WO2016184784A1 - Peptides including binding domain of plasmodium falciparum proteins (cbp1 and cbp2) to chemokine cx3cl1 - Google Patents
Peptides including binding domain of plasmodium falciparum proteins (cbp1 and cbp2) to chemokine cx3cl1 Download PDFInfo
- Publication number
- WO2016184784A1 WO2016184784A1 PCT/EP2016/060755 EP2016060755W WO2016184784A1 WO 2016184784 A1 WO2016184784 A1 WO 2016184784A1 EP 2016060755 W EP2016060755 W EP 2016060755W WO 2016184784 A1 WO2016184784 A1 WO 2016184784A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cx3cl1
- amino acid
- seq
- cbp2
- xaal
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/20—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans from protozoa
- C07K16/205—Plasmodium
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
- A61P33/02—Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
- A61P33/06—Antimalarials
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/44—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from protozoa
- C07K14/445—Plasmodium
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- PEPTIDES INCLUDING BINDING DOMAIN OF PLASMODIUM FALCIPARUM PROTEINS (CBPl AND CBP2) TO CHEMOKINE CX3CL1
- the invention relates to isolated peptides including binding domain of two Plasmodium Falciparum proteins (CBPl and CBP2) to the chemokine CX3CL1 which have the property to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells.
- CBPl and CBP2 Plasmodium Falciparum proteins
- iRBC infected red blood cells
- CX3CL1 binding protein or CX3CL1 associated diseases.
- iRBCs P. falciparum- fectGd red blood cells
- Sequestration of iRBC causes microvascular obstruction, leads to metabolic disturbances (Planche et al, 2005; Zougbede et al, 2010), and allows iRBC to escape splenic clearance, which is a selective advantage for the microorganism (Buffet et al, 2009; Mebius & Kraal, 2005).
- P EMP1 Plasmodium falciparum Erythrocyte Membrane Protein 1
- cytoadherence of iRBC may involve other molecules that have not yet been identified (Rowe et al, 2009).
- iRBC adhere to the chemokine CX3CL1 (Hatabu et al, 2003) and a recent study rules out the intervention of PfEMPl in the adherence phenotype to CX3CL1 (Janes et al., 2011). So the P. falciparum ligand to CX3CL1 remains unknown.
- Chemokines or chemotactic cytokines, are secreted soluble molecules that are expressed by numerous cell types of the immune system, either constitutively or following the induction of inflammatory responses. Chemokines have indeed played a pivotal role in recruitment, activation, and retention of immune and non-immune cells and specifically, their infiltration or egression at inflamed sites and immune organs (Baggiolini, 1998; Viola & Luster, 2008).
- Chemokine receptors are essentially G-protein Coupled Receptors (GPCR), members of the Rhodopsin class (Moser & Loetscher, 2001).
- GPCR G-protein Coupled Receptors
- the chemotactic activity of chemokines involves both activation of cell movement as well as adherence on various support. While chemokines generally operate through cell adherence by inducing or activating classical adhesive molecules like integrins (Moser & Loetscher, 2001; Rot & Von Andrian, 2004), CX3CL1 is an exception since it is natively expressed as a transmembrane protein that is endowed with an adhesive function unique among chemokines.
- CX3CL1 is expressed by numerous endothelial cell types, including the cerebral (Tarozzo et al, 2002; Zujovic et al, 2000) and trophoblastic (Cammas et al, 2005; Shimoya et al, 2003) lineages.
- Inflammation is the body's immediate response to damage to its tissues and cells by pathogens, noxious stimuli such as chemicals, or physical injury. (U.Weiss, Nature Insight, 2008, Vol. 454, Issue no. 7203). Though this phenomenon is extremely important for the accomplishment of healing processes, dysregulated inflammation can have severe consequences.
- Inflammation can be divided into two forms: acute inflammation, which is a short term response, and chronic inflammation, which is a dysregulated and maladaptive reaction highly detrimental for the host. It is now well established that chronic inflammation is involved in the development of several diseases among which are cardiovascular diseases, obesity, diabetes, asthma, inflammatory bowel diseases, allergies and rheumatoid arthritis (Durgaprasad L. et al, Inflammation & Allergy- Drug Targets, 2013, 12, 349-361).
- Acute inflammation is considered as mainly beneficial in the healing process, but when it is uncontrolled, it can lead to severe pathologies as for example the Systemic Inflammatory Response Syndrome (SIRS) and sepsis which are both common causes of morbidity and death in intensive care units (Fitting C.et al, PloS one 7.6, 2012, e38916).
- SIRS Systemic Inflammatory Response Syndrome
- NSAIDs Nonsteroidal anti- inflammatory
- NSAIDs are the most commonly used anti-inflammatory drugs but have several side effects among which are gastrointestinal ulcers and bleeding (H. Suleyman et al., Pharmacological Reports, 2007, 59, 247-258).
- CBP1 and CBP2 which are involved in CX3CL1 -mediated cytoadherence via a binding domain with CX3CL1, and accordingly, peptides derived from this binding domain, would represent a promising target of malaria infection but also for inflammation.
- the invention provides an isolated peptide comprising an amino acid sequence of formula (I):
- Xaal is serine (S) or absent
- Xaa2 is lysine (K), or absent;
- Xaa3 is Phenylalanine (F) or serine (S);
- Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid
- Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
- Xaa6 is methionine (M) or leucine (L);
- Xaa7 is leucine (L) or lysine (K);
- Xaa8 is alanine (A), asparagine (N) or aspartic acid (D),
- Xaa9 is isoleucine (I) or glutamic acid (E);
- XaalO is alanine (A), asparagine (N) or aspartic acid (D).
- Xaal 1 is Glycine (G) or absent;
- Xaa5 is asparagine (N).
- Xaal is serine (S) or absent
- Xaa2 is lysine (K), or absent
- Xaa3 is serine (S) or Phenylalanine (F)
- Xaa4 is leucine (L) or asparagine (N)
- Xaa5 is asparagine (N)
- Xaa6 is leucine (L), or methionin (M)
- Xaa7 is lysine (K) or leucine (L)
- Xaa8 is alanine (A) or asparagine (N)
- Xaa9 is glutamic acid (E) or isoleucine (I)
- XaalO is asparagine (N), alanine (A), Xaal l is Glycine (G), or absent.
- the isolated peptide comprises or consists of the following amino acid sequences
- the invention further relates to antibodies generated against the isolated peptides of the invention.
- the invention further relates to a pharmaceutical and vaccinal composition
- a pharmaceutical and vaccinal composition comprising an isolated peptide of the invention, together with a pharmaceutically acceptable carrier, and to the use of the peptides or the pharmaceutical composition according to the invention for treating or preventing Malaria or inflammatory disease and disease related to CX3CL1.
- CBP1 and CBP2 for CX3CL1 -Binding-Proteins - were previously identified as potential surface proteins of the early gametocytes and called P. falciparum Gametocyte-Exported Proteins (PfGEXPlO and PfGEXP07) (Silvestrini et al, 2010).
- the inventors have identified peptides sequence of the binding domain of CBP1 and CBP2 to the chemokine CX3CL1, corresponding to their extracellular domain (CBP1-EC and CBP2-EC), which has the property to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells (CBPl and CBP2, previously known as PfGEXPlO and PfGEXP07, sequences deposited in PlasmoDB database under accession number PF3D7_0113900 and PF3D7_1301700).
- binding domains of 9 and 12 amino-acids residues correspond to amino acid positions 182-190 of PfGEXPlO for CBPl -EC and to amino acid positions 188-199 of PfGEXP07 for CBP2-EC. These binding domains are able to inhibit the cytoadherence of P. falciparum-infected RBC to mammalian cells and consequently to treat Malaria disease.
- the inventors have obtained that these peptide CBP1- EC and CBP2-EC (and their specific antibody directed against CBPl -EC and CBP2-EC) competes with the native protein CBPl and CBP2 for binding to the CX3CL1 chemokine.
- the invention relates to novel isolated peptides derived from the extracellular domain of CBPl and CBP2 proteins of Plasmodium Falciparum, which have capacity to inhibit the interaction between CBPl or CBP2 of Plasmodium Falciparum with CX3CL1 and/or to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells;.
- iRBC infected red blood cells
- the invention provides an isolated peptide, comprising an amino acid sequence of formula (I):
- Xaal is serine (S) or absent
- Xaa2 is lysine (K), or absent;
- Xaa3 is Phenylalanine (F) or serine (S);
- Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid (E);
- Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
- Xaa6 is methionine (M) or leucine (L);
- Xaa7 is leucine (L) or lysine (K);
- Xaa8 is alanine (A) asparagine (N) or aspartic acid (D).
- Xaa9 is isoleucine (I) or glutamic acid (E);
- XaalO is alanine (A), asparagine (N) or aspartic acid (D).
- Xaal 1 is Glycine (G) or absent;
- Xaa5 is asparagine (N).
- Xaal is serine (S) or absent
- Xaa2 is lysine (K), or absent
- Xaa3 is serine (S) or Phenylalanine (F)
- Xaa4 is leucine (L) or asparagine (N)
- Xaa5 is asparagine (N)
- Xaa6 is leucine (L), or methionine (M)
- Xaa7 is lysine (K) or leucine (L)
- Xaa8 is alanine (A)
- Xaa9 is glutamic acid (E) or isoleucine (I)
- XaalO is asparagine (N), alanine (A)
- Xaal 1 is Glycine (G), or absent.
- the isolated peptide excludes the whole sequence of CBP1 and CBP2 proteins (PfGEXPIO (SEQ ID NO:9) and PfGEXP07 (SEQ ID NO: 10)).
- the invention provides an isolated peptide selected from the group comprising or consisting of:
- the isolated peptide comprises or consists of the following acid sequences STLNLKNEN (SEQ ID NO: l) or SKFTNNMLAIAG (SEQ ID NO:2)
- amino acid refers to natural or unnatural amino acids in their D and L stereoisomers for chiral amino acids. It is understood to refer to both amino acids and the corresponding amino acid residues, such as are present, for example, in peptidyl structure. Natural and unnatural amino acids are well known in the art.
- Common natural amino acids include, without limitation, alanine (Ala), arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamine (Gin), glutamic acid (Glu), glycine (Gly), histidine (His), isoleucine (He), leucine (Leu), Lysine (Lys), methionine (Met), phenylalanine (Phe), proline (Pro), serine (Ser), threonine (Thr), tryptophan (Trp), tyrosine (Tyr), and valine (Val).
- Uncommon and unnatural amino acids include, without limitation, allyl glycine (AllylGly), norleucine, norvaline, biphenylalanine (Bip), citrulline (Cit), 4- guanidinophenylalanine (Phe(Gu)), homoarginine (hArg), homolysine (hLys), 2- naphtylalanine (2-Nal), ornithine (Orn) and pentafluorophenylalanine.
- Amino acids are typically classified in one or more categories, including polar, hydrophobic, acidic, basic and aromatic, according to their side chains.
- polar amino acids include those having side chain functional groups such as hydroxyl, sulfhydryl, and amide, as well as the acidic and basic amino acids.
- Polar amino acids include, without limitation, asparagine, cysteine, glutamine, histidine, selenocysteine, serine, threonine, tryptophan and tyrosine.
- hydrophobic or non-polar amino acids include those residues having nonpolar aliphatic side chains, such as, without limitation, leucine, isoleucine, valine, glycine, alanine, proline, methionine and phenylalanine.
- basic amino acid residues include those having a basic side chain, such as an amino or guanidino group.
- Basic amino acid residues include, without limitation, arginine, homolysine and lysine.
- acidic amino acid residues include those having an acidic side chain functional group, such as a carboxy group.
- Acidic amino acid residues include, without limitation aspartic acid and glutamic acid.
- Aromatic amino acids include those having an aromatic side chain group.
- aromatic amino acids include, without limitation, biphenylalanine, histidine, 2- napthylalananine, pentafluorophenylalanine, phenylalanine, tryptophan and tyrosine. It is noted that some amino acids are classified in more than one group, for example, histidine, tryptophan and tyrosine are classified as both polar and aromatic amino acids. Amino acids may further be classified as non-charged, or charged (positively or negatively) amino acids. Examples of positively charged amino acids include without limitation lysine, arginine and histidine. Examples of negatively charged amino acids include without limitation glutamic acid and aspartic acid. Additional amino acids that are classified in each of the above groups are known to those of ordinary skill in the art.
- an isolated peptide according to the invention has the capacity (i) to inhibit the interaction between CBPl or CBP2 of Plasmodium Falciparum with CX3CL1; and/or (ii) to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells and/or CX3CL1.
- iRBC infected red blood cells
- the skilled in the art can easily determine whether isolated peptide is biologically active.
- the capacity to inhibit the interaction between CBPl or CBP2 protein of Plasmodium Falciparum with CX3CL1 can for example be determined by any routine test well known by the man skills in the art : Bimolecular fluorescence complementation (BiFC), affinity electrophoresis, label transfer, yeast two-hybrid, phage display, co- immunoprecipitation, microcalorimetry, Surface Plasmon Resonance, binding assay with radioactive ligand.
