로 구성된 전사인자의 모듈 특성에 기초한다. 이 경우, 베이트(bait)로서 LIMK1이 이용되고 프레이(prey)로서 타입 III 에펙터 단백질인 HopQ가 이용될 수 있다. 또한, 이와 반대로 컨스트럭션을 만들 수도 있다. 이 방법에 따르면, 타입 III 에펙터 단백질인 HopQ와 LIMK1의 상호작용을 억제하는 물질을 스크리닝 할 수 있다. 투-하이브리드 시스템은 간단하게는, 이 분석 방법은 두 가지 DNA 컨스트럭트를 이용한다. 예컨대, 하나의 컨스트럭트에서, LIMK1-코딩 폴리뉴클레오타이드를 공지의 전사 인자의 DNA 결합 도메인-코딩 폴리뉴클레오타이드에 융합시킨다. 만일, 베이트 및 프레이가 인 비보에서 상호작용하여 복합체를 형성하면, 전사인자의 DNA-결합 및 활성화 도메인이 인접하게 되며, 이는 리포터 유전자(예컨대, LacZ)의 전사를 촉발하게 된다. 시험물질이 타입 III 에펙터 단백질인 HopQ와 LIMK1의 상호작용을 억제한다면, 리포터 유전자의 발현을 방해할 것이며, 결론적으로 HopQ1에 의한 면역 억제에 대한 억제제로 이용될 수 있음을 나타내는 것이다. 상기 투-하이브리드 방법 외에 쓰리-하이브리드 방법을 따라서도 수행할 수 있다(U.S. Pat. No. 5,283,317; Zervos et al., Cell72, 223-232, 1993; Madura et al., J. Biol. Chem. 268, 12046-12054, 1993; Bartel et al., BioTechniques14, 920-924, 1993; Iwabuchi et al., Oncogene8, 1693-1696, 1993; 및 W0 94/10300).
본 명세서에서의 용어, “공동면역침강 방법(co-immunoprecipitation assay, Co-IP)”(Harlow and Lane, Eds., Antibodies: A LaboratoryManual, Cold Spring Harbor Laboratory (1988))에 따르면, 배양세포가 생산하는 항원성 물질을 측정할 때, 미량이라 직접 측정이 불가능하면, 우선 배양액에 3H-라이신 등을 첨가하여 표적물질을 표지하여 배양 상층액을 취한다. 이 상층액에 특이항체와 항원항체복합물이 형성될 수 있는 동일한 농도의 비표지표적물질을 첨가하여 침강반응을 일으키면, 배양액 내의 미량 표지된 표적물질도 침강물에 함께 공동침강반응이 일어나기 때문에 침강물의 방사활성으로 표적물질을 측정할 수 있다. 단백질의 큰 복합체의 일원으로 알려진 공지의 단백질을 표적으로 하는 항체를 선별하고, 상기 항체를 가지고 알려진 복합체를 표적으로 하여 총 단백질 콤플렉스를 용액에 침전시켜 상기 복합체의 알려지지 않은 단백질을 동정한다. 이는 알려지지 않은 물질이 미량인 경우에 직접 측정이 불가능하므로 배양액에 표적물질로 표지하여 배양상층액을 취하고, 상기 상층액에 특이 항체와 단백질복합체가 형성될 수 있는 동일 농도의 비표지표적물질을 첨가하여 침강반응을 일으키도록 하면, 미량 표지된 표적물도 같이 공동 침강 반응이 일어나게 된다. 용액 밖으로 단백질복합체가 빠져 나온다는 개념 때문에 풀다운(pull-down)이라고 언급된다. 공동면역 침강법은 단백질-단백질 상호작용을 분석하기 위해 널리 이용된다.
본 명세서에서의 용어, 공동-국소화 분석(co-localization assay)은 형광염색법을 이용하여, 형광 현미경에서 두 개 그 이상의 다른 각각의 차별화된 방출 파장을 가지는 형광 라벨 사이에 공간적 오버랩을 관찰하여, 세포의 같은 공간에 위치하거나 다른 세포와 매우 근접한 위치에 있는 다른 표적을 관찰하는데 이용되는 분석법이다. 다른 2 가지의 형광으로 염색한 단백질들을 컨포컬 현미경으로 스캐닝하고, 특정 위치에 나타난 색깔을 측정하여 2 가지 단백질의 위치가 한 곳에 위치하고 있음을 규명할 수 있으며, 이 단백질들이 상호작용을 하고 있음을, 즉 기능적으로도 결합하고 있다는 점도 유추할 수 있는 장점을 가진다(Manders et al, Journal of Microscopy 169:375-382 (1993); Pawley JB, HandbookofBiologicalConfocalMicroscopy, (2006)).
본 명세서에서의 용어, 섬광 근접 측정법(scintillation proximity assay; SPA)은 에너지를 가지는 전자에 의해 형광작용을 일으키는 폴리비닐-톨루엔 플라스틱 신딜레이터 비드(scintillator beads)에 항체를 부착하고, 수용액 상에서 쉽게 에너지를 잃거나 소멸되는 낮은 에너지의 전자를 방출하는 방사성 핵종을 비드(beads)에 부착된 항체에 선택적으로 결합하는 항원에 표지하여 항원-항체 결합의 정도를 발생되는 형광 측정을 통해 관찰하는 방식을 말한다(Alouani, Methods Mol. Biol. 138:135-41 (2000)). 이 방식을 이용하면 일반적으로 방사 면역측정법이 가지는 단점인 결합분획과 유리분획의 분리과정이 필요하여 보편적인 시스템의 구축이 어려운 점을 극복가능하고, 민감도가 높고 분리 과정이 필요 없다는 특징을 가진다. 방사성 핵종이 표지된 항원과 비드상에 부착된 항체간의 결합이 이루어지면, 항원에 표지된 방사성 핵종이 방출하는 낮은 에너지의 전자가 비드에 도달하여 에너지를 전달하고, 에너지를 받은 비드는 형광을 방출하게 된다. 이 방출된 형광은 액체섬광계수기로 항체-항원의 결합 양에 따른 비례를 보이며 증가되는 것을 측정할 수 있다.
본 명세서에서의 용어, 화학적 가교 결합 방법(chemical cross-linking)은 단백질이나 핵산 등의 생체 고분자에 대하여 가교 시약을 이용하여 화학적인 공유결합을 형성시켜, 단백질의 소유닛 구조, 단백질-핵산의 상호작용, 단백질-단백질 상호작용의 해석 등 분자 간 반응에 의해 기능을 발휘되는 특성을 분석하는데 이용되는 방식을 말한다(Fancy, Curr. Opin. Chem. Biol. 4:28-33 (2000)). 또한 단백질 분자의 고정화, 항체의 효소 표식과 같은 공유결합에 의한 단백질 접합체 구조의 안정화에 이용된다. 가교 시약은 일반적으로 동일 분자내 아민기(-NH2), 티올기(-SH) 및 카복시산기(-COOH) 등의 작용기에 특이적을 반응하거나, 광조사에 의한 활성화가 일어날 수 있는 작용기를 양단에 갖는 2가성 가교시약을 이용한다. 단백질 간의 상호 작용을 관찰하기에는 너무 그 결합력이 매우 약하거나 일시적이지만, 화학적 가교결합 방식을 이용하면 단백질 간의 상호결합을 캡처시켜 분석하는데 용이하다는 장점을 가진다.
본 명세서에서의 용어, 이분자 상호작용 분석(bimolecular interaction analysis; BIA)은 실시간으로 특이적 상호작용을 분석하는 기술로서, 상호작용물(interactants)의 레이블링 없이 실시할 수 있는 방식을 말한다(예컨대, BIAcore™)(Sjolander & Urbaniczky, Anal. Chem. 63:2338-2345(1991), and Szabo et al., Curr. Opin. Struct. Biol. 5:699-705(1995)). 표면 플라즈몬 공명(SPR)에서의 변화는 분자들 사이의 실시간 반응에 대한 지시자(indicator)로 이용될 수 있다.
본 명세서에서의 용어, 형광 편광 분석법(fluorescence polarization assays; FPA)은 C 반응성 단백질(C reactive protein, CRP)에 형광색소인 플루오레세인을 결합시킨 트레서와 CRP에 특이적으로 결합하는 항체를 혼합한 용액에, 측정 대상물로서의 CRP를 포함하는 체액(특히, 혈액)을 첨가하는 방법으로, 혼합 용액 중의 항체에 대한 트레서와 CRP의 경합에 근거하여, CRP를 측정하는 방식을 말한다(Degterev, et al., NatureCellBiology 3:173-182 (2001)).
질량 분석법에 의한 방식(McLafferty et al., Science 284:1289-1290 (1999) and Degterev, et al., Nature Cell Biology 3:173-182 (2001)), 또는 핵 자기 공명법에 의한 방식(Shuker etal., Science 274:1531-1534 (1996), Hajduk et al., J. Med. Chem. 42:2315-2317 (1999), and Chen and Shapiro, Anal. Chem. 71:669A-675A (1999))을 이용하여 미지의 시료의 구조를 분석하는데 이용된다.
본 발명에서 상기 타입 III 에펙터 단백질인 HopQ1과 LIMK1과의 상호작용은 상기 타입 III 에펙터 단백질인 HopQ1과 LIMK1의 N-말단 LIM1 도메인을 통한 상호작용일 수 있다.
본 발명에서 상기 면역 억제는 분리된 포유동물의 대식세포에서의 식균작용을 억제할 수 있다.
본 발명에서 상기 면역 억제는 인간을 제외한 포유동물의 대식세포에서의 식균작용을 억제할 수 있다.
본 발명에서 상기 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 억제제는 세포내 독소 유발 쇼크 조절용 물질일 수 있다.
본 발명에서 상기 세포내 독소 유발은 패혈증에 의한 것일 수 있다.
본 발명은 타입 III 에펙터 단백질인 HopQ1; 및 그의 결합파트너로서의 LIM 도메인 키나아제 1(LIMK1)을 포함하는 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝용 조성물을 제공한다.
또한 본 발명은 또한 타입 III 에펙터인 HopQ1을 포함하는 대식세포의 식균 작용 억제용 조성물을 제공한다. 본 발명에 따른 타입 III 에펙터인 HopQ1을 포함하는 대식세포의 식균 작용 억제용 조성물은 동물 세포에서 LIMK1의 조절을 통해 대식세포의 식균 작용을 억제하는 작용 효과를 가진다.
본 발명은 타입 III 에펙터 HopQ1 및 LIM 도메인 키나아제의 상호작용을 이용한 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물에 관한 것으로, 상기 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIMK1의 상호작용 억제제는 HopQ1에 의한 식균작용의 억제를 조절함으로써 세포내 독소 유발 쇼크 조절용 물질로 이용될 수 있다.
도 1의 A의 그래프는 유세포 분석결과를 정리한 그래프이고, Pta는 GFP-발현 P. syringae pv. tabaci, Pto는 P. syringae pv. tomato 및 E. coli는 E. coli DH5α의 표시하고, 도 1의 B의 좌측 그래프는 유세포 분석결과를 정리한 그래프이고 우측은 유세포 분석결과를 보여주는 도이며, 도 1의 C의 이미지는 지시된 시간(1시간(h), 2시간, 4시간) 동안 각각의 박테리아 (녹색)로 감염된 마우스 복막 대식세포에 있어서의 대식작용 패턴을 보여주고, 도 1의 D는 겐타마이신(gentamiin) 보호 어세이 결과를 보여주는 도로서 각각 P. syringae pv. tabaci(Pta), P. syringae pv. tomato(Pto), 또는 E. coli DH5α(E. coli)에 대한 결과를 나타내며, 도 1의 E는 마우스에서 P. syringae pv. tabaci, P. syringae pv. tomato, 또는 E. coli DH5α를 감염시킬 경우의 생존율을 보여주는 그래프이다.