- BiFC Bimolecular fluorescence complementation
- affinity electrophoresis affinity electrophoresis
- label transfer label transfer
- yeast two-hybrid yeast two-hybrid
- phage display co- immunoprecipitation
- microcalorimetry Surface Plasmon Resonance
- binding assay with radioactive ligand binding assay with radioactive ligand.
- the capacity to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells and/or CX3CL1 can for example be determined by using Static Adherence assay and or/ Flow adherence assay (e.g. as described in Example + Figures 1 and 2).
- a "biologically active" fragment refers to a fragment exhibiting at least one, preferably all, of the biological activities of a peptide of SEQ ID NO: l or SEQ ID NO:2, provided the biologically active fragment retains the capacity of inhibiting cytoadherence of infected red blood cells (iRBC) to endothelial cells.
- the biologically active fragment may for example be characterized in that it is capable of inhibiting the interaction between CBPl or CBP2 protein of Plasmodium Falciparum with CX3CL1 and/or inhibiting the cytoadherence of infected red blood cells (iRBC) to endothelial cells and/or CX3CL1 (see Example and Figures 3b, c).
- a peptide "substantially homologous" to a reference peptide may derive from the reference sequence by one or more conservative substitutions.
- Two amino acid sequences are "substantially homologous” or “substantially similar” when one or more amino acid residue are replaced by a biologically similar residue or when greater than 80 % of the amino acids are identical, or greater than about 90 %, preferably greater than about 95%, are similar (functionally identical).
- the similar, identical or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program, or any of the programs known in the art (BLAST, FASTA, etc.).
- the percentage of identity may be calculated by performing a pairwise global alignment based on the Needleman-Wunsch alignment algorithm to find the optimum alignment (including gaps) of two sequences along their entire length, for instance using Needle, and using the BLOSUM62 matrix with a gap opening penalty of 10 and a gap extension penalty of 0.5.
- conservative substitution denotes the replacement of an amino acid residue by another, without altering the overall conformation and function of the peptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, shape, hydrophobic, aromatic, and the like).
- Amino acids with similar properties are well known in the art. For example, arginine, histidine and lysine are hydrophilic-basic amino acids and may be interchangeable. Similarly, isoleucine, a hydrophobic amino acid, may be replaced with leucine, methionine or valine.
- Neutral hydrophilic amino acids, which can be substituted for one another, include asparagine, glutamine, serine and threonine.
- substituted or “modified” the present invention includes those amino acids that have been altered or modified from naturally occurring amino acids.
- a first amino acid sequence having at least 80% of identity with a second amino acid sequence means that the first sequence has 80; 81; 82; 83; 84; 85; 86; 87; 88; 89; 90; 91; 92; 93; 94; 95; 96; 97; 98; or 99% of identity with the second amino acid sequence.
- Amino acid sequence identity is preferably determined using a suitable sequence alignment algorithm and default parameters, such as BLAST P (Karlin and Altschul, 1990).
- the isolated peptide of the invention comprises at most 100 aminoacid (and at least 9).
- the polypeptide of the invention comprises 100; 99; 98; 97; 96; 95; 94; 93; 92; 91; 90; 89; 88; 87; 86; 85; 84; 83; 82; 81; 80; 79; 78; 77; 76; 75; 74; 73; 72; 71; 70; 69; 68; 67; 66; 65; 64; 63; 62; 61; 60; 59; 58; 57; 56; 55; 54; 53; 52; 51; 50; 49; 48; 47; 46; 45; 44; 43; 42; 41; 40; 39; 38; 37; 36; 35; 34; 33; 32; 31; 30; 29; 28; 27; 26; 25; 24; 23; 22; 21; 20; 19; 18; 17; 16; 15; 14; 13; 12; 11; 10 or 9 amino
- the polypeptide of the invention comprises less than 50 amino acids. In some embodiments, the polypeptide of the invention comprises less than 30 amino acids. In some embodiments, the polypeptide of the invention comprises less than 25 amino acids. In some embodiments, the polypeptide of the invention comprises less than 20 amino acids. In some embodiments, the polypeptide of the invention comprises less than 15 amino acids.
- N- and C-termini of the peptides described herein may be protected against proteolysis.
- the N-terminus may be in the form of an acetyl group, and/or the C- terminus may be in the form of an amide group.
- Internal modifications of the peptides to be resistant to proteolysis are also envisioned, e.g.
- the peptides described herein may also be protected against proteolysis by the technique of stapled peptides as described by Walensky et al. (Science. 2004, 305, 1466-70).
- peptides are covalently bound to a polyethylene glycol (PEG) molecule by their C- terminus or a lysine residue, notably a PEG of 1500 or 4000 MW, for a decrease in urinary clearance and in therapeutic doses used and for an increase of the half-life in blood plasma.
- PEG polyethylene glycol
- peptide half-life is increased by including the peptide in a biodegradable and biocompatible polymer material for drug delivery system forming microspheres.
- Polymers and copolymers are, for instance, poly (D, L-lactide-co-glycol ide) (PLGA) (as illustrated in US2007/0184015, SoonKap Hahn et al).
- the isolated peptides according to the invention may be produced using any method known in the art. They may for example be produced as recombinant peptides in a host cell (e.g. in a bacterial, yeast or eukaryotic host cell), or chemically synthesized (see for review Kent S.B.H. Chem. Soc. Rev., 2009,38, 338-351 and Bradley L. et al Annu Rev Biophys Biomol Struct. 2005; 34: 91-118 or R. B. Merrifield (1969). "Solid-phase peptide synthesis.” Advances in enzymology and related areas of molecular biology 32: 221-96.; R. B. Merrifield (1969).
- isolated peptides of the invention can be conformationally constrained to enable the peptides to bind to CX3CL1 with a better affinity.
- Cyclisation is well known in the art and generally involves the introduction of a disulfide bound between two cysteine residues.
- the cycle is formed through a side chain to side chain ring involving a monosulfide or disulfide bridge between pairs of cysteines, penicillamines, homocysteines, combinations of the foregoing, or other pairs of amino acids in which the side chains are linked with either one or two sulfur atoms.
- Methods for the synthesis of disulfide cyclic polypeptide are well known in the art and are described for example in US3,929,758, US4,216,141; and US4,102,877.
- Polypeptides of the invention may thus comprise cysteine residues at terminal ends to allow the cyclisation of the polypeptide.
- isolated peptides of the invention may comprise an amino acid sequence of formula II consisting of: Cysteine-PepXl -Xaal -Xaa2-Xaa3-Threonine-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-
- Xaal is serine (S) or absent
- Xaa2 is lysine (K), or absent;
- Xaa3 is Phenylalanine (F) or serine (S);
- Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid
- Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
- Xaa6 is methionine (M) or leucine (L);
- Xaa7 is leucine (L) or lysine (K);
- Xaa8 is alanine (A), asparagine (N) or aspartic acid (D);
- Xaa9 is isoleucine (I) or glutamic acid (E);
- XaalO is alanine (A), asparagine (N) or aspartic acid (D).
- Xaal 1 is Glycine (G) or absent;
- the isolated peptide of the invention comprises an amino acid sequence consisting of CSTLNLKNENC (SEQ ID NO: 11) and CSKFTNNMLAIAGC (SEQ ID NO: 12)
- the polypeptides as above described are cyclised via a disulfide bound between the two cysteine residues of the polypeptides.
- cyclic peptide of the invention may comprise an amino acid sequence having the formula (III):
- Xaal is serine (S) or absent
- Xaa2 is lysine (K), or absent;
- Xaa3 is Phenylalanine (F) or serine (S);
- Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid
- Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
- Xaa6 is methionine (M) or leucine (L);
- Xaa7 is leucine (L) or lysine (K);
- Xaa8 is alanine (A), asparagine (N) or aspartic acid (D).
- Xaa9 is isoleucine (I) or glutamic acid (E);
- XaalO is alanine (A), asparagine (N) or aspartic acid (D).
- Xaal 1 is Glycine (G) or absent;
- PepXl and “PepX2” each consists of, one independently from the other, a spacer polypeptide having an amino acid length varying from 0 to 10 amino acid residues,
- the cyclic polypeptide comprises an amino acid sequence consisting of:
- Cyclisation can also be performed by peptide bonds between the amino-terminal of the first amino acid and the carboxy-terminal of the last amino acid.
- cyclization is contemplated by the invention.
- those methods include but are not limited by those described by Marlowe (1993, Biorg. Med. Chem. Lett. 3:437-44) who describes peptide cyclization on TFA resin using trimethylsilyl (TMSE) ester as an orthogonal protecting group; Pallin and Tarn (1995, J. Chem. Soc. Chem. Comm. 2021-2022) who describe the cyclization of unprotected peptides in aqueous solution by oxime formation; Algin et al (1994, Tetrahedron Lett.
- TMSE trimethylsilyl
- the inventors have generated specific antibodies directed against a peptide derived from the CBP1 and CBP2 protein (CBP1-EC and CBP2-EC), i.e. the isolated peptide of formula (I).
- the anti-CBPl and anti-CBP2 polyclonal antibodies were performed by immunizing rabbit with two synthetic peptides, LSTLNLKNEN (SEQ ID NO:7) and AATSKFTNNMLAIAGVG (SEQ ID NO: 8) respectively. More precisely, the inventors have found that antibodies screened for their capacity to recognize specifically the isolated peptide of the invention (example 2 and figure 5 A) and to stain iRBC samples from a Malaria patient. It has also been found that an antibody directed against an isolated peptide of formula (I) above, inhibits iRBC binding to CX3CL1 (example 2 and figure 6A).
- the invention provides an antibody that specifically binds to an isolated peptide of formula I.
- the invention further provides an antibody that specifically binds to an isolated peptide comprising or consisting:
- These antibodies can recognize an epitope located within, or comprising at least one amino acid located within, the fragment comprising or consisting of any one of isolated peptide (i) to (vii).
- said epitope is located within the fragment comprising or consisting of any one of isolated peptide (i) to (vii).
- said epitope is located within the fragment comprising or consisting of any one of (i) to (vii).
- Such antibodies are characterized in that they specifically bind to CBPl-EC and CBP2-EC
- These antibodies can advantageously be used when selecting a patient to be treated by a peptide comprising CBP1-EC and CBP2-EC or a biologically active fragment thereof, e.g. using the method described hereabove.
- antibodies can be polyclonal or monoclonal.
- the antibodies can for example correspond to chimeric, humanized or fully human antibodies.
- Methods for obtaining such antibodies are well known in the art.
- polyclonal antibodies according to the invention can be obtained through immunization of a non-human mammal with said fragment comprising or consisting of any one of (i) to (vii). Starting from the polyclonal antibodies, one can then obtain monoclonal antibodies using standard methods.
- This invention is also directed to the use of an antibody directed against an isolated peptide of formula (I) for manufacturing a pharmaceutical composition for treating malaria disease linked to the infection of an individual with plasmodium falciparum Pharmaceutical compositions
- the invention further relates to a pharmaceutical composition
- a pharmaceutical composition comprising a peptide of the invention, a cyclic peptide of the invention, or antibody of the invention together with a pharmaceutically acceptable carrier.
- the invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising an isolated peptide of the invention or an antibody of the invention, together with a pharmaceutically acceptable carrier.
- the peptide or antibody is formulated in association with a pharmaceutically acceptable carrier.
- compositions, carriers, diluents and reagents are used interchangeably and represent that the materials are capable of administration to or upon a mammal without the production of undesirable physiological effects such as nausea, dizziness, gastric upset and the like.
- compositions that contains active ingredients dissolved or dispersed therein are well understood in the art and need not be limited based on formulation.
- compositions are prepared as injectables either as liquid solutions or suspensions; however, solid forms suitable for solution, or suspensions, in liquid prior to use can also be prepared.
- the preparation can also be emulsified.
- the pharmaceutical compositions may be formulated in solid dosage form, for example capsules, tablets, pills, powders, dragees or granules.
- excipients such as lactose, sodium citrate, calcium carbonate, dicalcium phosphate and disintegrating agents such as starch, alginic acids and certain complex silicates combined with lubricants such as magnesium stearate, sodium lauryl sulphate and talc may be used for preparing tablets.
- lactose and high molecular weight polyethylene glycols When aqueous suspensions are used they can contain emulsifying agents or agents which facilitate suspension.
- Diluents such as sucrose, ethanol, polyethylene glycol, propylene glycol, glycerol and chloroform or mixtures thereof may also be used.
- Total daily dose of a peptide administered to a subject in single or divided doses may be in amounts, for example, of from about 0.001 to about 100 mg/kg body weight daily and preferably 0.01 to 10 mg/kg/day.
- Dosage unit compositions may contain such amounts of such submultiples thereof as may be used to make up the daily dose. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the body weight, general health, sex, diet, time and route of administration, rates of absorption and excretion, combination with other drugs and the severity of the particular disease being treated.
- Another object of the invention is a vaccine composition
- a vaccine composition comprising an isolated peptide of formula (I) or a cyclic peptide of formula (III) and an immunoadjuvant compound.
- vaccine composition it is herein intended a substance which is able to induce an immune response in an individual, and for example to induce the production of antibodies directed against the isolated peptide of formula (I).
- a vaccine is defined herein as a biological agent which is capable of providing a protective response in an animal to which the vaccine has been delivered and is incapable of causing severe disease.
- the vaccine stimulates antibody production or cellular immunity against the pathogen causing the disease; administration of the vaccine thus results in immunity from the disease.
- said immunoadjuvant compound is selected in the group consisting of Freund complete adjuvant, Freund incomplete adjuvant, aluminium hydroxide, and calcium phosphate.
- the peptide of formula (I) or (III) can comprise from 2 to 12 peptides of formula (I) or (III), for instance "STLNLKNEN” (SEQ ID NO: l) or SKFTNNMLAIAG (SEQ ID NO:2). or CSTLNLKNENC (SEQ ID NO: 13) and CSKFTNNMLAIAGC(SEQ ID NO: 14)
- said antigenic polypeptide can have the following formula (IV) :
- PepNt consists of a polypeptide having an amino acid length varying from 0 to 100 amino acid residues and located at the N-terminal end of the polypeptide of formula (IV);
- - "(1)1" to - "(I)n” each consists of, one independently from each other, a peptide of formula (I) and/or (III) " with n being an integer from 1 to 12;
- PepXl to "PepXn” each consists of, one independently from the other, a spacer polypeptide having an amino acid length varying from 0 to 30 amino acid residues, with n being an integer from 1 to 12;
- n is the number of [(I)n-PepXn] polypeptide units in said polypeptide, with n being an integer from 1 to 12;
- PepCt consists of a polypeptide having an amino acid length varying from 0 to 100 amino acid residues and located at the C-terminal end of the polypeptide of formula (IV).
- peptide (1)1 to (I)n of formula (I) or (III) are selected between the group of "STLNLKNEN” (SEQ ID NO: l) and/or "SKFTNNMLAIAG” ( SEQ ID NO:2) and/or CSTLNLKNENC (SEQ ID NO: 13) and jCSKFTNNMLAIAGC(SEQ ID NO:
- said antigenic isolated peptide can have the following formula (I) (III) or
- said antigenic isolated peptide comprising or consisting:
- amino acids sequence consisting of STLALKAEA SEQ ID NO:3
- amino acids sequence consisting of STLDLKDED SEQ ID NO:4
- amino acids sequence consisting of SKFTAAMLAIAG SEQ ID NO:5;
- amino acids sequence consisting of CSTLNLKNENC SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC
- Said antigenic peptide can be covalently linked through an amino acid residue to a carrier protein or a synthetic polymer.
- the peptide of formula (I) can be covalently linked (“conjugated") to a larger molecule which serves as a carrier.
- Attachment of the peptide to the carrier can be by one of several methods, including linking through a peptide Lys using glutaraldehyde (Reichlin, Methods Enzymol. 70: 159- 165, 1980) or DCC procedures (for example, Atassi et al, Biochem. Biophys. Acta 670: 300- 302, 1981), through a Peptide Asp or Glu using DCC (Bauminger et al, Methods Enzymol 70: 151-159, 1980), through a peptide Tyr using bis-diazotized benzidine (Walter et al, Proc. Nat. Acad. Sci.
- Peptide carrier conjugates can be separated from excess free peptide by dialysis or gel filtration.
- the level of loading of the peptide on the carrier can be determined either using a radioactive tracer to establish the loading level in a particular procedure, or by quantitative amino acid analysis of the conjugate, in comparison with the unloaded carrier. It is convenient, when using the latter technique, to incorporate a unique non-natural amino acid into the peptide, at the N-terminal or C-terminal side, such as Nle, which can then serve as a quantitative marker for peptide incorporation, as measured by amino acid analysis of the conjugate.
- This Nle can also function as a spacer between the antigenic site and any amino acid incorporated to facilitate attachment, such as Cys, Lys, or Tyr, as described above.
- said carrier protein is selected from the group consisting of keyhole limpet hemocyanin (KLH), bovine serum albumin, or diphtheria toxoid.
- KLH keyhole limpet hemocyanin
- bovine serum albumin bovine serum albumin
- diphtheria toxoid diphtheria toxoid.
- said synthetic polymer can be a multiple branch peptide construction comprising a core matrix comprised of lysine residues.
- the core matrix is preferably a dendritic polymer which is branched in nature, preferably with each of the branches thereof being identical.
- the core matrix is based on a core molecule which has at least two functional groups to which molecular branches having terminal functional groups are covalently bonded.
- Exemplary for use to form the core matrix is lysine.
- a central lysine residue is bonded to two lysine residues, each through its carboxyl group, to one of the amino groups of the central lysine residue.
- This provides a molecule with four amino groups, which may be a core matrix for a structure comprising four peptides of formula (I).
- the manufacture of the above structures is known in the art. See, e.g., Tarn et al., J. Immun. 148, 914-920 (1992) and Wang et al, Science, 254, 285-288 (1991).
- a peptide linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures.
- Such a peptide linker sequence is incorporated into the fusion protein using standard techniques well known in the art. Suitable peptide linker sequences may be chosen based on the following factors: (1) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes.
- Preferred peptide linker sequences contain Gly, Asn and Ser residues. Other near neutral amino acids, such as Thr and Ala may also be used in the linker sequence.
- Amino acid sequences which may be usefully employed as linkers include those disclosed in Maratea et al, Gene 40:39-46, 1985; Murphy et al, Proc. Natl. Acad. Sci. USA 83:8258-8262, 1986; U.S. Pat. No. 4,935,233 and U.S. Pat. No. 4,751,180.
- the linker sequence may generally be from 1 to about 50 amino acids in length. Linker sequences are not required when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
- the invention concerns also a vaccine composition
- a vaccine composition comprising a peptide comprising the amino acid sequence STLNLKNEN (SEQ ID NO: 1) or SKFTNNMLAIAG (SEQ ID NO:2), and/or CSTLNLKNENC (SEQ ID NO: 13) and CSKFTNNMLAIAGC(SEQ ID NO: 14).
- said peptide being covalently linked through an amino acid residue to a carrier protein or to a synthetic polymer.
- said carrier protein is selected from the group consisting of keyhole limpet hemocyanin (KLH), bovine serum albumin, or diphtheria toxoid.
- KLH keyhole limpet hemocyanin
- bovine serum albumin bovine serum albumin
- diphtheria toxoid diphtheria toxoid.
- the synthetic polymer can be a multiple branch peptide construction comprising a core matrix comprised of lysine residues. Spacers between said polypeptide and said carrier protein or synthetic polymer can be introduced.
- the vaccine composition cited immediately above there are spacers between said polypeptide and said carrier protein or synthetic polymer.
- the isolated peptide as defined above, the antibody of the invention, the pharmaceutical and vaccine composition of the invention may be used for treating Malaria Disease.
- the invention thus also relates to a peptide, or an antibody of the invention for use for treating Malaria Disease.
- Malaria is a mosquito-borne infectious disease of humans and other animals caused by parasitic protozoans (a group of single-celled microorganism) belonging to the genus Plasmodium.[l] Malaria causes symptoms that typically include fever, fatigue, vomiting and headaches. In severe cases it can cause yellow skin, seizures, coma or death [Caraballo H (2014). Emergency Medicine Practice 16 (5)]. The disease is transmitted by the biting of mosquitos, and the symptoms usually begin ten to fifteen days after being bitten. In those who have not been appropriately treated disease may recur months later[l]. Clinical manifestations of severe malaria result from a combination of high parasite burdens and sequestration of mature P.
- iRBCs falciparum- fectGd red blood cells
- cytoadherence Bignami & Bastiannelli, 1890. Cytoadherence of iRBC causes obstruction of blood flow in small brain blood vessels - thereby contributing to cerebral malaria - and in the villous chamber of the placenta, leading to pregnancy-associated malaria (Brabin et al, 2004).
- Sequestration of iRBC causes microvascular obstruction, leads to metabolic disturbances (Planche et al, 2005; Zougbede et al, 2010), and allows iRBC to escape splenic clearance, which is a selective advantage for the microorganism (Buffet et al, 2009; Mebius & Kraal, 2005).
- the isolated peptide, or the antibody of the invention may have the ability to decrease the parasite load in a subject of at least 40%, 50%, 60%, 70%, 80%, 90% or 100%.
- the invention also provides a method of treatment of a Malaria disease in a patient in need thereof, which method comprises administering said patient with an isolated peptide, or antibody of the invention.
- patient refers to a human or non-human mammal, preferably a mouse, cat, dog, monkey, horse, cattle (i.e. cow, sheep, goat, buffalo), including male, female, adults and children.
- cattle i.e. cow, sheep, goat, buffalo
- treatment includes curative and/or prophylactic treatment. More particularly, curative treatment refers to any of the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a symptom, as well as delay in progression of a symptom of a particular disorder.
- Prophylactic treatment refers to any of: halting the onset, reducing the risk of development, reducing the incidence, delaying the onset, reducing the development, as well as increasing the time to onset of symptoms of a particular disorder.
- CX3CL1 and its receptor CX3CR1 play a major role in numerous inflammatory processes.
- the CX3CR1/CX3CL1 axis is known to contribute to the recruitment of monocytes to inflammatory sites [Fong AM et al 1998, Auffray C et al 2009, Poupel L et al 2013] to sequester monocytes in the bone marrow (BM) [Jacquelin S et al 2013] and to induce macrophage survival [Kim K-W et al 2011].
- the CBP1-EC and CBP1-EC peptides correspond to the external domain of the two invariant parasite ligands of CX3CL1, were assayed as "neutraligands", i.e. molecules binding the ligand CX3CL1 to inhibit its binding to its receptor CX3CR1.
- the present invention relates to a isolated peptide of the invention or an cyclic peptide of invention for use in the treatment of an inflammatory disease.
- inflammatory disease or "inflammatory disorder” relates to a complex reaction of vascularized tissue to infection, toxin exposure, or cell injury that involves extravascular accumulation of plasma proteins and leukocytes (Abbas et al., Cellular and Molecular Immunology, 7th edition, 2011).
- Inflammatory diseases can be divided into to two groups: acute inflammatory diseases and chronic inflammatory diseases.
- Acute inflammatory diseases it is herein referred to a common result of innate immune responses, and local adaptive immune responses. Acute inflammation is the initial response of the body to harmful stimuli and is achieved by the increased movement of plasma and leukocytes from the blood into the injured tissues. Although inflammation serves a protective function in controlling infections and promoting tissue repair, it can also cause tissue damage and disease (Abbas et al, Cellular and Molecular Immunology, 7th edition, 2011).
- SIRS Systemic Inflammatory Response Syndrome
- sepsis sepsis
- peritonitis reperfusion injury
- pancreatitis pancreatitis
- nephritis myocarditis
- encephalitis myocarditis
- pelvic inflammatory disease vasculitis, uveitis, keratitis and acne vulgaris.
- chronic inflammatory diseases it is herein referred to prolonged inflammation that leads to a progressive shift in the type of cells present at the site of inflammation and is characterized by simultaneous destruction and healing of the tissue from the inflammatory process.
- chronic inflammatory diseases are Inflammatory Bowel Diseases (IBD) as Crohn's disease and ulcerative colitis, celiac disease, chronic bronchitis, chronic obstructive pulmonary disease, chronic prostatitis, gastritis, atherosclerosis, rheumatoid arthritis, obesity, allergies, asthma, psoriasis, dermatitis, eczema.
- the inflammatory disease is acute inflammatory disease.
- the acute inflammatory disease is selected between Systemic Inflammatory Response Syndrome (SIRS), sepsis, peritonitis.
- SIRS Systemic Inflammatory Response Syndrome
- sepsis sepsis
- peritonitis CX3CL1 associated disease
- the CX3CL1/CX3CR1 pathway has been shown to be involved in the development of autoimmune diseases such as multiple sclerosis (Huang et al. 2006, Faseb J 20(7): 896-905), rheumatoid arthritis (Sawai et al. 20 2007 Arthritis Rheum 56(1 0): 3215-25), lupus erythematosus (lnoue et al. 2005, Arthritis Rheum 52(5): 1522-33), cardiovascular diseases (Moatti et al. 2001, Blood 97(7): 1925-8; Combadiere et al. 2003, Circulation 107(7): 1009- 16; Lesnik et al.
- autoimmune diseases such as multiple sclerosis (Huang et al. 2006, Faseb J 20(7): 896-905), rheumatoid arthritis (Sawai et al. 20 2007 Arthritis Rheum 56(1 0): 3215-25), lup
- the invention is directed to a peptide according to the invention for use as a medicament, more specifically for use for the treatment or the prevention of any disease described herein.