도 2는 Pto, Pta 또는 E. coli의 접종 후 대식세포의 사이토카인을 보여주는 도이며, 도 2에서 A, B 및 C는 각각 바이러스 Pto, Pta 또는 E. coli의 접종 후 TNF-α, B는 IL-1β, C는 IL-6 발현량을 보여주는 도이고, D는 Pto, Pta 또는 E. coli의 접종 후 MAPK 신호 및 NF-κB 활성을 보여주는 단백질 흡입법(western blotting)의 결과를 보여주는 도이다.
도 3의 A의 좌측 그래프는 유세포 분석결과를 정리한 그래프이고 우측은 유세포 분석결과를 보여주는 도이고, 도 3의 B의 이미지는 1 및 2시간 동안 Pto DC3000 또는 ΔhrpL (녹색)으로 감염된 복막 대식세포에 있어서의 식균작용 억제를 보여주는 도이고, 도 3의 C는 겐타마이신(gentamiin) 보호 어세이 결과를 보여주는 도로서 각각 Pto DC3000(Pto) 또는 ΔhrpL에 대한 결과를 나타내며, 도 3의 D는 마우스에서 Pto DC3000(Pto) 또는 ΔhrpL 돌연변이체를 감염시킬 경우의 생존율을 보여주는 그래프이다.
도 4의 A의 도는 Pto DC3000(Pto) 또는 ΔhrpL 돌연변이체를 감염시킨 후의 박테리아의 감염정도를 보여주는 유세포 분석 결과를 정리한 도이고, 도 4의 B의 도는 Pto 및 Pta에 대하여 조기 엔도솜 마커(early endosome marker), Eea1, 플렉스트린(pleckstrin) 및 Rab 5 및 후기 엔도솜(late endosome), Rab7 및 Lamp1의 마커를 측정한 단백질 흡입법(western blotting) 결과를 보여주는 도이다.
도 5는 Pto 또는 ΔhrpL 돌연변이체의 접종 후 대식세포의 사이토카인을 보여주는 도이며, 도 2에서 A, B 및 C는 각각 바이러스 Pto 또는 ΔhrpL 돌연변이체의 접종 후 TNF-α, B는 IL-1β, C는 IL-6 발현량을 보여주는 도이고, D는 Pto 또는 ΔhrpL 돌연변이체의 접종 후 MAPK 신호 및 NF-κB 활성을 보여주는 단백질 흡입법(western blotting)의 결과를 보여주는 도이다.
도 6은 겐타마이신 (gentamiin) 보호 어세이 결과를 보여주는 도이다.
도 7의 A는 식물 HopQ1은 포유류 LIMK1과 상호작용함을 확인하기 위한 단백질 흡입법(western blotting)의 결과를 보여주는 도이고, 도 7의 B는 293T 세포에서의 코필린1(cofilin1) 및 LIMK1의 인산화 및 발현을 보여주는 단백질 흡입법(western blotting)의 결과의 도이고, 도 7의 C는 HopQ1은 LIMK1의 N-말단 LIM1 도메인을 통해 LIMK1과 상호작용함을 보여주는 GST 풀-다운 어세이(GST pull-down assay)의 결과의 도이고, 7의 D의 왼쪽 이미지는 3T3-L1 세포에 있어서 LIMK1 및 HopQ1 모두의 공동-국소화를 보여주는 도이고, 도 7의 D 오른쪽 도는 HopQ1-형질감염된 3T3-L1 세포에 있어서의 HopQ1 수준을 보여주는 도이고 도 7의 E는 HopQ1-발현 P.fluorescens에 의한 복막 대식세포의 감염 동안의 LIMK1 및 cofilin1의 인산화 여부를 보여주는 단백질 흡입법(western blotting)의 결과의 도이다.
도 8의 A는 Pto DC3000 또는 Pto ΔhprL-접종된 마우스로부터의 복막강, 혈액, 비장 및 간의 박테리아의 수를 보여주는 도이고, 도 8의 B는 Pto 또는 ΔhprL를 RAW 264.7 세포주에 감염시킨 후의 식세포 컵 형성 여부를 분석한 그래프이고, 도 8의 C는 GFP-발현 E.cloacae 또는 DsRed 및 HopQ-발현 E.cloacae의 유세포 분석 결과를 보여주는 도이고, 도 8의 D의 왼쪽 도는 HopQ1를 함유하는 플라스미드를 가지거나 가지지 않는 E.cloacae가 10-12주령의 마우스로부터의 복막강, 혈액, 비장 및 간의 박테리아 콜로니 형성을 보여주는 도이고 오른쪽 도는 HopQ1를 함유하는 플라스미드를 가지거나 가지지 않는 E.cloacae가 10-12주령의 마우스로부터의 복막강, 혈액, 비장 및 간의 박테리아의 수를 보여주는 도이다.
도 9는 Pto 또는 ΔhprL를 RAW 264.7 세포주에 감염시킨 후의 식세포 컵 형성 여부를 보여주는 현미경 이미지이다.
도 10은 GFP-발현 E.cloacae 또는 DsRed 및 HopQ-발현 E.cloacae의 유세포 분석 결과를 보여주는 도이다.
도 11은 GFP-발현 E.cloacae 또는 DsRed 및 HopQ-발현 E.cloacae의 유세포 분석 결과를 보여주는 현미경 사진이다.
도 12는 P. syringae pv. tomato 의 대식세포에 의한 phagocytosis 억제 결과를 보여주는 현미경 이미지이다.
이하, 하기 실시예에 의해 본 발명을 보다 상세하게 설명한다. 그러나, 하기 실시예는 본 발명의 범위를 제한하는 것은 아니며, 이는 본 발명의 이해를 돕기 위한 것으로 해석되어야 할 것이다.
실시예 1. 식물 병원균 P. syringae tomato DC3000에 의한 포유류 면역 시스템 조절 여부 확인
도 1의 A 관련 실험
본 실시예에서 본 발명자들은 식물 병원균이 대식세포에 의한 포유류 면역 시스템을 조절하는지 여부를 결정하도록 P. syringae tomato DC3000 (Pto DC3000)의 감염 중에 식균작용 수준을 평가하였다.
복강 대식세포와 세포주 배양 방법
마우스의 복강 대식세포를 얻기 위하여 C57BL/6 마우스의 복강에 3% 티오글리콜레이트(thioglycollate)를 주입하고 4일 후에 마우스의 복강에 RPMI media를 10ml을 넣어 복강 대식세포을 얻어 낸 후에 세포배양접시에 2시간 동안 37℃, 5% CO2 배양기에서 배양 후에 배양접시에 붙지 않은 세포들을 제거하고 10% FBS가 들어간 RPMI 배지를 넣어서 37℃, 5% CO2 배양기 배양하여 준비하였다.
GFP-발현 플라스미드가 도입된 P. syringae pv. tabaci, P. syringae pv. tomato, 또는 E. coli DH5α의 준비
GFP-발현 플라스미드가 도입된 박테리아를 준비하기 위하여 P. syringae pv. tabaci와 P. syringae pv. tomato 균주를 King’s B 배지 200ml에 30℃에서 배양을 하고 E. coli DH5α는 LB 배지 200ml에 37℃에서 배양을 하였다. 600nm의 흡광도에서 흡광도가 0.4에서 0.6 사이까지만 균주를 배양 한 다음 4℃에서 3,000rpm으로 15분 동안 원심 분리하여 박테리아의 배지를 제거하고 차가운 300mM 수크로오스 (Sucrose) 200ml을 첨가하여 침전된 균주를 혼합한 후 다시 원심 분리를 진행하여 여분의 박테리아 배지를 제거하였다. 이와 같은 방법을 반복적으로 네 차례 진행 후 차가운 300mM 수크로오스 (Sucrose)를 400ul를 넣어서 박테리아를 혼합하였다. 이 후 pDSK-GFPuv 벡터를 1ul (100 ng/μl)를 첨가한 후에 0.2cm 큐벳(cuvette)에 넣은 후 2.5 kV, 25 F, 200 Ω의 조건에서 전기천공법(electroporation)으로 GFP-발현 플라스미드가 각 균주에 도입 되도록 하였다. 전기천공법을 실시 한 후 P. syringae pv. tabaci와 P. syringae pv. tomato 균주(P. syringae pv. tabaci (NCPPB 2504)와 P. syringae pv. tomato DC3000 (NCPPB 4369)는 NCPPB(National Collection of Plant Pathogenic Bacteria, York, UK)으로부터 수득하였다.)는 50ug/ml의 카나마이신이(kanamycin) 포함 된 King’s B 배지 1ml을 첨가하여 30℃에서 2시간 동안 배양을 하고 동일한 방법으로 E. coli DH5α균주(E. coli DH5α(KCTC 2466)는 KCTC(Korean Collection for Type Cultures, Daejeon, Korea)으로부터 수득하였다) 또한 50ug/ml의 카나마이신이(kanamycin) 포함 된 LB 배지 1ml을 첨가하여 37℃에서 배양을 하였다.
식균작용 확인
마우스의 복강에서 얻어낸 복막 대식세포에 전기천공법 (elecroporation)으로 GFP-발현 플라스미드가 도입된 P. syringae pv. tabaci, P. syringae pv. tomato, 또는 E. coli DH5α (multiplelicity of infection; MOI, 20:1)로 감염시키기 위하여 복막 대식세포 배양 배지(10% FBS가 들어간 RPMI 배지)에 박테리아를 혼합한 후에 도 1의 A에 지시된 시간 동안 감염 시킨 후 인산완충식염수 (phosphate buffered saline)로 세척하고 긁어냈다. 좀 더 구체적으로 복강 대식세포를 1 x 106 세포 기준으로 12-well 배양 접시에 배양한 후에 GFP를 발현하는 P. syringae tabaci, P. syringae tomato 및 E. coli DH5α를 2.0 × 107 CFU수로 시간 별로 세포에 감염시켰다. 감염 후 배양 배지를 제거한 후에 차가운 인산완충생리식염수 (phosphate bufffered saline, PBS)를 1ml 씩 세 번 세척하여 세포 주변에 남아 있는 박테리아를 제거하였다. 유세포측정 완충용액 (1% FBS가 포함된 인산완충생리식염수)을 400ul 첨가 후에 스크레이퍼(scraper)로 세포를 긁어냈다. 감염된 복막 대식세포에 4% 포름알데하이드 (formaldehyde)로 고정하여 남아있는 박테리아는 유세포 분석기에 통해 복막 대식세포 안에서 GFP 형광을 나타내는 정도를 측정한 후에 분석하였다. 도 1의 A의 그래프는 유세포 분석결과를 정리한 그래프이고, Pta는 GFP-발현 P. syringae pv. tabaci, Pto는 P. syringae pv. tomato 및 E. coli는 E. coli DH5α의 표시한다. 도 1의 A의 결과를 통해, Pto DC3000에 의해 접종될 때 대식세포에 있어서 식균작용 수준이 극적으로 감소됨을 확인할 수 있었다.
도 1의 B 관련 실험
식물 병원균이 대식세포에 의한 식포 성숙 (phagosome maturation)에 영향을 미치는 지 여부를 평가하도록, 도 1의 A와 동일하게 준비된 GFP-발현 P. syringae pv. tabaci(Pta), P. syringae pv. tomato(Pto), 또는 E. coli DH5α(E. coli)를 대식세포 배양 배지(10% FBS가 들어간 RPMI 배지)에 박테리아를 혼합한 후에 마우스 복강에서 분리한 대식세포에 처리하여 1시간 동안 전-감염(pre-infected)시킨 후, 인산완충식염수 (phosphate buffered saline)로 세척하여 감염되지 않은 박테리아를 제거하였다. 복강 대식세포 안에 감염되어 제거되는 박테리아를 확인하기 위하여, 4% 포름알데하이드 (formaldehyde)로 고정하여 남아있는 박테리아의 GFP형광을 유세포 분석법을 이용하여 박테리아가 제거된 정도를 지시된 시간에 따라 측정하여 분석하였다. 데이터는 각 시점에 대한 세 개의 웰로부터 계산된 평균±표준편차이다(P. syringae pv. tabaci에 비교한 *P<0.05, **P<0.01). 도 1의 B의 좌측 그래프는 유세포 분석결과를 정리한 그래프이고 우측은 유세포 분석결과를 보여주는 도이다. 도 1의 B의 결과를 통해, 마우스 복막 대식세포에서 Pto에 대한 식균작용 수준이 극적으로 감소되었음을 확인할 수 있었다.