- a preferred aspect of the invention is directed to:
- a method for treating or preventing a disease selected from the group consisting of an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, a graft versus host disease, a behavioral disorder, a cicatrisation disorder, a viral infection, cancer and pain comprising the step of administering an effective amount of an isolated peptide according to the invention to an individual in need thereof; and/or
- a disease selected from the group consisting of an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, a graft versus host disease, a behavioural disorder, a cicatrisation disorder, a viral infection, cancer and pain.
- a disease selected from the group consisting of an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, a graft versus host disease, a behavioural disorder, a cicatrisation disorder, a viral infection, cancer and pain.
- the present invention is devoted to the generation of novel therapeutic compounds and drugs with increased efficacy and specificity for the treatment of mental or neurological diseases, or pathologies of the immune system, infectious diseases or cancer. These modulators could also be used as drugs for the treatment of pathological states for which specific therapeutic agents are now lacking. Published studies using a macaque model have already emphasized the potential of chemokine variants in topical drugs (Lederman, 2004, Science, 306, 485-487.).
- an effective amount is meant an amount sufficient to achieve a concentration of peptide which is capable of preventing, treating or slowing down the disease to be treated. Such concentrations can be routinely determined by those of skilled in the art.
- the amount of the compound actually administered will typically be determined by a physician, in the light of the relevant circumstances, including the condition to be treated, the chosen route of administration, the actual compound administered, the age, weight, and response of the individual patient, the severity of the patient's symptoms, and the like. It will also be appreciated by those of stalled in the art that the dosage may be dependent on the stability of the administered peptide.
- said disease is selected from the group consisting of an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, cancer and a graft versus host disease.
- Autoimmune disorders include, e.g., multiple sclerosis, rheumatoid arthritis, lupus erythematosus, inflammatory bowel disease and ulcerative colitis.
- Cardiovascular diseases include, e.g., atherosclerosis, thrombosis, atherothrombosis and heart failure.
- Cancer include, e.g., breast cancer, colon cancer, prostate metastasis dissemination, and lymphoma.
- the neurodegenerative disease may for example correspond to Parkinson's disease.
- FIGURES
- Figure 7 Static adherence of 3D7-iRBC on the CX3CL1 chemokine in the presence of CBP-EC peptides and of their variants.
- FIG. 8 LPS preclinical model. Seql or Rd-Seql peptides (100 ⁇ g) are injected just before intraperiteoneal injection of LPS in WT animals (grey bars). Only LPS is injected in CX3CR1-/- animals (black bar) and only PBS is injected in control animals (left bar). Bars represent mean ⁇ SD of data collected in three animals
- Migration assays were performed in 24-transwell inserts (Corning Costar, Avon, France) with 8 ⁇ polycarbonate filter. Cells were resuspended in chemotaxis buffer (DMEM containing 0.5% BSA and 10 nM HEPES) in presence or not of 0.5 ⁇ CBP-EC peptides located in the top chamber. The bottom of each well was filled with 600 ⁇ pre-warmed chemotaxis buffer at indicated chemokine concentration. The plates were then incubated for 4 hours at 37°C in a 5% CO2 atmosphere.
- DMEM containing 0.5% BSA and 10 nM HEPES
- Results are expressed as a number of cells migrating in the presence of chemoattractant or peptide minus the number of cells migrating in presence of buffer only. Experiments were run in triplicate, and results are representative of at least three independent experiments.
- Chemokine CCL2 are from Peprotech (Levallois-Perret, France) and chemokine domain of CX3CL1 from R&D Systems (Lille, France).
- the peptides CBP1-EC or Seql STLNLKNEN (SEQ ID NO: l) and CBP2-EC or Seq2 (SKFTNNMLAIAG (SEQ ID NO:2)) as well as the random peptides CBPl-EC-rd or Seql-rd (NLETNSKNL (SEQ ID NO: 15)) and CBP2-EC-rd or Seq2-rd (MATGSAKNLFNI (SEQ ID NO: 16)) were synthetised in the Institut Biologie Paris Seine (UPMC).
- Anti-CX3CR1 polyclonal antibody (pAb 14-6093) was purchased from eBioscience (SAS, Paris, France). Anti-DARC antibody was a generous gift from O. Bertrand (Inserm U-1134). The anti-CBPl and anti-CBP2 polyclonal antibodies were performed at Proteogenix (Schiltigheim, France) by immunizing rabbit with two synthetic peptides, LSTLNLKNEN (SEQ ID N:7) and AATSKFTNNMLAIAGVG (SEQ ID N: 8) respectively.
- Plasmodium falciparum 3D7 cloned strain was cultured in human erythrocytes as described previously (Trager & Jensen, 1976). Enrichment of late-stage infected erythrocytes (parasitaemia greater than 80 %) was obtained by gelatin flotation (Plasmion, Fresenius Kabi, France) according to already published protocol (Pasvol et al, 1978).
- CBP CX3CL1-Binding Protein
- Membranes from RBCs and iRBCs were prepared by hypotonic lysis (Steck & Kant, 1974) by incubation in 5P8 buffer (5 mM NaH2P04/Na2HP04, 0.35 mM EDTA, pH 8) and centrifuged 5 min at 4000 xg at 4°C to remove parasite pellet. The supernatant containing RBC ghost was centrifuged 15 min at 25,000 xg at 4°C. Then the pellet was washed in 5P8 buffer by centrifugation several times until the ghost pellet became white.
- LC-MS/MS Liquid Chromatography - Mass Spectrometry analysis were performed on an Ultimate 3000 Nano HPLC instrument (Thermo Fisher Scientific, Courtaboeuf, France) coupled to an Esquire HCTultra ion trap mass spectrometer (Bruker Daltonics, Mame-la-Vallee, France).
- the CBP-DNAs were synthetized by the GeneArt Plasmid Services (Life
- CX3CL1 peptide signal and codons optimization for human cells were cloned in pMA gene art vector between Sacl and KpNI restriction sites. These constructs were digested with Hindlll and BamHI and the Hindlll/BamHI fragments were then cloned in pEYFP-NI (Clontech, Ozyme, France). CBP-pEYFP constructs were trans fected into HEK293 using the cationic polymer transfection reagent jetPEI (Polyp lus transfection, Illkirch, France). Stable transformants resistant to 1 mg/ml G418 (Life Technologies) were selected with Facs Ariall Cell Sorter (Becton-Dickinson, le Pont de Claix, France).
- CX3CL1 or CCL2 were adsorbed overnight at 4°C on flat-bottom 96-well microtiter plates (Nunc A/S, Roskilde, Denmark) at the indicated concentrations (50 ⁇ /well) diluted in 25 mM Tris pH 8 and 150 mM NaCl. Well surfaces were blocked for 2 h at room temperature (RT) with 1 % nonfat milk in the same buffer. Enriched iRBCs were suspended at 5x106 ml-1 in HBSS supplemented with 1 mM CaCk, 1 mM MgCk and 10 mM Hepes (pH 6.8).
- the CBPs-HEK293 transfectants to be tested were first labelled with 1 mM 5(6) carboxyf uorescein diacetate succinimidyl ester (Interchim, Montlucon, France). Before addition, enriched iRBCs and CBPs-HEK293 transfectants were treated or not for 15 min at RT with 500 nM CX3CL1 or CCL2, or with 0.5 ⁇ of the different Abs. Alternatively, the wells with the immobilized CX3CL1 chemokine were incubated with peptides CBPl-EC and CBP2-EC as well as CBPl-ECrd and CBP2-ECrd at 0.1 ⁇ .
- the cells (1.5xl0 6 iRBCs or 10 4 HEK293 cells per well) were then added and incubated 1 h at 37°C and exactly quantified by measurements of nine different fields per well at 415 nm for iRBCs and 530 nm for HEK293 cells (Flexstation 3, Molecular Devices, Sunnyvale, USA). After washing to remove the non-adherent cells as described as previously (Hermand et al, 2000), the number of adherent cells was calculated as a ratio to the total number of cells loaded in each well, determined by the a new absorbance/fluorescence evaluation and expressed as number of adherent cells per mm 2 , knowing that the well surface is 0.32 mm 2 .
- the number of adherent cells was expressed as % of the control, i.e. the number of adherent iRBC on coated CX3CL1 (50 pmoles/well).
- CX3CL1-L929 trans fectant and parental cells (104 cells in 20 ⁇ DMEM containing 10% FCS) were platted in IbiTreat - ⁇ -SlideVI (Ibidi Biovalley, Marne La Vallee, France).
- the slide was set on the stage of an inverted microscope (TE300, Nikon, Champigny, France) equipped with a phase contrast 10x objective (Nikon, n.a. 0.25) and a cooled CCD camera (Sensicam, PCO, Kelheim, Germany).
- iRBC (parasitemia superior to 80 %) were resuspended in flow buffer HBSS (GE Healthcare Europe, Velizy- Villacoublay, France) supplemented with 1 mM CaCk, 1 mM MgCk (pH 6.8) at 5xl0 6 mL _1 and incubated 15 min at 37°C in the presence or not or 0,5 ⁇ CX3CL1 or CCL2.
- a syringe pump (PHD 2000; Harvard Apparatus, Les Ulis, France) drove 0.5 ml of iRBC suspension through the IbiTreat slide at a wall shear stress of 0.27 dynes. cm -2 . The 37°C temperature was controlled all over the experiment. After a 10-min wash at 0.27 dynes. cm 2 , images of fifteen 0.57 mm 2 separate fields were recorded to count the adherent cells. The results were expressed as mean ⁇ SD per mm 2 .
- the rabbit sera diluted were adsorbed on fresh normal human 0+ red blood cells.
- unfixed iRBCs were used in liquid phase Pellets (5 ⁇ ) of cultured iRBC were incubated for 45 min at RT with 100 ⁇ of serum diluted 5 times in PBS supplemented with 2 % BSA and 100 ⁇ g/ml Hoechst reagent. After washing with PBS supplemented with 2 % BSA, antibodies were detected with Alexafluor 488 conjugated goat anti-rabbit IgG (Life Technologies). Immunofluorescence staining was analyzed with a direct microscope (BX51, Olympus, Rungis, France).
- Fluorescence imaging of the HEK293 clones expressing the CBP candidates as EYFP chimera was performed on Lab-Tek II slides (Nunc, Dutscher) after fixation (PFA 4%, 30 min 4°C) using an Olympus IX81-ZDC2 inverted microscope equipped for Total Internal Reflection fluorescence (TIRF). Digital images were captured on a cooled charge-coupled device (CCD) camera (ORCA-ER, Hamamatsu, Massy, France).
- CCD charge-coupled device
- PF3D7 0113900 and PF3D7 1301700 are herein referred to CBPl and CBP2.
- CBPl and CBP2 are unique, homologous, monogenic exported proteins with two transmembrane domains, and are expressed on the external surface of iRBC
- CBPl and CBP2 are monogenic proteins of 243 and 245 amino acids in length, respectively. They are encoded by single-copy genes and their sequences share 32% identity (Table 1, Figure 4), making them the only two members of the hypothetical family of Plasmodium exported protein called "hyp8" (PlasmoDB) (Freeh & Chen, 2013). Similar to all Pexel-containing genes, cbpl and cbp2 contain one intron flanked by two exons; there are no homologs in the 3D7 genome and no orthologs in genomes of other Plasmodium strains/species.
- Both CBPl and CBP2 have a signal peptide (hence their calculated molecular masses without signal peptide of 25320 Da and 25328 Da, respectively) and two short 9- and 12-amino acid extracellular domains. Their topology may be similar to STEVOR, RIFIN and PfMC-2TM, in that both N- and C-termini are intracellular (Lavazec et al, 2006).
- the cbpl gene has 49 singlenucleotide polymorphisms (SNP) and among them 41 are synonymous; cbp2 has 15 SNP among them 13 are synonymous.
- SNP singlenucleotide polymorphisms
- cbp2 has 15 SNP among them 13 are synonymous.
- the non- synonymous SNP of both genes exist outside the regions encoding for the transmembrane and extracellular domains.
- Anti-CBP antibodies and CBP-EC peptides inhibit iRBC binding to CX3CL1
- Anti-CBPl and anti-CBP2 antibodies inhibited the adherence of 3D7-iRBC to immobilized CX3CL1 by 33% and 38% respectively i.e. at a similar level to the anti- CX3CR1 antibody ( Figure 6A), while a control rabbit antibody did not have any effect on adherence.
- anti-CBP antibodies were incubated simultaneously, the inhibitory effect on adherence was not enhanced.
- incubating the anti-CX3CRl with either of the anti- CBP antibodies we did not observe any change in the inhibitory effect (Figure 6A).
- CBPs are coded by genes of the P. falciparum 3D7 reference strain and also in field isolates, as demonstrated by the detection of mRNA transcripts in all patient samples analyzed to date (data not shown).