도 1의 C 관련 실험
복막 대식세포에서의 식균작용 수준은 면역형광을 수행함으로써 결정되었다. 도 1의 A와 동일하게 준비된 GFP-발현 P. syringae pv. tabaci, P. syringae pv. tomato, 또는 E. coli DH5α-처리된 대식세포를 4% 포름알데하이드 (formaldehyde)로 고정하였고, 세포막 투과성(permeability)을 가지는 핵 염색 시약인 DAPI를 처리하여 세포 핵을 염색한 후에, 공초점 레이저 현미경 (Carl Zeiss, LSM510)을 이용하여 복막 대식세포 안에서 GFP 형광을 나타내는 박테리아를 분석하였다. 구체적으로, 24-well 배양접시에 둥근 커버글라스를 집어 넣은 후에 세포를 2.0 × 105 세포 수로 배양한 후 GFP를 발현하는 P. syringae tabaci, P. syringae tomato 그리고 E. coli DH5α를 2.0 × 106 CFU 수로 시간 별로 감염시켰다. 감염 시킨 후 배양 배지를 제거한 후에 차가운 인산완충생리식염수 (phosphate bufffered saline, PBS)를 1ml씩 세 번 세척하여 세포 주변에 남아 있는 박테리아를 제거하였다. 다음으로 4% 파라포름알데하이드 (paraformaldehyde) 가 포함된 PBS를 첨가하여 실온에서 20분 동안 고정을 시킨 후에 DAPI 염료를 5분 동안 첨가하여 핵을 염색 후에 차가운 인산완충생리식염수 (phosphate bufffered saline, PBS)로 세 번 세척하여 남아있는 DAPI를 제거한 하여 면역 염색 샘플을 준비하였다. 준비된 면역염색 샘플은 공초점형광현미경인 LSM510 confocal microscope (Carl Zeiss)을 이용하여 형광 이미지를 분석하였다.
도 1의 C의 이미지는 지시된 시간(1시간(h), 2시간, 4시간) 동안 각각의 박테리아 (녹색)로 감염된 마우스 복막 대식세포에 있어서의 대식작용 패턴을 보여준다. 도 1의 C에서 기준자는 20㎛이다. 도 1의 C의 결과를 통해, 마우스 복막 대식세포에서 Pto에 대한 식균작용 수준이 극적으로 감소되었음을 확인할 수 있었다.
도 1의 D 관련 실험
도 1의 A와 동일하게 준비된 C57BL/6 마우스로의 복강으로부터 분리한 복막 대식세포에 P. syringae pv. tabaci, P. syringae pv. tomato, 또는 E. coli DH5α를 감염시키기 복막 대식세포에 50배에 해당하는 수의 박테리아를 대식세포 배지(10% FBS가 들어간 RPMI 배지)에 혼합하여 1시간 동안 처리를 해준다. 내재화된 박테리아 수준은 겐타마이신(gentamiin) 보호 어세이에 의해 측정되었다. 겐타마이신 (gentamiin) 보호 어세이는 복막 대식세포에 박테리아를 1시간 동안 감염(구체적으로 복막 대식세포를 1 x 106 세포 기준으로 12-well 배양 접시에 배양한 후에 박테리아를 5.0 × 107 CFU수로 한 시간 동안 세포에 감염)시킨 후에 주변에 감염되지 않은 박테리아를 세척을 한 후에 복막 대식세포 주변에 남아있는 박테리아를 완벽히 제거하기 위하여 겐타마이신(gentamiin)을 100ug/ml의 농도로 1시간 동안 처리한 후 2% 트리톤 엑스-100(Triton X-100)이 포함된 인산완충식염수 (phosphate buffered saline)로 복막 대식세포 안에 남아있는 박테리아를 용출하여 Agar 플레이트에 도말하여 30℃에서 박테리아를 24시간 동안 배양 후 박테리아의 복제수를 확인 하였다. 박테리아 복제는 집락형성단위(colony-forming unit; CFU)를 결정함으로써 측정되었다. 데이터는 각 시점에 대한 세 개의 웰로부터 계산된 평균±표준편차이다(P. syringae pv. tabaci에 비교한 **P<0.01, ***P<0.001). 도 1의 D의 결과를 통해, 마우스 복막 대식세포에서 Pto에 대한 식균작용 수준이 극적으로 감소되었음을 확인할 수 있었다.
도 1의 E 관련 실험
본 발명자들은 식물병원균이 포유동물의 생체내에서의(in vivo) 감염에 대한 사망률 패턴에 영향을 미칠 것인지 여부를 결정하고자 실험을 수행하였다. 마우스(n=10) 복강내로 박테리아 수가 108 CFU/ml가 되도록 인산완충식염수 (phosphate buffered saline)로 녹여 0.2ml을 마우스 복강내로 주입하여 P. syringae pv. tabaci, P. syringae pv. tomato, 또는 E. coli DH5α를 감염시켰다. 생존율은 매 2시간 평가되었다. 좀 더 구체적으로 10주에서 12주령의 C57BL/6 마우스에 P. syringae DC3000와 P.syringae DC3000 ΔHrpL를 복강으로 1.0 x 108 CFU로 감염 시킨 뒤 박테리아에 의한 마우스의 치사율을 확인하기 위하여 P. syringae pv. tabaci, P. syringae pv. tomato, 또는 E. coli DH5α를 마우스 복강으로 1.0 x 108 CFU로 감염 시킨 후에 매 2시간 마다 마우스의 죽는 정도를 체크하여 치사율을 결정하였다.
도 1의 E의 결과를 통해, Pto 감염에 의해 야기된 마우스의 생존에 대한 상당한 감소는 Pto로부터의 일부 발병력 인자(virulence factor)가 시험관내(in vitro) 식균작용 예방 뿐만 아니라 마우스의 생존을 조절하는데 중요한 역할을 하는 것을 암시한다는 것을 확인하였다.
실시예 2. 숙주 인자가 운동성(motility)에 기여하는지 여부를 결정
숙주 인자가 운동성(motility)에 기여하는지 여부를 결정하도록, 본 발명자들은 Pto, Pta 또는 E. coli의 접종 후 대식세포의 사이토카인을 확인하기 위하여 감염 된 대식세포의 배지를 수집하여 13,000rpm에서 원심분리하여 상층액을 수집한 후에 효소결합면역흡착검사(enzyme-linked immunosorbent assay, ELISA)방법을 이용하였다. 세포 배양 배지와 마우스의 혈액 그리고 조직에서 사이토카인의 양을 측정하기 위하여 DuoSet antibody pairs (R&D Systems) 방법을 이용하여 TNF-α, IL-1β 그리고 IL-6를 확인하였다. 우선 96웰 플레이트에 1차 capture 항체를 12시간 동안 실온에서 반응시킨 후에 비특이적결합을 방지하기 위해 1% BSA가 포함된 인산완충생리식염수 (phosphate bufffered saline, PBS)를 첨가하여 실온에서 1시간 동안 반응을 진행하였다. 0.1% 트윈20(Tween20)이 포함된 인산완충생리식염수 (phosphate bufffered saline, PBS)으로 세 번 세척 후에 측정하고자 하는 샘플을 실온에서 2시간 동안 반을 시켰다. 샘플 반응이 끝난 후 0.1% 트윈20(Tween20)이 포함된 PBS로 세 번 세척 후 2차 Detection항체를 첨가하여 2시간 동안 실온에서 반응을 시킨 후 0.1% 트윈20(Tween20)이 포함된 인산완충생리식염수 (phosphate bufffered saline, PBS)으로 세 번 세척하였다. 2차 항체 반응까지 끝낸 후 Streptavidin-HRP 용액을 넣어 실온에서 20분 동안 반응 후 앞선 방법과 동일하게 세 번 세척 후에 TMB 기질 시약 (BD Biosciences)을 첨가한 후에 microtiter plate reader (Emax; Molecular Devices) 장비에서 450nm의 파장으로 흡광도를 측정하여 사이토카인의 양을 분석하였다. MAPK 신호 및 NF-κB 활성의 실험은 감염된 대식 세포에 세포용해버퍼 (RIPA lysis buffer)를 첨가하여 대식 세포내 단백질을 수확한 후에 단백질 흡입법(western blotting)을 이용하여 지시된 각각의 단백질의 항체(Rabbit IgG 항P65항체, Rabbit IgG 항pP65항체, Rabbit IgG 항JNK항체, Rabbit IgG 항pJNK항체, Rabbit IgG 항P38항체, Rabbit IgG항pP38항체, Rabbit IgG 항ERK항체 그리고 Rabbit IgG 항pERK항체, Cell Signaling Technology에서 구매)를 붙여 확인을 하였다. 그리고 그 결과를 도 2에 나타내었다. 도 2에서 나타낸 바와 같이, 사이토카인의 농도, MAPK 신호 및 NF-κB 활성은 대식세포의 각각의 군에서 유사하였다. 도 2의 결과를 통해, 이러한 현상이 대식세포-매개된 식균작용을 억제하는 박테리아 스텔스 기전(stealth mechanism)으로 예상됨을 확인할 수 있었다.
실시예 3. Pto 에 대한 대식세포의 식균작용을 감소시키거나 방해시키는 특정 에펙터의 역할 확인
Pto는 식물세포로 발병력 에펙터(virulence effector)를 분비하는 타입 III 분비 시스템을 이용한다. Pto에 대한 대식세포의 식균작용을 감소시키거나 방해시키는 특정 에펙터의 역할을 시험하기 위하여, 본 발명자는 에펙터의 분비를 없애는 것을 야기하는 타입 III 분비 시스템의 시그마 인자를 결여하는 야생형 Pto DC3000의 ΔhrpL 돌연변이체와 비교한 야생형 Pto DC3000을 분석하였다.
도 3의 A 관련 실험
마우스 복강에서 얻어낸 복막 대식세포를 지시된 시간(30분, 1시간 및 2시간)동안 GFP-발현 Pto DC3000 또는 ΔhrpL (MOI, 20:1)를 대식세포 배지(10% FBS가 들어간 RPMI 배지)에 혼합하여 감염시키고, 인산완충식염수 (phosphate buffered saline)로 세척하고 긁어냈다. 복강 대식세포 안에 감염되어 제거되는 박테리아를 확인하기 위하여, 4% 포름알데하이드 (formaldehyde)로 고정하여 남아있는 박테리아의 GFP 형광을 도 1의 A와 같은 유세포 분석법을 이용하여 박테리아가 제거된 정도를 지시된 시간에 따라 측정하여 분석하였다. 세포는 고정되고 남아있는 박테리아를 유세포 분석에 의해 분석했다. 도 3의 A의 좌측 그래프는 유세포 분석결과를 정리한 그래프이고 우측은 유세포 분석결과를 보여주는 도이다. 데이터는 각 시점에 대한 세 개의 웰로부터 계산된 평균±표준편차이다(**P<0.01). 도 3A의 결과를 통해, 식균작용 수준은 ΔhrpL에 의해 감염된 마우스 복막 대식세포에서 식균작용 수준이 극적으로 증가함을 확인할 수 있었다.
도 3의 B 관련 실험
마우스로부터의 복막 대식세포에서의 식균작용 수준은 식물 박테리아가 처리된 복막 대식세포에 4% 포름알데하이드 (formaldehyde)로 고정하였고, 0.2% 트리톤 엑스-100 (Triton X-100)이 포함된 인산완충식염수 (phosphate buffered saline)으로 세포막 투과(permeabilization)을 유도한 후에 액틴(actin)에 특이적인 항체(붉은색 염료 Alexa Fluor 546(Alexa 546)로 컨주게이트된)를 염색한 후 세포핵을 염색하기 위하여 핵 염색 시약인 DAPI를 처리하여 세포 핵을 염색하여 공초점 레이저 현미경 (Carl Zeiss, LSM510)를 이용하여 복막 대식 세포안에서 GFP 형광을 가지는 박테리아를 측정하고 분석하였다. 도 3의 B의 이미지는 1 및 2시간 동안 Pto DC3000 또는 ΔhrpL (녹색)으로 감염된 복막 대식세포에 있어서의 식균작용 억제를 보여준다. 도 3의 B에서 기준자는 1㎛이다. 도 3B의 결과를 통해, 식균작용 수준은 ΔhrpL에 의해 감염된 마우스 복막 대식세포에서 식균작용 수준이 극적으로 증가함을 확인할 수 있었다.
도 3의 C 관련 실험
마우스 복막 대식세포는 Pto DC3000 또는 ΔhrpL로 감염되었다. 박테리아 복제는 도 1의 D의 겐타마이신(gentamiin) 보호 어세이와 동일한 방법을 이용하여 집락형성단위(CFU)를 결정함으로써 측정되었다. 데이터는 각 시점에 대한 세 개의 웰로부터 계산된 평균±표준편차이다(**P<0.01). 도 3C의 결과를 통해, 내재화된 박테리아의 숫자는 ΔhrpL로 감염된 대식세포에서 훨씨 더 큼을 확인할 수 있었다.
도 3의 D 관련 실험
Pto DC3000 또는 ΔhrpL (108 CFU의 살아있는 박테리아)는 인산완충식염수 (phosphate buffered saline)로 녹여 0.2ml을 마우스 복강내로 주입하여 마우스(n=10)에 감염되었다. 생존율은 매 2시간 평가되었다. 도 3의 D의 결과를 통해, Pto DC3000 또는 ΔhrpL 돌연변이체에 의한 마우스의 사망률은 Pto DC3000 감염된 대다수의 마우스가 죽어 사망률이 매우 높은 반면, ΔhrpL 접종된 마우스의 약 절반이 생존하여 상대적으로 사망률이 낮은 것을 확인할 수 있었다.
도 4의 A 관련 실험
마우스 대식세포인 RAW264.7에 감염되는 박테리아를 확인하기 위하여, RAW264.7 세포에 지시된 시간별로 박테리아를 처리한 후, 4% 포름알데하이드 (formaldehyde)로 고정하여 남아있는 박테리아의 GFP 형광을 1의 A와 같은 유세포 분석법을 이용하여 박테리아가 감염된 정도를 측정하여 분석하였다.
도 4의 A의 그래프는 유세포 분석 결과를 정리한 그래프로, 도 4의 A의 결과를 통해, 식균작용에 대하여 관찰된 결과가 감염 후 RAW264.7 세포에 있어서 식균작용 수준을 측정했을 때 Pto DC3000(Pto)에 비해 ΔhrpL에서 현저하게 감소함을 확인할 수 있었다.
도 4의 B 관련 실험
본 발명자들 대식세포의 식포 성숙 진행이 식물 병원균 Pto에 의해 조절되는지 여부를 분명히 밝히도록 Pto 및 Pta에 대하여 조기 엔도솜 마커(early endosome marker), Eea1, 플렉스트린(pleckstrin) 및 Rab 5 및 후기 엔도솜(late endosome), Rab7 및 Lamp1의 마커를 측정하기 위하여, 감염된 대식 세포에 세포용해버퍼 (RIPA lysis buffer)를 첨가하여 대식 세포내 단백질을 수확한 후에 단백질 흡입법(western blotting)을 이용하여 지시된 각각의 단백질의 항체(Rabbit IgG 항Eea1항체 , Rabbit IgG항Pleckstrin항체, Rabbit IgG 항Rab5 항체, Rabbit IgG 항Rab7항체, Rabbit IgG 항Lamp1항체, 그리고 Rabbit IgG 항β-액틴 항체, Cell Signaling Technology에서 구매)를 붙여 확인을 하였다.
도 4의 B의 결과를 통해, 상기 언급된 마커들이 Pto 및 Pta 모두에서 유사한 수준으로 유지됨을 확인할 수 있었다.
도 5 관련 실험
본 발명자들은 야생형 Pto DC3000 또는 ΔhrpL 중 어느 하나의 접종 후 대식세포의 사이토카인을 확인하기 위하여 감염 된 대식세포의 배지를 수집하여 13,000rpm에서 원심분리하여 상층액을 수집한 후에 효소결합면역흡착검사(enzyme-linked immunosorbent assay,ELISA)방법을 이용하였다. 세포 배양 배지와 마우스의 혈액 그리고 조직에서 사이토카인의 양을 측정하기 위하여 DuoSet antibody pairs (R&D Systems) 방법을 이용하여 TNF-α, IL-1β 그리고 IL-6를 확인하였다. 우선 96웰 플레이트에 1차 capture 항체를 12시간 동안 실온에서 반응시킨 후에 비특이적결합을 방지하기 위해 1% BSA가 포함된 인산완충생리식염수 (phosphate bufffered saline, PBS)를 첨가하여 실온에서 1시간 동안 반응을 진행하였다. 0.1% 트윈20(Tween20)이 포함된 인산완충생리식염수 (phosphate bufffered saline, PBS)으로 세 번 세척 후에 측정하고자 하는 샘플을 실온에서 2시간 동안 반을 시켰다. 샘플 반응이 끝난 후 0.1% 트윈20(Tween20)이 포함된 PBS로 세 번 세척 후 2차 Detection항체를 첨가하여 2시간 동안 실온에서 반응을 시킨 후 0.1% 트윈20(Tween20)이 포함된 인산완충생리식염수 (phosphate bufffered saline, PBS)으로 세 번 세척하였다. 2차 항체 반응까지 끝낸 후 Streptavidin-HRP 용액을 넣어 실온에서 20분 동안 반응 후 앞선 방법과 동일하게 세 번 세척 후에 TMB 기질 시약 (BD Biosciences)을 첨가한 후에 microtiter plate reader (Emax; Molecular Devices) 장비에서 450nm의 파장으로 흡광도를 측정하여 사이토카인의 양을 분석하였다. MAPK 신호 및 NF-κB 활성의 실험은 감염된 대식 세포에 세포용해버퍼 (RIPA lysis buffer)를 첨가하여 대식 세포내 단백질을 수확한 후에 단백질 흡입법(western blotting)을 이용하여 지시된 각각의 단백질의 항체(Rabbit IgG 항IκBα항체, Rabbit IgG 항pIκBα항체, Rabbit IgG 항pP65항체, Rabbit IgG 항pJNK항체, Rabbit IgG 항pP38항체 그리고 Rabbit IgG 항pERK항체, Cell Signaling Technology에서 구매)를 붙여 확인을 하였다. 그리고 그 결과를 도 5에 나타내었다. 도 5에서 나타낸 바와 같이, 사이토카인의 농도, MAPK 신호 및 NF-κB 활성은 야생형 Pto DC3000 또는 ΔhrpL 감염된 대식세포의 각각의 군에서 유사한 수준으로 증가했다. 도 5의 결과를 통해, 이러한 현상이 대식세포-매개된 식균작용을 억제하는 박테리아 스텔스 기전(stealth mechanism)으로 예상됨을 확인할 수 있었다. 이들 데이터는 대식세포에 대한 Pto DC3000의 감소된 식균작용은 타입 III 분비 시스템을 통한 특정 에펙터의 주입의 결과이다.
도 6 관련 실험
본 발명자들은 에펙터를 찾기 위하여 DC3000로부터의 28 에펙터 중에서 개별적인 18 에펙터가 Pto에 대하여 그러나 타입 III 분비 시스템 기구의 유전자 클러스터를 발현하는 Pseudomonas fluorescens에를 도입하였고, 식균작용 억제를 평가했다(Alfano JR, Charkowski AO, Deng WL, Badel JL, Petnicki-Ocwieja T, et al. 2000. The Pseudomonas syringae Hrp pathogenicity island has a tripartite mosaic structure composed of a cluster of type III secretion genes bounded by exchangeable effector and conserved effector loci that contribute to parasitic fitness and pathogenicity in plants. Proc. Natl. Acad. Sci. USA 97:4856.61, Kvitko BH, Park DH, Velasquez AC, Wei CF, Russell AB, et al. 2009. Deletions in the repertoire of Pseudomonas syringae pv. tomato DC3000 type III secretion effector genes reveal functional overlap among effectors. PLoS Pathog. 5:e1000388).
도 6의 결과를 확인하기 위하여 겐타마이신 (gentamiin) 보호 어세이는 복막 대식세포에 박테리아를 1시간 동안 감염시킨 후에 주변에 감염되지 않은 박테리아를 세척을 한 후에 복막 대식세포 주변에 남아있는 박테리아를 완벽히 제거하기 위하여 겐타마이신을 100ug/ml의 농도로 1시간 동안 처리한 후 2% 트리톤 엑스-100(Triton X-100)이 포함된 인산완충식염수 (phosphate buffered saline)로 복막 대식세포 안에 남아있는 박테리아를 용출하여 박테리아의 복제수를 확인 하였다.
도 6의 결과를 통해, 대식세포에서의 식균작용 억제를 입증하기 위한 겐타마이신 보호 어세이는 HopQ1-발현 P.fluorescens만 야생형 수준과 유사한 낮은 식균작용 수준을 나타냄을 확인할 수 있었다.
실시예 4. HopQ1과 LIMK1과의 상호작용에 의한 식균작용 억제 확인
HopQ1이 어떻게 식균작용을 제한하는지 이해하기 위하여, 플래그-태그된 HopQ1를 293T 세포주에 도입시켜 포유류 세포에 있어서의 결합 파트너 단백질을 찾았다.
도 7의 A 관련 실험
클로닝 (Clonning)과 형질주입 (Transfection)
HopQ1 gene을 Flag표지 단백질 발현 vector인 pBICEP vector에 클로닝 하기 위하여 다음과 같이 프라이머를 준비하였다. HopQ1 (full) 정방향 5’-GACAAGCTTGCGGCCCATCGTCCTATCACCGCA-3’ (서열번호 5) (NotⅠ) 및 역방향 5’-ATGCCACCCGGGATCTCAATCTGGGGCTACCGT-3’ (서열번호 6) (BamHⅠ). 다음으로 PCR(Denaturation 98℃ 10초, Anealing 55℃에서 15초, extension 72℃에서 30초, 총 25 cycle 조건으로 실행)을 이용하여 HopQ1을 증폭시킨 후에 agarose 젤에 로딩하여 사이즈를 확인 후 젤에서 정제한 후에 DNA정량법으로 100ng/ul의 농도로 맞추어주었다. 다음으로 pBICEP vector 1μg을 제한효소인 NotⅠ과 BamHⅠ을 이용하여 vector를 절단한 후에 agarose 젤에 로딩하여 사이즈를 확인하여 젤에서 정제한 후에 DNA 정량법으로 정량하여 50ng에 맞춘다. 위와 같이 준비된 HopQ 100ng와 절단된 pBICEP vector를 INFUSION HD enzyme(Clontech Laboratories)으로 ligation을 수행하여 Flag표지 HopQ1 발현 시스템을 준비하였다. 동일한 방법으로 mCherry 형광을 발현시키는 vector인 pLVX-mCherry-N1 vcetor를 이용하여 mCherry표지 HopQ1을 준비하였다. mCherry vector에 클로닝시 제한 효소는 XhoⅠ과 BamHⅠ을 이용하여 절단된 vector를 준비하고 HopQ1의 PCR을 위한 프라이머는 다음과 같이 준비를 하였다. mCherry-HopQ1 정방향5’-GGACTCAGATCTCGAGATGCATCGTCCTATCACC-3’ (서열번호 7) (XhoⅠ) 및 역방향 5’-CATGACCGGTGGATCATCTGGGGCTACCGTCGA-3’ (서열번호 8) (BamHⅠ). 마우스 기원 Limk1 유전자를 GST 표지 단백질 발현 벡터인 pEBG에 클로닝하기 위하여 각 도메인 별로 다음과 같이 프라이머를 준비하였다. 