- Anti-CBPl and anti-CBP2 antibodies stained the surface of iRBC from a patient as well as 3D7-iRBC ( Figures 5B and 5C), suggesting that both CBPl and CBP2 are expressed at the surface of iRBC.
- both proteins have been shown to be putatively exported protein in early gametocyte proteome (Silvestrini et al, 2010), are hence named GEXP10 and GEXP07 (Table 1) and could contribute to the gametocyte sequestration.
- immature gametocytes accumulate in the extravascular spaces of the human bone marrow (Farfour et al, 2012; Joice et al, 2014; Sinton et al, 1926) and it is known that CX3CL1 is well expressed in bone marrow stromal cells (Honczarenko et al, 2006), where it contributes to the retention of monocytes (Jacquelin et al, 2013). So CX3CL1 could arguably contribute to the gametocyte accumulation in specific body sites, including bone marrow.
- CX3CL1 expression is induced on endothelia by inflammation (Fong et al, 1998; Harrison et al, 1999). This could facilitate the cytoadherence of additional iRBC through CBP-CX3CL1 interaction once the malaria infection has triggered inflammation (Avril et al, 2012; Claessens et al, 2012; Lavstsen et al, 2012). Whether CBPs act independently from the dominant P. falciparum ligand for cytoadherence PfEMPl, or rather in combination with it as a co-ligand, remains to be elucidated.
- CBP1 and CBP2 induce an iRBC phenotype similar to that induced by PfEMPl (translation at the ring stage, surface expression and cytoadherence at the mature stage), they differ markedly regarding their structural and genetic features.
- Our staining ( Figure 5B) and functional data (Figure 6A) using antibodies strongly suggest that the N- and the C-terminus of CBP1 and CBP2 are intracytoplasmic ( Figure 4) leaving only short 9- or 12-amino acid domains exposed at the external side of the host red blood cell.
- the PfEMPl ectodomain is large (250-350 kDa) and built from a combination of multiple domains (Smith et al, 2000).
- the PfEMPl family is encoded by the highly diverse and polymorphic var gene family associated with very broad antigenic diversity.
- CBPs are monogenic members of a small family and exhibit no variant in their extracellular domain (PlasmoDB), which is consistent with the fact that we could not select for a subpopulation of iRBC with higher binding affinity even after several cycles of panning(data not shown).
- PfEMPl antigens are highly immunogenic; however intra-clonal diversity and poorly overlapping antigenic repertoires between clones/strains is a major drawback in vaccine development.
- CBPs are constitutively expressed and monogenic and, as such, expected to be poorly immunogenic.
- Seql and Seq2 peptides correspond to the external domain of the two invariant parasite ligands of CX3CL1, a chemokine mediating cytoadherence of Plasmodium falciparum-infected erythrocytes. These peptides were assayed as "neutraligands", i.e. molecules binding the ligand CX3CL1 to inhibit its binding to its receptor CX3CR1.
- the CX3CR1/CX3CL1 axis is known to contribute to the recruitment of monocytes to inflammatory sites [Fong AM et al 1998, Auffray C et al 2009, Poupel L et al 2013] to sequester monocytes in the bone marrow (BM) [Jacquelin S et al 2013] and to induce macrophage survival [Kim K-W et al 2011].
- BM bone marrow
- This model consists in injecting LPS or PBS for control in the peritoneum immediately after the intravenous injection of the peptides (10( ⁇ g) or PBS for control. After 4h, the mice are sacrificed and the inflammatory monocytes in peritoneal fluid are analysed by flow cytometry. When injected intraperiteonally (IP), LPS induced after 4h, the recruitment of inflammatory monocytes from the BM. As show in Figure 8, this recruitment is significantly increased in the presence of Seql peptide and reaches a level similar to the recruitment observed in the CX3CR1-/- animals.
- IP intraperiteonally
- This model consists in injecting thioglycolate in the peritoneum at DO.
- the peptides are IP injected (3 x 30 ⁇ g) and at D2, the mice are sacrificed and the monocytes in peritoneal liquid are analysed by flow cytometry.
- CBP 1 -EC and CBP2-EC peptides corresponding to the predicted extracellular domain (EC) of each CBP
- CX3CL1 CX3CL1
- This assertion was borne out using fluorescent version of the CBP-EC peptides. While the fluorescence of CBP 1 -EC and CBP2-EC only slightly increased in the presence of the control chemokine (CCL2, empty bars), it was significantly enhanced in the presence of CX3CL1 (filled bars) ( Figure 1 1). By contrast, this increase was minimal using the random counterparts of the CBP-EC peptides (CBPl-EC-rd, CBP2-ECrd, i.e. peptides with the same residues in a different order) ( Figure 1 1). So the interaction between CBP and CX3CL1 appears to be direct and specific of the chemokine on one hand and of the CBP-EC sequence on the other hand.
- the anti-CBPl and anti-CBP2 antibodies stain specifically the gamatocytes.
- Plasmodium falciparum erythrocyte membrane protein 1 domain cassettes 8 and 13 are associated with severe malaria in children.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Tropical Medicine & Parasitology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Veterinary Medicine (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relate to isolated peptides including binding domain of the Plasmodium Falciparum proteins (CBP1 and CBP2) to the chemokine CX3CL1 which has the property to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells. These isolated peptides (or their specific antibody) are used for the prevention or the treatment of Malaria and also acting as "CX3CL1 binding protein" for the treatment of inflammatory diseases or CX3CL1 -associated disease.
Description
PEPTIDES INCLUDING BINDING DOMAIN OF PLASMODIUM FALCIPARUM PROTEINS (CBPl AND CBP2) TO CHEMOKINE CX3CL1
FIELD OF THE INVENTION:
The invention relates to isolated peptides including binding domain of two Plasmodium Falciparum proteins (CBPl and CBP2) to the chemokine CX3CL1 which have the property to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells. These isolated peptides (or their specific antibody) are used for the prevention or the treatment of Malaria and also acting as "CX3CL1 binding protein" for the treatment of inflammatory diseases or CX3CL1 associated diseases.
BACKGROUND OF THE INVENTION:
As the major causative agent of severe malaria, Plasmodium falciparum is responsible for the bulk of malaria-related mortality worldwide (WHO, 2011). Clinical manifestations of severe malaria result from a combination of high parasite burdens and sequestration of mature P. falciparum- fectGd red blood cells (iRBCs) in microvascular beds throughout the body, a phenomenon described more than a century ago and commonly referred to as cytoadherence (Bignami & Bastiannelli, 1890). Cytoadherence of iRBC causes obstruction of blood flow in small brain blood vessels - thereby contributing to cerebral malaria - and in the villous chamber of the placenta, leading to pregnancy-associated malaria (Brabin et al, 2004; Bray & Sinden, 1979). Sequestration of iRBC causes microvascular obstruction, leads to metabolic disturbances (Planche et al, 2005; Zougbede et al, 2010), and allows iRBC to escape splenic clearance, which is a selective advantage for the microorganism (Buffet et al, 2009; Mebius & Kraal, 2005).
The emergence of drug resistant strains has compounded the problem of treating the malaria disease. Unfortunately, no FDA-approved vaccine exists. Thus, there is a continued need to develop novel vaccines and therapies for treating malaria infection.
Numerous parasite molecules of P. falciparum have been identified as ligands for cytoadherence; however, only the surface antigen variant family called "Plasmodium falciparum Erythrocyte Membrane Protein 1" (P EMP1) that is encoded by the var genes, is demonstrated as a bona fide adherence molecule (Smith et al, 2013). Conversely, several host molecules have been identified as receptors for iRBC adherence to human endothelium,
including CD36, ICAM1, P-selectin, thrombospondin, CSA (chondroitin sulfate A), and protein C receptor (Kirchgatter & Del Portillo, 2005; Rowe et al, 2009; Turner et al, 2013).
Importantly, clinical data have indicated that cytoadherence of iRBC may involve other molecules that have not yet been identified (Rowe et al, 2009). For example, iRBC adhere to the chemokine CX3CL1 (Hatabu et al, 2003) and a recent study rules out the intervention of PfEMPl in the adherence phenotype to CX3CL1 (Janes et al., 2011). So the P. falciparum ligand to CX3CL1 remains unknown.
Chemokines, or chemotactic cytokines, are secreted soluble molecules that are expressed by numerous cell types of the immune system, either constitutively or following the induction of inflammatory responses. Chemokines have indeed played a pivotal role in recruitment, activation, and retention of immune and non-immune cells and specifically, their infiltration or egression at inflamed sites and immune organs (Baggiolini, 1998; Viola & Luster, 2008).
Chemokine receptors are essentially G-protein Coupled Receptors (GPCR), members of the Rhodopsin class (Moser & Loetscher, 2001). The chemotactic activity of chemokines involves both activation of cell movement as well as adherence on various support. While chemokines generally operate through cell adherence by inducing or activating classical adhesive molecules like integrins (Moser & Loetscher, 2001; Rot & Von Andrian, 2004), CX3CL1 is an exception since it is natively expressed as a transmembrane protein that is endowed with an adhesive function unique among chemokines. During inflammation, CX3CL1 is expressed by numerous endothelial cell types, including the cerebral (Tarozzo et al, 2002; Zujovic et al, 2000) and trophoblastic (Cammas et al, 2005; Shimoya et al, 2003) lineages.
Inflammation is the body's immediate response to damage to its tissues and cells by pathogens, noxious stimuli such as chemicals, or physical injury. (U.Weiss, Nature Insight, 2008, Vol. 454, Issue no. 7203). Though this phenomenon is extremely important for the accomplishment of healing processes, dysregulated inflammation can have severe consequences.
Inflammation can be divided into two forms: acute inflammation, which is a short term response, and chronic inflammation, which is a dysregulated and maladaptive reaction highly detrimental for the host. It is now well established that chronic inflammation is involved in the development of several diseases among which are cardiovascular diseases, obesity, diabetes, asthma, inflammatory bowel diseases, allergies and rheumatoid arthritis (Durgaprasad L. et al, Inflammation & Allergy- Drug Targets, 2013, 12, 349-361). Acute
inflammation is considered as mainly beneficial in the healing process, but when it is uncontrolled, it can lead to severe pathologies as for example the Systemic Inflammatory Response Syndrome (SIRS) and sepsis which are both common causes of morbidity and death in intensive care units (Fitting C.et al, PloS one 7.6, 2012, e38916). Nonsteroidal anti- inflammatory (NSAIDs) are the most commonly used anti-inflammatory drugs but have several side effects among which are gastrointestinal ulcers and bleeding (H. Suleyman et al., Pharmacological Reports, 2007, 59, 247-258).
Thus, there is a continued need to develop novel drugs and therapies for treating inflammatory disorders.
The inventors of the present invention have discovered that, surprisingly, two P. falciparum proteins named CBP1 and CBP2 which are involved in CX3CL1 -mediated cytoadherence via a binding domain with CX3CL1, and accordingly, peptides derived from this binding domain, would represent a promising target of malaria infection but also for inflammation.
SUMMARY OF THE INVENTION:
The invention provides an isolated peptide comprising an amino acid sequence of formula (I):
Xaa 1 -Xaa2-Xaa3 -Threonine -Xaa4-Xaa5 -Xaa6-Xaa7-Xaa8-Xaa9-Xaa 10-Xaa 11 , wherein :
Xaal is serine (S) or absent;
Xaa2 is lysine (K), or absent;
Xaa3 is Phenylalanine (F) or serine (S);
Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid
Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
Xaa6 is methionine (M) or leucine (L);
Xaa7 is leucine (L) or lysine (K);
Xaa8 is alanine (A), asparagine (N) or aspartic acid (D),
Xaa9 is isoleucine (I) or glutamic acid (E);
XaalO is alanine (A), asparagine (N) or aspartic acid (D).
Xaal 1 is Glycine (G) or absent;
In preferred embodiments, Xaa5 is asparagine (N). In preferred embodiments, Xaal is serine (S) or absent, Xaa2 is lysine (K), or absent, Xaa3 is serine (S) or Phenylalanine (F), Xaa4 is leucine (L) or asparagine (N), Xaa5 is asparagine (N), Xaa6 is leucine (L), or methionin (M), Xaa7 is lysine (K) or leucine (L), Xaa8 is alanine (A) or asparagine (N), Xaa9 is glutamic acid (E) or isoleucine (I), XaalO is asparagine (N), alanine (A), Xaal l is Glycine (G), or absent.
In a preferred embodiment, the isolated peptide comprises or consists of the following amino acid sequences
STLNLK EN (SEQ ID NO : 1 ) or
SKFTNNMLAIAG (SEQ ID NO:2)
The invention further relates to antibodies generated against the isolated peptides of the invention.