마우스LIMK1 (full), 정방향 5’-GCGTGGATCCACTAGTATGAGGTTGACGCTACTTT-3’ (서열번호 9) (SpeⅠ) 및 역방향 5’-TCTAGAGTCGCGGCCTCAGTCAGGGACCTCGGG-3’ (서열번호 10) (NotⅠ); 마우스 LIMK1 (△Lim1), 정방향5’-GCGTGGATCCACTAGTGGCGAGTCTTGCCACGG-3’ (서열번호 11) (SpeⅠ) 및역방향 5’-TCTAGAGTCGCGGCCTCAGTCAGGGACCTCGGG-3’ (서열번호 12) (NotⅠ); 마우스 LIMK1 (△Lim2) 정방향 5’-GCGTGGATCCACTAGTGAACAGATCCTACCTGAC-3’ (서열번호 13) (SpeⅠ) 및 역방향 5’-TCTAGAGTCGCGGCCTCAGTCAGGGACCTCGGG-3’ (서열번호 14) (NotⅠ); 마우스 LIMK1 (△Kinase) 정방향 5’-GCGTGGATCCACTAGTATGAGGTTGACGCTACTTT-3’(서열번호 15) (SpeⅠ) 및 역방향 5’-TCTAGAGTCGCGGCCGCCCAGCACTTCCCCATG-3’(서열번호 16) (NotⅠ) ; 마우스 LIMK1 (Lim1,2) 정방향 5’-GCGTGGATCCACTAGTATGAGGTTGACGCTACTTT-3’ (서열번호 17) (SpeⅠ) 및 역방향 5’-TCTAGAGTCGCGGCCGATGACTGGAGTTACCACG-3’ (서열번호 18) (NotⅠ); 마우스 LIMK1 (Lim1) 정방향 5’-GCGTGGATCCACTAGTATGAGGTTGACGCTACTTT-3’(서열번호 19) (SpeⅠ) 및 역방향 5’-TCTAGAGTCGCGGCCGCAAGACTCGCCATAGCG-3’(서열번호 20) (NotⅠ). HopQ1과 동일한 방법을 이용하여 Limk1을 100ng를 준비하고 pEBG 벡터 또한 pBCIEP 벡터와 동일한 방법으로 50ng를 준비한 후에 INFUSION HD enzyme(Clontech Laboratories) 으로 ligation을 수행하여 GST 표지 Limk1 발현 시스템을 준비하였다. 준비된 발현 vector들을 형질 주입하기 위하여 293T 세포주를 1 x 106 세포 기준으로 6-well 배양접시(10% FBS가 포함된 DMEM 배지)에 배양한 후에 항생제가 첨가 되지 않은 10% FBS가 포함된 DMEM 배지 2ml을 배양접시에 공급하였다. 준비된 벡터는 1ug을 TransIT-X2Dynamic Delivery System (Mirus)시약과 1:3 비율로 250ul의 opti-MEM 배지에 혼합하여 30분 정도 실온 (24°C)에서 반응 시킨 후에 준비된 293T 세포주에 첨가하여 24시간 후에 발현 양을 확인하여 실험에 이용하였다.
293 세포에 대조군 항-DYKDDDDK {플래그(Flag)}만 발현하는 pBICEP 벡터 또는 항-DYKDDDDK {플래그(Flag)} 태그된 HopQ1 유전자를 함유하는 pBICEP로 형질감염되었다. 형질 감염 후 24 시간 후에, 세포를 세표용해버퍼 (RIPA lysis buffer)로 단백질을 용출하였고 동일한 양의 단백질을 회전 장치 상에서 4℃에서 2시간 동안 항-DYKDDDDK {플래그(Flag)} 태그된 자성 비드와 함께 배양 후 자성을 가지는 컬럼을 이용하여 항-DYKDDDDK {플래그(Flag)}에 결합된 단백질들 복합체를 분리한 후에 결합된 단백질을 내인성 Limk1, Cdc42, Wasp, Rac1, Pak1, 칼시뉴린(Calcineurin) 및 코필린(Cofilin)과 HopQ1의 연합이 항-플래그 면역침전 이어서 각각의 단백질 흡입법(western blotting)을 이용하여 각각에 대한 항체로 검출하여 나타내졌다. 구체적으로 면역침강법을 위해 Flag 표지 HopQ1이 형질주입 (Transfection)된 293T 세포주를 프로테아제 억제제 (proteinase inhibitor)가 포함된 세포 용해 버퍼(RIPA lysis buffer)로 세포를 용해 시킨 후에 BCA법을 이용하여 단백질 정량을 한 후에 동일한 단백질 샘플에 안티- DYKDDDDK(Flag) 표지 마그테틱 비드를 첨가하여 4°C에서 2시간 동안 선회장치(rotating apparatus)에서 반응 시킨 후에 자성 컬럼을 이용하여 마그테틱 비드에 결합되지 않은 단백질을 제거하기 위하여 차가운 세포용해버퍼(RIPA lysis buffer)로 3번 세척한다. 세포용해버퍼(RIPA lysis buffer)를 제거한 후에 2배의 Laemmli 샘플 버퍼로 비드에 결합된 단백질 샘플을 얻어 낸 후에 단백질 흡입법을 통하여 Flag 표지 HopQ1과 결합된 단백질을 확인하기 위하여, Rabbit IgG 항 Limk1 항체, Rabbit IgG 항 Wasp 항체, Rabbit IgG 항 Calcineurin 항체, Rabbit IgG 항 pCofilin1 항체, Rabbit IgG 항 Cofilin1 항체, Rabbit IgG 항 Pak1 항체, Rabbit IgG 항 Cdc42 항체, Rabbit IgG 항 Rac1 항체 (상기 항체들은 Cell Signaling Technology에서 구매)를 이용하여 분석하였다.
도 7의 A의 결과를 통해, 식물 HopQ1은 포유류 LIMK1과 상호작용함을 확인할 수 있었다.
도 7의 B 관련 실험
LIM 도메인 키나아제 1(LIMK1)은 다양한 키나아제에 의해 인산화되고, 그리고 나서 활성화되는 세린/트레오닌 키나아제이다. 인산화된 LIMK1은 액틴의 중합 및 해중합을 조절하는 코필린1(cofilin1)의 인산화 및 불활성화를 유도한다(Bravo-Cordero JJ, Magalhaes MA, Eddy RJ, Hodgson L, Condeelis J (2013), Functions of cofilin in cell locomotion and invasion, Nat Rev Mol Cell Biol. 14(7):405-15). 이들 사건은 세포내로의 입자의 흡입을 예방하고, 이는 식세포 컵 폐쇄(phagocytic cup closure)의 억제를 야기한다(HBierne, Edith Gouin, Pascal Roux, Pico Caroni, Helen L. Yin, and Pascale Cossart(2001), A role for cofilin and LIM kinase in Listeria-induced phagocytosis, J. Cell Biol. 155:101-112).
293 세포에 대조군 항-DYKDDDDK {플래그(Flag)}만 발현하는 pBICEP 벡터 또는 항-DYKDDDDK {플래그(Flag)} 태그된 HopQ1 유전자를 함유하는 pBICEP로 형질감염되었다. 형질 감염 후 24 시간 후에, 세포를 세표용해버퍼 (RIPA lysis buffer)로 단백질을 수확하였고 동일한 양의 단백질을 HopQ1 발현에 의한 pLimk1, Limk1, pCofilin1, Cofilin1, Ssh1, 크로노핀(chronophin) 및 β-액틴의 수준은 도 7의 A와 같이 단백질 흡입법(western blotting)을 이용하여 각각에 대한 항체로 검출하여 결정되었다. 이때 사용한 항체 정보는 다음과 같다(Rabbit IgG 항 pLimk1 항체, Rabbit IgG 항 Limk1 항체, Rabbit IgG항 pCofilin1 항체, Rabbit IgG 항 Cofilin1 항체, Rabbit IgG 항 Ssh1 항체, Rabbit IgG 항 크로노핀(chronophin)항체 및 Rabbit IgG 항 β-액틴 항체, Cell signaling에서 구매).
HopQ1에 대한 웨스턴 블롯 분석은 항-플래그 항체를 이용하여 수행되었다.
도 7의 B의 결과를 통해, 293T 세포에서의 코필린1(cofilin1) 및 LIMK1의 인산화 및 발현을 분석하여 HopQ1은 Limk1에 결합하고 그리고나서 Limk1 및 코필린1(cofilin1) 모두의 인산화를 활성화시킬 수 있다는 것을 확인할 수 있었다.
도 7의 C 관련 실험
LIMK1은 두 개의 LIM 도메인, PDZ 도메인, 및 키나아제 도메인으로 이루어진다. 어떻게 HopQ1가 LIMK1과 상호작용하는지 밝히기 위해, 본 발명자들은 LIMK1의 도메인 결실 돌연변이체를 생성하였다. HopQ1 (플래그 발현 pBICEP)- 및 Limk1 (GST 발현 pEBG)-인코딩 벡터가 293T에 공동 형질감염 되었다. 단백질 복합체를 GST 풀-다운 어세이(GST pull-down assay)를 이용하여 확인하기 위하여 294T 세포를 세포용해버퍼 (RIPA lysis buffer)로 단백질을 수확한 후에 BCA법을 이용하여 단백질 정량을 한 후에 동일한 양의 단백질에 glutathione-agarose beads를 동일한 양을 첨가하여 회전 장치 상에서 4℃에서 2시간 동안 배양한 후에 glutathione-agarose beads 침전시킨 후 상층액을 제거한 후 세포용해버퍼(RIPA lysis buffer)를 첨가 한 후 다시 glutathione-agarose beads 침전 시켜 상층액을 제거하여 GST에 결합하지 않는 단백질을 충분히 제거한 후에 침전된 glutathione-agarose beads를 수확하여 HopQ1 및 Limk1 구축물에 대한 단백질 흡입법(western blotting) 분석이 항-플래그, 항-GST 항체, β-액틴 항체, Cell Signaling Technology(Rabbit IgG 항 플래그 항체 그리고 Rabbit IgG 항-GST 항체, Rabbit IgG 항β-액틴 항체는 각각 Sigma-Aldrich 와 Santa Cruz Biotechnology 및 Cell Signaling Technology에서 구매)를 이용하여 수행되었다.
도 7의 C의 결과를 통해, HopQ1은 LIMK1의 N-말단 LIM1 도메인을 통해 LIMK1과 상호작용함을 확인할 수 있었다.
도 7의 D 관련 실험
3T3-L1 세포는 GST-Limk1(녹색) 또는 세포내에서 내인성으로 붉은 형광을 나타내는 mCherry-HopQ1(붉은색) 중 어느 하나로 형질감염되었고 4% 포름알데하이드 (formaldehyde)로 고정한 후, 0.2% 트리톤 엑스-100 (Triton X-100)이 포함된 인산완충식염수 (phosphate buffered saline)으로 세포막 투과(permeabilization)을 유도한 후에 GST를 검출하는 항-GST 항체를 12시간 동안 배양 후에 항-GST 항체를 특이적으로 인식하는 2차 항체(녹색 염료 Alexa Fluor 488(Alexa 488)로 컨주게이트된)로 1시간 동안 배양(10% FCS (fetal calf serum)이 포함된 DMEM 배지)하여 LIMK1(녹색)이 염색되었다. 세포핵을 염색하기 위하여 핵 염색 시약인 DAPI를 처리하여 세포 핵을 염색한 후 공초점 레이저 현미경 (Carl Zeiss, LSM510)를 이용하여 복막 대식 세포안에서 GFP(녹색) 형광과 mCherry (붉은색) 형광을 가지는 단백질를 측정하고 분석하였다. 도 7의 D의 왼쪽 이미지는 3T3-L1 세포에 있어서 LIMK1 및 HopQ1 모두의 공동-국소화를 보여준다. 도 7의 D에서 기준자는 10㎛이다. HopQ1 발현은 세포에 있어서의 웨스턴 블롯 분석에 의해 결정되었다. 도 7의 D 오른쪽 도는 HopQ1-형질감염된 3T3-L1 세포에 있어서의 HopQ1 수준을 보여준다.
도 7의 E 관련 실험
본 발명자들은 이 에펙터가 식균작용-관련된 신호를 변화시키는지 여부를 결정하기 위해 HopQ1-발현 P.fluorescens에 의한 복막 대식세포의 감염 동안의 LIMK1 및 cofilin1의 인산화를 평가하였다. 복막 대식세포는 도 1의 A와 동일한 방법으로 P. fluorescens 및 HopQ1 발현된 P. fluorescens는 지시된 시간에 마우스 대식세포에 감염되었다. 박테리아를 감염 시킨 후에 지시 된 시간별로 세포용해버퍼 (RIPA lysis buffer)를 첨가하여 세포내 단백질을 수확한 후에, Limk1, pLimk1, p코필린1(pCofilin1) 및 코필린1(Cofilin1), 크로노핀(chronophin), Ssh1, 및 β-액틴의 수준은 도 7의 A와 같이 단백질 흡입법(western blotting)을 이용하여 각각에 대한 항체로 검출하여 결정되었다. 이때 사용한 항체 정보는 다음과 같다(Rabbit IgG 항 pLimk1 항체, Rabbit IgG 항 Limk1항체, Rabbit IgG 항 p코필린1(pCofilin1)항체 그리고 Rabbit IgG 항 코필린1(Cofilin1)항체, Cell signaling에서 구매).
도 7의 E의 결과를 통해, Limk1 및 cofilin1의 인산화 수준은 벡터 대조군에 비해 HopQ1-발현 P.fluorescens로 감염된 마우스 복막 대식세포에서 증가하였음을 확인할 수 있었다. 그러므로, 도 7의 E의 결과를 통해, HopQ1은 LIMK1 및 코필린1(Cofilin1)의 상승된 인산화에 의한 식균작용 경로를 억제하는데 기여할 수 있음을 확인할 수 있었다.
도 8의 A 관련 실험
포유류에서 박테리아 감염에 의해 유도되는 심각한 질환 중 하나인 균혈증(Bacteremia)은 혈청 또는 조직에 남아 패혈증 및 패혈증 쇼크를 유도한다. 생체 내에서(in vivo), HopQ1에 의한 식균작용의 조절을 확인하기 위하여, 마우스는 Pto DC3000 또는 ΔhrpL로 주입되었다. Pto DC3000 또는 Pto ΔhrpL (108 CFU의 살아있는 박테리아) 10-12주령의 C57BL/6 마우스에 인산완충식염수 (phosphate buffered saline)로 녹여 0.2ml을 마우스 복강내로 주입되었다. 24시간 후, 마우스의 간, 비장을 적출하여 무게를 측정한 후에 70um의 스트레이너를 King’s Media 넣고 갈아 조직을 파쇄 후 총 볼륨을 10ml로 맞춘 후에 Agar 플레이트에 도말 후 30℃에서 배양하여 박테리아의 콜로니 수를 확인하였다. 혈액의 경우 King’s media에 10배 희석하여 Agar 플레이트에 도말 후 30℃에서 배양하여 박테리아의 콜로니 수를 확인 하였다. 박테리아 복제는 집락형성단위(CFU)를 결정함으로써 측정되었다. 데이터는 각 시점에 대한 세 개의 웰로부터 계산된 평균±표준편차이다(**P<0.01, ***P<0.001). 도 8의 A의 결과를 통해, ΔhprL-접종된 마우스로부터의 복막강, 혈액, 비장 및 간이 DC3000-접종된 마우스에 비해 극적으로 더 많은 박테리아의 수를 나타냄을 확인할 수 있었다.
도 8의 B 및 도 9 관련 실험
액틴 세포골격의 리모델을 위한 식세포 컵 형성은 실시간영상분석 현미경(time-lapse microscope)에 의해 분석되었다. Pto DC3000 또는 ΔhrpL 돌연변이체가 RAW 264.7 세포에 처리되었고, 그리고나서 매 15초마다 이미지를 캡쳐함으로써 30분의 기간에 걸쳐 모니터링되었다. 구체적으로, RAW 264.7 세포주를 35미리 유배양접시 (μ-dish)에 1 × 105 세포 수로 24시간 동안 10% FBS가 포함된 RPMI 배지로 배양한 후에 배양접시를 형광현미경 fluorescence microscope (Olympus, IX81-ZDC)이 설치된 실시간 세포 배양 챔버에 옮긴 후에 P.syringae DC3000와 P.syringae DC3000 ΔHrpL를 2 × 106 콜로니 수로 RAW 264.7 세포주에 감염시킨 후에 식세포 컵이 형성 되는 것을 15초 간격으로 30분 동안 실시간 이미지를 촬영한 후에 Metamorph 7.1 프로그램으로 이미지 데이터를 분석하였다. 세 개의 독립적인 실험으로부터의 형성 숫자 및 빈도의 정량 데이터는 그래프로 나타내졌다. *P <0.05. 현미경 이미지는 도 9에 나타냈다. 도 8의 B 및 도 9의 결과를 통해, RAW 264.7 세포 내로 ΔhrpL 처리는 식세포 컵 형성 숫자 및 빈도를 유의하게 증가시킴을 확인할 수 있었다.
도 8의 C, 도 10 및 도 11 관련 실험
식균작용의 억제에 대한 HopQ1의 기능을 알아내도록, 본 발명자들은 많은 인간의 정상 장내 세균총(normal gut flora)의 일원이고 타입 III 분비 시스템을 함유하는 Enterobacter cloacae를 사용하였다(Kvitko BH, Park DH, Velasquez AC, Wei CF, Russell AB, et al. 2009. Deletions in the repertoire of Pseudomonas syringae pv. tomato DC3000 type III secretion effector genes reveal functional overlap among effectors. PLoS Pathog. 5:e1000388).
도 1의 b와 동일한 방법으로 마우스 복막 대식세포는 GFP-발현 E.cloacae(pDSK-GFPuv 벡터와 동일한 벡터에 HopQ를 클로닝 후 각 벡터를 형질전환 시켜 녹색 형광을 발현하는 균주, E.cloacae (KCTC 2361)는 KCTC(Korean Collection for Type Cultures, Daejeon, Korea)으로부터 수득하였다) 또는 DsRed 및 HopQ-발현 E.cloacae (pBBRBB-DsRED 벡터와 동일한 벡터에 HopQ를 클로닝 후 각 벡터를 혈질전환 시켜 적색 형광을 발현하는 균주)로 1시간동안 감염되었고 그리고 나서 인산완충식염수 (phosphate buffered saline)로 세척하고 긁어내고, 4% 포름알데하이드 (formaldehyde)로 고정하여 남아있는 박테리아의 GFP형광을 측정하여 박테리아가 제거된 정도를 확인하기 위하여 1의 A와 같은 유세포 분석법이 사용되었다. 유세포 분석이 제거된 박테리아의 확인을 위해 사용되었다. 현미경 이미지는 도 11에 나타내졌다. 도 8의 C, 도 10 및 도 11의 결과를 통해, 플라스미드 상의 HopQ1은 E. cloacae 내에 도입되어 감염동안 RAW 264.7 및 복막 대식세포의 식균작용이 성공적으로 예방할 수 있음을 확인할 수 있었다.
도 8의 D 관련 실험
추가적으로, 생체내에서(in vivo) HopQ1에 의한 식균작용의 조절을 확인하기 위하여, 108 CFU/ml로 HopQ1를 함유하는 플라스미드를 가지거나 가지지 않는 E.cloacae가 10-12주령의 마우스에 인산완충식염수 (phosphate buffered saline)로 녹여 0.2ml을 마우스 복강내로 주입되었다. 24시간 후, 혈액, 비장 및 간 시료를 수확한 후에 균질화하여 한천 플레이트 상에 플레이트되었고 그리고나서 24시간동안 배양되었다. 24시간 후, 마우스의 간, 비장을 적출하여 무게를 측정한 후에 70um의 스트레이너를 King’s Media 넣고 갈아 조직을 파쇄 후 총 볼륨을 10ml로 맞춘 후에 Agar 플레이트에 도말 후 30℃에서 배양하여 박테리아의 콜로니 수를 확인하였다. 박테리아 복제는 집락형성단위(CFU)를 결정함으로써 측정되었다. 데이터는 각 시점에 대한 세 개의 웰로부터 계산된 평균±표준편차이다(**P<0.01). 도 8의 D의 결과를 통해, HopQ1-발현 E. cloacae 주입된 마우스로부터의 혈액, 비장 및 간은 대조군 E. cloacae 주입된 마우스에 비해 극적으로 더 높은 CFU를 나타냄을 확인할 수 있었다.
실시예 5. P. syringae pv. tomato 의 대식세포에 의한 phagocytosis 억제 확인
도 12 관련 실험
P. syringae pv. tabaci와 E.coli의 경우에 대식세포에 의한 phagocytosis가 원활하게 이루어지지만, P. syringae pv. tomato는 대식세포에 의한 phagocytosis가 억제를 받음을 confocal image를 이용해서 확인하였다. 대식세포에 의한 각 균주의 식균작용을 테스트하기 위해서, 형광이 발현되는 각각의 박테리아를 대식세포에 infection 시킨후 타겟 분자와 박테리아의 양상을 confocal 이미지로 검사하였다. early phagosome maturation에 관여하는 EEA1과 형광을 나타내는 박테리아의 location(도 12의 A)과 lysosome의 마커를 이용해서 박테리아의 위치(도 12의 B)를 confocal image를 이용해서 확인하였다.
도 12의 A에서 확인되는 바와 같이, 대식세포에 의한 정상적인 phagocytosis의 발생시 early phagosome maturation에 관여하는 EEA1과 박테리아의 co-localization을 확인할 수 있으나, P. syringae pv. tomato의 경우는 이러한 현상이 나타나지 않음이 확인되었다. 도 12의 B의 결과는 phagocytosis의 마지막 단계인 라이소좀과의 원활한 결합에 의한 박테리아의 degradation을 보여주는 그림인데, P. syringae pv. tomato의 경우는 초기 phagocytosis의 억제에 의한 영향으로 극소량의 박테리아만 대식세포내로 들어오는 것을 보여주었다.
즉, 도 12의 A 및 B에서 확인되는 바와 같이, P. syringae pv. tabaci와 E.coli는 흰색 화살표로 나타냈듯이 co-localization(노란색으로 표기된 부분)되지만, P. syringae pv. tomato는 박테리아의 수 자체(또는 초록색)가 감소되는 것이 확인되었다.
또한, z stack images (x-z plane)를 확인한 결과를 도 12의 C에 나타내었다. 도 12의 C에서 확인되는 바와 같이, P. syringae pv. tabaci는 대식세포의 내부에 존재하지만, P. syringae pv. tomato는 대식세포의 표면에 단순히 붙어 있는 것을 확인함으로써, P. syringae pv. tomato는 대식세포의 phagocytosis가 원활하게 이루어지지 못하도록 억제하는 기능을 갖고 있는 것이 확인되었다.
상기 실시예들의 실험결과들은 고려하면, 본 발명자들은 식물 병원균 박테리아 Pto로부터의 HopQ1 에펙터는 LIMK1과 특이적으로 상호작용하고 비활성형인 과도하게 인산화된 코필린1(cofilin1)을 야기하는 인산화된 LIMK1을 생산하는 키나아제로서 사용함에 의해 포유류 방어 시스템에서의 식균작용을 억제한다는 것을 최초로 입증하였다. HopQ1에 의한 Limk1의 인산화는 코필린(cofilin)의 인산화를 유지하고, 액틴 필라멘트의 조립 및 분해를 조절하고, 과도한 인산화에 의한 코필린의 억제는 돌출(protrusion), 세포 극성(cell polarity) 및 화학주성(chemotaxis)에 있어서의 결함을 야기한다(Bravo-Cordero JJ, Magalhaes MA, Eddy RJ, Hodgson L, Condeelis J (2013), Functions of cofilin in cell locomotion and invasion, Nat Rev Mol Cell Biol. 14(7):405-15). 결론적으로, 본 발명자들은 Pseudomonas syringae의 HopQ1 에펙터가 세포 이동에 연루된 LIMK1를 직접적으로 표적화함으로써 코필린의 인산화를 통해 숙주 식균작용을 제한하는 특별한 역할을 규명하였다.