The invention further relates to a pharmaceutical and vaccinal composition comprising an isolated peptide of the invention, together with a pharmaceutically acceptable carrier, and to the use of the peptides or the pharmaceutical composition according to the invention for treating or preventing Malaria or inflammatory disease and disease related to CX3CL1. DETAILED DESCRIPTION OF THE INVENTION:
Using a proteomic approach, inventors have identified two P. falciparum proteins involved in CX3CL1 -mediated cytoadherence. These proteins - named CBP1 and CBP2 for CX3CL1 -Binding-Proteins - were previously identified as potential surface proteins of the early gametocytes and called P. falciparum Gametocyte-Exported Proteins (PfGEXPlO and PfGEXP07) (Silvestrini et al, 2010). They have no other known function, share 32 % of their residues, and contain a signal peptide and an export motif called "Plasmodium export element" (Pexel) (Marti et al, 2004) or Vacuolar Transport Signal (VTS) (Hiller et al, 2004). They have no homology with other proteins from P. falciparum, have no ortholog in other Plasmodium species and, unlike PfEMPl, PfMC-2TM, RIFIN or STEVOR (Lavazec et al, 2006), are coded by single non-polymorphic genes. CBPs are expressed at the surface of iRBC and mediate the cytoadherence of P. falciparum-infected RBC to mammalian cells, a process that can be inhibited by peptides and anti-CBP antibodies.
The inventors have identified peptides sequence of the binding domain of CBP1 and CBP2 to the chemokine CX3CL1, corresponding to their extracellular domain (CBP1-EC and
CBP2-EC), which has the property to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells (CBPl and CBP2, previously known as PfGEXPlO and PfGEXP07, sequences deposited in PlasmoDB database under accession number PF3D7_0113900 and PF3D7_1301700). These binding domains of 9 and 12 amino-acids residues correspond to amino acid positions 182-190 of PfGEXPlO for CBPl -EC and to amino acid positions 188-199 of PfGEXP07 for CBP2-EC. These binding domains are able to inhibit the cytoadherence of P. falciparum-infected RBC to mammalian cells and consequently to treat Malaria disease. The inventors have obtained that these peptide CBP1- EC and CBP2-EC (and their specific antibody directed against CBPl -EC and CBP2-EC) competes with the native protein CBPl and CBP2 for binding to the CX3CL1 chemokine.
So inventor's work identified new ligands for the human chemokine CX3CL1 and discovered a non-polymorphic family of proteins in P. falciparum involved in the cytoadherence, thus opening the way to an innovative vaccination approach. The inventors have thus found a new targeted therapy for treating malaria infection by the Plasmodium falciparum with no available targeted therapy.
Isolated peptides
The invention relates to novel isolated peptides derived from the extracellular domain of CBPl and CBP2 proteins of Plasmodium Falciparum, which have capacity to inhibit the interaction between CBPl or CBP2 of Plasmodium Falciparum with CX3CL1 and/or to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells;.
In one aspect, the invention provides an isolated peptide, comprising an amino acid sequence of formula (I):
Xaa 1 -Xaa2-Xaa3 -Threonine -Xaa4-Xaa5 -Xaa6-Xaa7-Xaa8-Xaa9-Xaa 10-Xaa 11 , wherein :
Xaal is serine (S) or absent;
Xaa2 is lysine (K), or absent;
Xaa3 is Phenylalanine (F) or serine (S);
Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid (E);
Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
Xaa6 is methionine (M) or leucine (L);
Xaa7 is leucine (L) or lysine (K);
Xaa8 is alanine (A) asparagine (N) or aspartic acid (D).
Xaa9 is isoleucine (I) or glutamic acid (E);
XaalO is alanine (A), asparagine (N) or aspartic acid (D).
Xaal 1 is Glycine (G) or absent;
In preferred embodiments, Xaa5 is asparagine (N). In preferred embodiments, Xaal is serine (S) or absent, Xaa2 is lysine (K), or absent, Xaa3 is serine (S) or Phenylalanine (F), Xaa4 is leucine (L) or asparagine (N), Xaa5 is asparagine (N), Xaa6 is leucine (L), or methionine (M), Xaa7 is lysine (K) or leucine (L), Xaa8 is alanine (A), asparagine (N), Xaa9 is glutamic acid (E) or isoleucine (I), XaalO is asparagine (N), alanine (A), Xaal 1 is Glycine (G), or absent.
In a specific embodiment, the isolated peptide excludes the whole sequence of CBP1 and CBP2 proteins (PfGEXPIO (SEQ ID NO:9) and PfGEXP07 (SEQ ID NO: 10)).
In particular embodiment, the invention provides an isolated peptide selected from the group comprising or consisting of:
i) the amino acids sequence consisting of STLNLKNEN (SEQ ID NO : 1 ) ; ii) the amino acids sequence consisting of SKFTNNMLAIAG (SEQ ID
NO:2);
iii) the amino acids sequence consisting of STLALKAEA (SEQ ID NO:3) iv) the amino acids sequence consisting of STLDLKDED (SEQ ID NO:4) v) the amino acids sequence consisting of SKFTAAMLAIAG (SEQ ID NO:5);
vi) the amino acids sequence consisting of SKFTDDMLAIAG (SEQ ID NO:6);
vii) an amino acid sequence substantially homologous to the sequence of (i), to (vi) preferably an amino acid a sequence at least 80% identical to the sequence of (i) to (vi).
In a preferred embodiment, the isolated peptide comprises or consists of the following acid sequences STLNLKNEN (SEQ ID NO: l) or SKFTNNMLAIAG (SEQ ID NO:2)
As used herein, the term "amino acid" refers to natural or unnatural amino acids in their D and L stereoisomers for chiral amino acids. It is understood to refer to both amino acids and the corresponding amino acid residues, such as are present, for example, in peptidyl structure. Natural and unnatural amino acids are well known in the art. Common natural amino acids include, without limitation, alanine (Ala), arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamine (Gin), glutamic acid (Glu), glycine (Gly), histidine (His), isoleucine (He), leucine (Leu), Lysine (Lys), methionine (Met), phenylalanine (Phe), proline (Pro), serine (Ser), threonine (Thr), tryptophan (Trp), tyrosine (Tyr), and valine (Val). Uncommon and unnatural amino acids include, without limitation, allyl glycine (AllylGly), norleucine, norvaline, biphenylalanine (Bip), citrulline (Cit), 4- guanidinophenylalanine (Phe(Gu)), homoarginine (hArg), homolysine (hLys), 2- naphtylalanine (2-Nal), ornithine (Orn) and pentafluorophenylalanine.
Amino acids are typically classified in one or more categories, including polar, hydrophobic, acidic, basic and aromatic, according to their side chains. Examples of polar amino acids include those having side chain functional groups such as hydroxyl, sulfhydryl, and amide, as well as the acidic and basic amino acids. Polar amino acids include, without limitation, asparagine, cysteine, glutamine, histidine, selenocysteine, serine, threonine, tryptophan and tyrosine. Examples of hydrophobic or non-polar amino acids include those residues having nonpolar aliphatic side chains, such as, without limitation, leucine, isoleucine, valine, glycine, alanine, proline, methionine and phenylalanine. Examples of basic amino acid residues include those having a basic side chain, such as an amino or guanidino group. Basic amino acid residues include, without limitation, arginine, homolysine and lysine. Examples of acidic amino acid residues include those having an acidic side chain functional group, such as a carboxy group. Acidic amino acid residues include, without limitation aspartic acid and glutamic acid. Aromatic amino acids include those having an aromatic side chain group. Examples of aromatic amino acids include, without limitation, biphenylalanine, histidine, 2- napthylalananine, pentafluorophenylalanine, phenylalanine, tryptophan and tyrosine. It is noted that some amino acids are classified in more than one group, for example, histidine, tryptophan and tyrosine are classified as both polar and aromatic amino acids. Amino acids may further be classified as non-charged, or charged (positively or negatively) amino acids. Examples of positively charged amino acids include without limitation lysine, arginine and histidine. Examples of negatively charged amino acids include without limitation glutamic
acid and aspartic acid. Additional amino acids that are classified in each of the above groups are known to those of ordinary skill in the art.
The term CBPl -EC and CBP2-EC and Seql and Seq2 used in the present application are equivalent. Preferably, an isolated peptide according to the invention has the capacity (i) to inhibit the interaction between CBPl or CBP2 of Plasmodium Falciparum with CX3CL1; and/or (ii) to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells and/or CX3CL1.
The skilled in the art can easily determine whether isolated peptide is biologically active. For example, the capacity to inhibit the interaction between CBPl or CBP2 protein of Plasmodium Falciparum with CX3CL1 can for example be determined by any routine test well known by the man skills in the art : Bimolecular fluorescence complementation (BiFC), affinity electrophoresis, label transfer, yeast two-hybrid, phage display, co- immunoprecipitation, microcalorimetry, Surface Plasmon Resonance, binding assay with radioactive ligand.
The capacity to inhibit the cytoadherence of infected red blood cells (iRBC) to endothelial cells and/or CX3CL1 can for example be determined by using Static Adherence assay and or/ Flow adherence assay (e.g. as described in Example + Figures 1 and 2).
As used herein, a "biologically active" fragment refers to a fragment exhibiting at least one, preferably all, of the biological activities of a peptide of SEQ ID NO: l or SEQ ID NO:2, provided the biologically active fragment retains the capacity of inhibiting cytoadherence of infected red blood cells (iRBC) to endothelial cells. The biologically active fragment may for example be characterized in that it is capable of inhibiting the interaction between CBPl or CBP2 protein of Plasmodium Falciparum with CX3CL1 and/or inhibiting the cytoadherence of infected red blood cells (iRBC) to endothelial cells and/or CX3CL1 (see Example and Figures 3b, c).
A peptide "substantially homologous" to a reference peptide may derive from the reference sequence by one or more conservative substitutions. Two amino acid sequences are "substantially homologous" or "substantially similar" when one or more amino acid residue are replaced by a biologically similar residue or when greater than 80 % of the amino acids are identical, or greater than about 90 %, preferably greater than about 95%, are similar
(functionally identical). Preferably, the similar, identical or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wisconsin) pileup program, or any of the programs known in the art (BLAST, FASTA, etc.). The percentage of identity may be calculated by performing a pairwise global alignment based on the Needleman-Wunsch alignment algorithm to find the optimum alignment (including gaps) of two sequences along their entire length, for instance using Needle, and using the BLOSUM62 matrix with a gap opening penalty of 10 and a gap extension penalty of 0.5.
The term "conservative substitution" as used herein denotes the replacement of an amino acid residue by another, without altering the overall conformation and function of the peptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, shape, hydrophobic, aromatic, and the like). Amino acids with similar properties are well known in the art. For example, arginine, histidine and lysine are hydrophilic-basic amino acids and may be interchangeable. Similarly, isoleucine, a hydrophobic amino acid, may be replaced with leucine, methionine or valine. Neutral hydrophilic amino acids, which can be substituted for one another, include asparagine, glutamine, serine and threonine.
By "substituted" or "modified" the present invention includes those amino acids that have been altered or modified from naturally occurring amino acids.
As such, it should be understood that in the context of the present invention, a conservative substitution is recognized in the art as a substitution of one amino acid for another amino acid that has similar properties.
According to the invention a first amino acid sequence having at least 80% of identity with a second amino acid sequence means that the first sequence has 80; 81; 82; 83; 84; 85; 86; 87; 88; 89; 90; 91; 92; 93; 94; 95; 96; 97; 98; or 99% of identity with the second amino acid sequence. Amino acid sequence identity is preferably determined using a suitable sequence alignment algorithm and default parameters, such as BLAST P (Karlin and Altschul, 1990).
In some embodiments, the isolated peptide of the invention comprises at most 100 aminoacid (and at least 9). In some embodiments, the polypeptide of the invention comprises 100; 99; 98; 97; 96; 95; 94; 93; 92; 91; 90; 89; 88; 87; 86; 85; 84; 83; 82; 81; 80; 79; 78; 77; 76; 75; 74; 73; 72; 71; 70; 69; 68; 67; 66; 65; 64; 63; 62; 61; 60; 59; 58; 57; 56; 55; 54; 53; 52; 51; 50; 49; 48; 47; 46; 45; 44; 43; 42; 41; 40; 39; 38; 37; 36; 35; 34; 33; 32; 31; 30; 29;
28; 27; 26; 25; 24; 23; 22; 21; 20; 19; 18; 17; 16; 15; 14; 13; 12; 11; 10 or 9 amino acids. In some embodiments, the polypeptide of the invention comprises less than 50 amino acids. In some embodiments, the polypeptide of the invention comprises less than 30 amino acids. In some embodiments, the polypeptide of the invention comprises less than 25 amino acids. In some embodiments, the polypeptide of the invention comprises less than 20 amino acids. In some embodiments, the polypeptide of the invention comprises less than 15 amino acids.