Claims (11)

  1. (a) 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIM 도메인 키나아제 1(LIMK1)에 시험물질을 접촉시키는 단계; 및
    (b) 상기 시험물질이 상기 타입 III 에펙터 단백질인 HopQ1과 그의 결합파트너로서의 LIMK1의 상호작용을 억제하는 지 여부를 분석하는 단계;
    (c) 상기 시험물질이 상기 상호작용을 억제하면 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 저해제 후보로 선별하는 단계를 포함하는 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝 방법.
  2. 제1항에 있어서, 상기 타입 III 에펙터 단백질인 HopQ1은 서열번호 1의 펩티드 서열로 표시되는 방법.
  3. 제1항에 있어서, 상기 LIMK1은 서열번호 3의 펩티드 서열로 표시되는 방법.
  4. 제1항에 있어서, 상기 단계 (b)는 투-하이브리드 방법, 공동면역침강 방법(co-immunoprecipitation assay), 공동-국소화 분석(co-localization assay), 섬광 근접 측정법(scintillation proximity assay; SPA), UV 또는 화학적 가교 결합 방법, 이분자 상호작용 분석(bimolecular interaction analysis; BIA), 질량 분석법(mass spectrometry; MS), NMR(nuclear magnetic resonance) 또는 형광 편광 분석법(fluorescence polarization assays; FPA)에 의해 수행되는 방법.
  5. 제1항에 있어서, 상기 타입 III 에펙터 단백질인 HopQ1과 LIMK1과의 상호작용은 상기 타입 III 에펙터 단백질인 HopQ1과 LIMK1의 N-말단 LIM1 도메인을 통한 상호작용인 것인 방법.
  6. 제1항에 있어서, 상기 면역 억제는 분리된 포유동물의 대식세포에서의 식균작용을 억제하는 것인 방법.
  7. 제1항에 있어서, 상기 면역 억제는 인간을 제외한 포유동물의 대식세포에서의 식균작용을 억제하는 것인 방법.
  8. 제1항에 있어서, 상기 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 억제제는 세포내 독소 유발 쇼크 조절용 물질인 것인 방법.
  9. 제8항에 있어서, 상기 세포내 독소 유발은 패혈증에 의한 것인 방법.
  10. 타입 III 에펙터 단백질인 HopQ1; 및
    그의 결합파트너로서의 LIM 도메인 키나아제 1(LIMK1)을 포함하는 타입 III 에펙터 단백질인 HopQ1에 의한 면역 억제에 대한 억제제 스크리닝용 조성물.
  11. 타입 III 에펙터 단백질인 HopQ1을 포함하는 대식세포의 식균 작용 억제용 조성물.
PCT/KR2016/006791 2015-06-26 2016-06-24 타입 iii 에펙터 hopq1 및 lim 도메인 키나아제1(limk1)의 상호작용을 이용한 hopq1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물 Ceased WO2016209036A2 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2015-0090939 2015-06-26
KR20150090939 2015-06-26

Publications (2)

Publication Number Publication Date
WO2016209036A2 true WO2016209036A2 (ko) 2016-12-29
WO2016209036A3 WO2016209036A3 (ko) 2017-02-16

Family

ID=57586045

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2016/006791 Ceased WO2016209036A2 (ko) 2015-06-26 2016-06-24 타입 iii 에펙터 hopq1 및 lim 도메인 키나아제1(limk1)의 상호작용을 이용한 hopq1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물

Country Status (2)

Country Link
KR (1) KR101852148B1 (ko)
WO (1) WO2016209036A2 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109164260A (zh) * 2018-08-20 2019-01-08 广州伯信生物科技有限公司 一种能够排除抗体信号干扰的免疫共沉淀方法

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111411115B (zh) * 2020-03-03 2022-05-27 中山大学 基因和改良根瘤菌的方法

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
IN184685B (ko) * 1996-02-14 2000-09-23 Nat Inst Immunology
US8163474B2 (en) 2008-03-15 2012-04-24 Arbor Vita Corporation NS1-NP diagnostics of influenza virus infection

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN109164260A (zh) * 2018-08-20 2019-01-08 广州伯信生物科技有限公司 一种能够排除抗体信号干扰的免疫共沉淀方法

Also Published As

Publication number Publication date
WO2016209036A3 (ko) 2017-02-16
KR20170001646A (ko) 2017-01-04
KR101852148B1 (ko) 2018-04-25

Similar Documents

Publication Publication Date Title
Dupuis-Williams et al. Functional role of ε-tubulin in the assembly of the centriolar microtubule scaffold
Aistleitner et al. Selective fragmentation of the trans-Golgi apparatus by Rickettsia rickettsii
KR101242445B1 (ko) 세균성 발병력 인자들 및 그의 용도들
Tomita et al. Toxoplasma gondii matrix antigen 1 is a secreted immunomodulatory effector
JP2003524400A (ja) Ｓ．ｃｅｒｅｖｉｓｉａｅ由来のタンパク質−タンパク質およびそれを使用する方法
Kim et al. Synaptotagmin 5 controls SYP132-VAMP721/722 interaction for Arabidopsis immunity to Pseudomonas syringae pv tomato DC3000
CN114133450A (zh) 抗-Rho GTPase的构象单域抗体及其用途
Wilson et al. A Toxoplasma gondii patatin-like phospholipase contributes to host cell invasion
WO2016209036A2 (ko) 타입 iii 에펙터 hopq1 및 lim 도메인 키나아제1(limk1)의 상호작용을 이용한 hopq1에 의한 면역 억제에 대한 억제제 스크리닝 방법 및 이를 위한 조성물
Dhanda et al. Cyclophilin A controls Salmonella internalization levels and is present at E. coli actin‐rich pedestals
Bavelloni et al. Proteomic‐based analysis of nuclear signaling: PLCβ1 affects the expression of the splicing factor SRp20 in Friend erythroleukemia cells
CA2926997A1 (en) Perforin-2 activators and inhibitors as drug targets for infectious disease and gut inflammation
Luo et al. Localization of the hypothetical protein Cpn0585 in the inclusion membrane of Chlamydia pneumoniae-infected cells
US7423018B2 (en) Kinesin-like proteins and methods of use
KR101223995B1 (ko) 간흡충증 진단용 조성물
KR101223998B1 (ko) 간흡충증 진단용 조성물
EP3404038A1 (en) Cyclin-dependent kinase substrate
KR100883158B1 (ko) 살아있는 세포에서 단백질분해효소의 활성 측정 방법
CN119574888A (zh) 一种靶点在药物中的应用
CN101891813A (zh) 白血病耐药细胞膜蛋白及其作为耐药靶蛋白的用途
Edberg Characterization of monoclonal antibodies reactivity patterns against transthyretin
Szep ORP3 Promotes ALPK1-TIFA Dependent NF-κB Activation upon Detection of Bacterial Heptose Phosphate containing Metabolites
Arsenault Yee Deciphering the Function of HAM1 in the Biology of Cryptococcus neoformans Item
Yee Deciphering the Function of HAM1 in the Biology of Cryptococcus neoformans
Su et al. A novel YGGT family protein is localized in the apicoplast and is essential for the organelle inheritance

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16814749

Country of ref document: EP

Kind code of ref document: A2

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16814749

Country of ref document: EP

Kind code of ref document: A2