The N- and C-termini of the peptides described herein may be protected against proteolysis. For instance, the N-terminus may be in the form of an acetyl group, and/or the C- terminus may be in the form of an amide group. Internal modifications of the peptides to be resistant to proteolysis are also envisioned, e.g. wherein at least a -CONH peptide bond is modified and replaced by a (CH2NH) reduced bond, a (NHCO) retro-inverso bond, a (CH2- O) methylene -oxy bond, a (CH2-S) thiomethylene bond, a (CH2CH2) carba bond, a (CO- CH2) cetomethylene bond, a (CHOH-CH2) hydroxyethylene bond), a (N-N) bound, a E- alcene bond or also a -CH=CH-bond. The peptides described herein may also be protected against proteolysis by the technique of stapled peptides as described by Walensky et al. (Science. 2004, 305, 1466-70).
In another aspect of the invention, peptides are covalently bound to a polyethylene glycol (PEG) molecule by their C- terminus or a lysine residue, notably a PEG of 1500 or 4000 MW, for a decrease in urinary clearance and in therapeutic doses used and for an increase of the half-life in blood plasma. In yet another embodiment, peptide half-life is increased by including the peptide in a biodegradable and biocompatible polymer material for drug delivery system forming microspheres. Polymers and copolymers are, for instance, poly (D, L-lactide-co-glycol ide) (PLGA) (as illustrated in US2007/0184015, SoonKap Hahn et al). The isolated peptides according to the invention may be produced using any method known in the art. They may for example be produced as recombinant peptides in a host cell (e.g. in a bacterial, yeast or eukaryotic host cell), or chemically synthesized (see for review Kent S.B.H. Chem. Soc. Rev., 2009,38, 338-351 and Bradley L. et al Annu Rev Biophys Biomol Struct. 2005; 34: 91-118 or R. B. Merrifield (1969). "Solid-phase peptide synthesis." Advances in enzymology and related areas of molecular biology 32: 221-96.; R. B. Merrifield (1969). "The synthesis of biologically active peptides and proteins." JAMA 210(7): 1247-54. and Raibaut, L., O. El Mahdi and O. Melnyk (2015). "Solid Phase Protein Chemical Synthesis." Topics in current chemistry).
In a particular embodiment, isolated peptides of the invention can be conformationally constrained to enable the peptides to bind to CX3CL1 with a better affinity.
Cyclisation is well known in the art and generally involves the introduction of a disulfide bound between two cysteine residues. Typically, the cycle is formed through a side chain to side chain ring involving a monosulfide or disulfide bridge between pairs of cysteines, penicillamines, homocysteines, combinations of the foregoing, or other pairs of amino acids in which the side chains are linked with either one or two sulfur atoms. Methods for the synthesis of disulfide cyclic polypeptide are well known in the art and are described for example in US3,929,758, US4,216,141; and US4,102,877. Polypeptides of the invention may thus comprise cysteine residues at terminal ends to allow the cyclisation of the polypeptide.
Accordingly, isolated peptides of the invention may comprise an amino acid sequence of formula II consisting of: Cysteine-PepXl -Xaal -Xaa2-Xaa3-Threonine-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-
XaalO-Xaal l- PepX2 -Cysteine
, wherein :
Xaal is serine (S) or absent;
Xaa2 is lysine (K), or absent;
Xaa3 is Phenylalanine (F) or serine (S);
Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid
(E);
Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
Xaa6 is methionine (M) or leucine (L);
Xaa7 is leucine (L) or lysine (K);
Xaa8 is alanine (A), asparagine (N) or aspartic acid (D);
Xaa9 is isoleucine (I) or glutamic acid (E);
XaalO is alanine (A), asparagine (N) or aspartic acid (D).
Xaal 1 is Glycine (G) or absent;
- "PepXl" and "PepX2" each consists of, one independently from the other, a spacer polypeptide having an amino acid length varying from 0 to 10 amino acid residues,
In a particular embodiment, the isolated peptide of the invention comprises an amino acid sequence consisting of CSTLNLKNENC (SEQ ID NO: 11) and CSKFTNNMLAIAGC (SEQ ID NO: 12) In another particular embodiment, the polypeptides as above described are cyclised via a disulfide bound between the two cysteine residues of the polypeptides.
Accordingly, the cyclic peptide of the invention may comprise an amino acid sequence having the formula (III):
C-PepXl -Xaal -Xaa2-Xaa3-T-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaal 0-Xaal 1 -PepX2-C
I I
, wherein:
Xaal is serine (S) or absent;
Xaa2 is lysine (K), or absent;
Xaa3 is Phenylalanine (F) or serine (S);
Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid
(E);
Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
Xaa6 is methionine (M) or leucine (L);
Xaa7 is leucine (L) or lysine (K);
Xaa8 is alanine (A), asparagine (N) or aspartic acid (D).
Xaa9 is isoleucine (I) or glutamic acid (E);
XaalO is alanine (A), asparagine (N) or aspartic acid (D).
Xaal 1 is Glycine (G) or absent;
- "PepXl" and "PepX2" each consists of, one independently from the other, a spacer polypeptide having an amino acid length varying from 0 to 10 amino acid residues,
In a preferred embodiment, the cyclic polypeptide comprises an amino acid sequence consisting of:
CSTLNLKNENC (SEQ ID NO: 13) and CSKFTNNMLAIAGC(SEQ ID NO: 14)
Cyclisation can also be performed by peptide bonds between the amino-terminal of the first amino acid and the carboxy-terminal of the last amino acid.
Other methods of cyclization are contemplated by the invention. For example, those methods include but are not limited by those described by Marlowe (1993, Biorg. Med. Chem. Lett. 3:437-44) who describes peptide cyclization on TFA resin using trimethylsilyl (TMSE) ester as an orthogonal protecting group; Pallin and Tarn (1995, J. Chem. Soc. Chem. Comm. 2021-2022) who describe the cyclization of unprotected peptides in aqueous solution by oxime formation; Algin et al (1994, Tetrahedron Lett. 35:9633-9636) who disclose solid- phase synthesis of head-to-tail cyclic peptides via lysine side-chain anchoring; Kates et al (1993, Tetrahedron Lett. 34: 1549-1552) who describe the production of head-to-tail cyclic peptides by three-dimensional solid phase strategy; Tumelty et al (1994, J. Chem. Soc. Chem. Comm. 1067-1068) who describe the synthesis of cyclic peptides from an immobilized activated intermediate, wherein activation of the immobilized peptide is carried out with N- protecting group intact and subsequent removal leading to cyclization; McMurray et al (1994, Peptide Res. 7: 195-206) who disclose head-to-tail cyclization of peptides attached to insoluble supports by means of the side chains of aspartic and glutamic acid; Hruby et al (1994, Reactive Polymers 22:231-241) who teach an alternate method for cyclizing peptides via solid supports; and Schmidt and Langer (1997, J. Peptide Res. 49:67-73) and those described by Davies JS (The cyclisation of peptides and depsipeptides J Pept Sci 2003,8:471- 501); and Li and Roller (PPCyclisation strategies in peptide derived drug design. Curr. Tp Med. Chem. 2002, 3:325-41) and Boll, E., J. P. Ebran, H. Drobecq, O. El-Mahdi, L. Raibaut, N. Ollivier and O. Melnyk (2015). "Access to large cyclic peptides by a one-pot two-peptide segment ligation/cyclization process." Organic letters 17(1): 130-3.
Antibodies according to the invention
The inventors have generated specific antibodies directed against a peptide derived from the CBP1 and CBP2 protein (CBP1-EC and CBP2-EC), i.e. the isolated peptide of formula (I).
The anti-CBPl and anti-CBP2 polyclonal antibodies were performed by immunizing rabbit with two synthetic peptides, LSTLNLKNEN (SEQ ID NO:7) and AATSKFTNNMLAIAGVG (SEQ ID NO: 8) respectively. More precisely, the inventors have found that antibodies screened for their capacity to recognize specifically the isolated peptide of the invention (example 2 and figure 5 A) and to stain iRBC samples from a Malaria patient.
It has also been found that an antibody directed against an isolated peptide of formula (I) above, inhibits iRBC binding to CX3CL1 (example 2 and figure 6A).
The invention provides an antibody that specifically binds to an isolated peptide of formula I.
The invention further provides an antibody that specifically binds to an isolated peptide comprising or consisting:
i) the amino acids sequence consisting of STLNLK EN (SEQ ID NO: 1) ; ii) the amino acids sequence consisting of SKFTNNMLAIAG (SEQ ID NO:2);
iii) the amino acids sequence consisting of STLALKAEA (SEQ ID NO:3) iv) the amino acids sequence consisting of STLDLKDED (SEQ ID NO:4) v) the amino acids sequence consisting of SKFTAAMLAIAG (SEQ ID NO:5);
vi) the amino acids sequence consisting of SKFTDDMLAIAG (SEQ ID NO:6);
vii) an amino acid sequence substantially homologous to the sequence of (i), to (vi) preferably an amino acid a sequence at least 80% identical to the sequence of (i) to (vi).
These antibodies can recognize an epitope located within, or comprising at least one amino acid located within, the fragment comprising or consisting of any one of isolated peptide (i) to (vii).
Preferably, said epitope is located within the fragment comprising or consisting of any one of isolated peptide (i) to (vii).
Most preferably said epitope is located within the fragment comprising or consisting of any one of (i) to (vii). Such antibodies are characterized in that they specifically bind to CBPl-EC and CBP2-EC
These antibodies can advantageously be used when selecting a patient to be treated by a peptide comprising CBP1-EC and CBP2-EC or a biologically active fragment thereof, e.g. using the method described hereabove.
These antibodies can be polyclonal or monoclonal. When the antibodies are monoclonal, they can for example correspond to chimeric, humanized or fully human antibodies.
Methods for obtaining such antibodies are well known in the art. For example, polyclonal antibodies according to the invention can be obtained through immunization of a non-human mammal with said fragment comprising or consisting of any one of (i) to (vii). Starting from the polyclonal antibodies, one can then obtain monoclonal antibodies using standard methods.
This invention is also directed to the use of an antibody directed against an isolated peptide of formula (I) for manufacturing a pharmaceutical composition for treating malaria disease linked to the infection of an individual with plasmodium falciparum Pharmaceutical compositions
The invention further relates to a pharmaceutical composition comprising a peptide of the invention, a cyclic peptide of the invention, or antibody of the invention together with a pharmaceutically acceptable carrier.
More particularly, the invention relates to a pharmaceutical composition comprising an isolated peptide of the invention or an antibody of the invention, together with a pharmaceutically acceptable carrier.
The peptide or antibody is formulated in association with a pharmaceutically acceptable carrier.
As used herein, the term "pharmaceutically acceptable" and grammatical variations thereof, as they refer to compositions, carriers, diluents and reagents, are used interchangeably and represent that the materials are capable of administration to or upon a mammal without the production of undesirable physiological effects such as nausea, dizziness, gastric upset and the like.
The preparation of a pharmacological composition that contains active ingredients dissolved or dispersed therein is well understood in the art and need not be limited based on formulation. Typically such compositions are prepared as injectables either as liquid solutions or suspensions; however, solid forms suitable for solution, or suspensions, in liquid prior to use can also be prepared. The preparation can also be emulsified. In particular, the pharmaceutical compositions may be formulated in solid dosage form, for example capsules, tablets, pills, powders, dragees or granules.
The choice of vehicle and the content of active substance in the vehicle are generally determined in accordance with the solubility and chemical properties of the active compound, the particular mode of administration and the provisions to be observed in pharmaceutical practice. For example, excipients such as lactose, sodium citrate, calcium carbonate,
dicalcium phosphate and disintegrating agents such as starch, alginic acids and certain complex silicates combined with lubricants such as magnesium stearate, sodium lauryl sulphate and talc may be used for preparing tablets. To prepare a capsule, it is advantageous to use lactose and high molecular weight polyethylene glycols. When aqueous suspensions are used they can contain emulsifying agents or agents which facilitate suspension. Diluents such as sucrose, ethanol, polyethylene glycol, propylene glycol, glycerol and chloroform or mixtures thereof may also be used.
The dosing is selected by the skilled person so that a anti-infectious effect is achieved, and depends on the route of administration and the dosage form that is used. Total daily dose of a peptide administered to a subject in single or divided doses may be in amounts, for example, of from about 0.001 to about 100 mg/kg body weight daily and preferably 0.01 to 10 mg/kg/day. Dosage unit compositions may contain such amounts of such submultiples thereof as may be used to make up the daily dose. It will be understood, however, that the specific dose level for any particular patient will depend upon a variety of factors including the body weight, general health, sex, diet, time and route of administration, rates of absorption and excretion, combination with other drugs and the severity of the particular disease being treated.
Vaccine composition
As inventors identified new ligands for the human chemokine CX3CL1 and discovered a non-polymorphic family of proteins in P. falciparum involved in the cytoadherence, thus opening the way to an innovative vaccination approach.
Accordingly, another object of the invention is a vaccine composition comprising an isolated peptide of formula (I) or a cyclic peptide of formula (III) and an immunoadjuvant compound.
By "vaccine composition" it is herein intended a substance which is able to induce an immune response in an individual, and for example to induce the production of antibodies directed against the isolated peptide of formula (I).
A vaccine is defined herein as a biological agent which is capable of providing a protective response in an animal to which the vaccine has been delivered and is incapable of causing severe disease. The vaccine stimulates antibody production or cellular immunity against the pathogen causing the disease; administration of the vaccine thus results in immunity from the disease.
Preferably, said immunoadjuvant compound is selected in the group consisting of Freund complete adjuvant, Freund incomplete adjuvant, aluminium hydroxide, and calcium phosphate.
In order to enhance the immunogenicity of the vaccine composition according to the invention, the peptide of formula (I) or (III), can comprise from 2 to 12 peptides of formula (I) or (III), for instance "STLNLKNEN" (SEQ ID NO: l) or SKFTNNMLAIAG (SEQ ID NO:2). or CSTLNLKNENC (SEQ ID NO: 13) and CSKFTNNMLAIAGC(SEQ ID NO: 14)
In particular, said antigenic polypeptide, can have the following formula (IV) :
NH2-PepNt-[(I)n-PepXn]n-PepCt- COOH (III),
wherein :
- "PepNt" consists of a polypeptide having an amino acid length varying from 0 to 100 amino acid residues and located at the N-terminal end of the polypeptide of formula (IV);
- "[(I)n-PepXn]" consists of a polypeptide unit wherein :
- "(1)1" to - "(I)n" each consists of, one independently from each other, a peptide of formula (I) and/or (III) " with n being an integer from 1 to 12; and
- "PepXl" to "PepXn" each consists of, one independently from the other, a spacer polypeptide having an amino acid length varying from 0 to 30 amino acid residues, with n being an integer from 1 to 12; and
- n is the number of [(I)n-PepXn] polypeptide units in said polypeptide, with n being an integer from 1 to 12; and
- "PepCt" consists of a polypeptide having an amino acid length varying from 0 to 100 amino acid residues and located at the C-terminal end of the polypeptide of formula (IV).
In particular, embodiment, peptide (1)1 to (I)n of formula (I) or (III), are selected between the group of "STLNLKNEN" (SEQ ID NO: l) and/or "SKFTNNMLAIAG" ( SEQ ID NO:2) and/or CSTLNLKNENC (SEQ ID NO: 13) and jCSKFTNNMLAIAGC(SEQ ID
In particular, said antigenic isolated peptide, can have the following formula (I) (III) or
(IV) as defined above.
More particularly, said antigenic isolated peptide, comprising or consisting:
i) the amino acids sequence consisting of STLNLKNEN (SEQ ID NO: 1) ;
the amino acids sequence consisting of SKFTNNMLAIAG ( SEQ ID NO:2);
the amino acids sequence consisting of STLALKAEA (SEQ ID NO:3) the amino acids sequence consisting of STLDLKDED (SEQ ID NO:4) the amino acids sequence consisting of SKFTAAMLAIAG (SEQ ID NO:5);
the amino acids sequence consisting of SKFTDDMLAIAG (SEQ ID NO:6);
the amino acids sequence consisting of CSTLNLKNENC (SEQ ID NO: the amino acids sequence consisting of CSKFTNNMLAIAGC ( SEQ ID
NO: 14); ' ' an amino acid sequence substantially homologous to the sequence of (i), to (viiii) preferably an amino acid a sequence at least 80% identical to the sequence of (i) to (viiii).
Said antigenic peptide can be covalently linked through an amino acid residue to a carrier protein or a synthetic polymer.
In order to enhance peptide immunogenicity, the peptide of formula (I) can be covalently linked ("conjugated") to a larger molecule which serves as a carrier.
Attachment of the peptide to the carrier can be by one of several methods, including linking through a peptide Lys using glutaraldehyde (Reichlin, Methods Enzymol. 70: 159- 165, 1980) or DCC procedures (for example, Atassi et al, Biochem. Biophys. Acta 670: 300- 302, 1981), through a Peptide Asp or Glu using DCC (Bauminger et al, Methods Enzymol 70: 151-159, 1980), through a peptide Tyr using bis-diazotized benzidine (Walter et al, Proc. Nat. Acad. Sci. USA 77: 5197-5200, 1980), through photochemical attachment sites (Parker et al, Cold Spring Harbor Symposium - Modern Aoproaches to Vaccines, Ed. Chanock & Lerner, Cold Spring Harbor Press, New York, 1984), or through a peptide Cys (Liu et al, Biochem. 18: 690-697, 1979).
Peptide carrier conjugates can be separated from excess free peptide by dialysis or gel filtration. The level of loading of the peptide on the carrier can be determined either using a radioactive tracer to establish the loading level in a particular procedure, or by quantitative amino acid analysis of the conjugate, in comparison with the unloaded carrier. It is convenient, when using the latter technique, to incorporate a unique non-natural amino acid
into the peptide, at the N-terminal or C-terminal side, such as Nle, which can then serve as a quantitative marker for peptide incorporation, as measured by amino acid analysis of the conjugate. This Nle can also function as a spacer between the antigenic site and any amino acid incorporated to facilitate attachment, such as Cys, Lys, or Tyr, as described above.
Preferably, said carrier protein is selected from the group consisting of keyhole limpet hemocyanin (KLH), bovine serum albumin, or diphtheria toxoid.
In a vaccine composition according to the invention, said synthetic polymer can be a multiple branch peptide construction comprising a core matrix comprised of lysine residues.
Radially branched systems using lysine skeletons in polymers have been used by J. P. Tarn [Proc. Natl. Acad. Sci. U.S.A., 85, 5409-5413 (1988)] to develop antigens without the use of carriers. Those antigens were designed to generate vaccines against a variety of diseases. Specifically, antigens for generating vaccines against malaria disease are described in PCT patent application ser. no. WO93/10152, WO2006/029887, WO2007/003384, WO2009/021931 and WO2009/080715, WO2015038708
The core matrix is preferably a dendritic polymer which is branched in nature, preferably with each of the branches thereof being identical. The core matrix is based on a core molecule which has at least two functional groups to which molecular branches having terminal functional groups are covalently bonded. Exemplary for use to form the core matrix is lysine. A central lysine residue is bonded to two lysine residues, each through its carboxyl group, to one of the amino groups of the central lysine residue. This provides a molecule with four amino groups, which may be a core matrix for a structure comprising four peptides of formula (I). The manufacture of the above structures, is known in the art. See, e.g., Tarn et al., J. Immun. 148, 914-920 (1992) and Wang et al, Science, 254, 285-288 (1991).
Additionally, spacers between said peptide and said carrier protein or synthetic polymer can be added. A peptide linker sequence may be employed to separate the first and second polypeptide components by a distance sufficient to ensure that each polypeptide folds into its secondary and tertiary structures. Such a peptide linker sequence is incorporated into the fusion protein using standard techniques well known in the art. Suitable peptide linker sequences may be chosen based on the following factors: (1) their ability to adopt a flexible extended conformation; (2) their inability to adopt a secondary structure that could interact with functional epitopes on the first and second polypeptides; and (3) the lack of hydrophobic or charged residues that might react with the polypeptide functional epitopes. Preferred peptide linker sequences contain Gly, Asn and Ser residues. Other near neutral amino acids, such as Thr and Ala may also be used in the linker sequence. Amino acid sequences which
may be usefully employed as linkers include those disclosed in Maratea et al, Gene 40:39-46, 1985; Murphy et al, Proc. Natl. Acad. Sci. USA 83:8258-8262, 1986; U.S. Pat. No. 4,935,233 and U.S. Pat. No. 4,751,180. The linker sequence may generally be from 1 to about 50 amino acids in length. Linker sequences are not required when the first and second polypeptides have non-essential N-terminal amino acid regions that can be used to separate the functional domains and prevent steric interference.
The invention concerns also a vaccine composition comprising a peptide comprising the amino acid sequence STLNLKNEN (SEQ ID NO: 1) or SKFTNNMLAIAG (SEQ ID NO:2), and/or CSTLNLKNENC (SEQ ID NO: 13) and CSKFTNNMLAIAGC(SEQ ID NO: 14). 1 1 I 1
said peptide, being covalently linked through an amino acid residue to a carrier protein or to a synthetic polymer.
Preferably, said carrier protein is selected from the group consisting of keyhole limpet hemocyanin (KLH), bovine serum albumin, or diphtheria toxoid.
The synthetic polymer can be a multiple branch peptide construction comprising a core matrix comprised of lysine residues. Spacers between said polypeptide and said carrier protein or synthetic polymer can be introduced.
Preferably, in the vaccine composition cited immediately above, there are spacers between said polypeptide and said carrier protein or synthetic polymer.
Therapeutic applications
A) Malaria
The isolated peptide as defined above, the antibody of the invention, the pharmaceutical and vaccine composition of the invention may be used for treating Malaria Disease.
The invention thus also relates to a peptide, or an antibody of the invention for use for treating Malaria Disease.
As used herein, the term "Malaria " is a mosquito-borne infectious disease of humans and other animals caused by parasitic protozoans (a group of single-celled microorganism) belonging to the genus Plasmodium.[l] Malaria causes symptoms that typically include fever, fatigue, vomiting and headaches. In severe cases it can cause yellow skin, seizures, coma or death [Caraballo H (2014). Emergency Medicine Practice 16 (5)]. The disease is transmitted by the biting of mosquitos, and the symptoms usually begin ten to fifteen days after being bitten. In those who have not been appropriately treated disease may recur months later[l].
Clinical manifestations of severe malaria result from a combination of high parasite burdens and sequestration of mature P. falciparum- fectGd red blood cells (iRBCs) in microvascular beds throughout the body, a referred to as cytoadherence (Bignami & Bastiannelli, 1890). Cytoadherence of iRBC causes obstruction of blood flow in small brain blood vessels - thereby contributing to cerebral malaria - and in the villous chamber of the placenta, leading to pregnancy-associated malaria (Brabin et al, 2004). Sequestration of iRBC causes microvascular obstruction, leads to metabolic disturbances (Planche et al, 2005; Zougbede et al, 2010), and allows iRBC to escape splenic clearance, which is a selective advantage for the microorganism (Buffet et al, 2009; Mebius & Kraal, 2005).
In particular, the isolated peptide, or the antibody of the invention may have the ability to decrease the parasite load in a subject of at least 40%, 50%, 60%, 70%, 80%, 90% or 100%.
The invention also provides a method of treatment of a Malaria disease in a patient in need thereof, which method comprises administering said patient with an isolated peptide, or antibody of the invention.
The term "patient" or "subject" refers to a human or non-human mammal, preferably a mouse, cat, dog, monkey, horse, cattle (i.e. cow, sheep, goat, buffalo), including male, female, adults and children.
As used herein, the term "treatment" or "therapy" includes curative and/or prophylactic treatment. More particularly, curative treatment refers to any of the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a symptom, as well as delay in progression of a symptom of a particular disorder. Prophylactic treatment refers to any of: halting the onset, reducing the risk of development, reducing the incidence, delaying the onset, reducing the development, as well as increasing the time to onset of symptoms of a particular disorder.
B) Inflammation disease
CX3CL1 and its receptor CX3CR1 play a major role in numerous inflammatory processes. The CX3CR1/CX3CL1 axis is known to contribute to the recruitment of monocytes to inflammatory sites [Fong AM et al 1998, Auffray C et al 2009, Poupel L et al 2013] to sequester monocytes in the bone marrow (BM) [Jacquelin S et al 2013] and to induce macrophage survival [Kim K-W et al 2011].
The CBP1-EC and CBP1-EC peptides correspond to the external domain of the two invariant parasite ligands of CX3CL1, were assayed as "neutraligands", i.e. molecules binding the ligand CX3CL1 to inhibit its binding to its receptor CX3CR1.
As show in example 3 inventors tested here the 2 peptides in two preclinical models of non- infectious peritonitis, a short-term one (LPS-induced) and a long term one (thioglycolate- induced)
Thus, the present invention relates to a isolated peptide of the invention or an cyclic peptide of invention for use in the treatment of an inflammatory disease. As used herein, the terms "inflammatory disease" or "inflammatory disorder" relates to a complex reaction of vascularized tissue to infection, toxin exposure, or cell injury that involves extravascular accumulation of plasma proteins and leukocytes (Abbas et al., Cellular and Molecular Immunology, 7th edition, 2011).
Inflammatory diseases can be divided into to two groups: acute inflammatory diseases and chronic inflammatory diseases.
By "acute inflammatory diseases" it is herein referred to a common result of innate immune responses, and local adaptive immune responses. Acute inflammation is the initial response of the body to harmful stimuli and is achieved by the increased movement of plasma and leukocytes from the blood into the injured tissues. Although inflammation serves a protective function in controlling infections and promoting tissue repair, it can also cause tissue damage and disease (Abbas et al, Cellular and Molecular Immunology, 7th edition, 2011). Examples of acute inflammatory diseases are Systemic Inflammatory Response Syndrome (SIRS), sepsis, peritonitis, reperfusion injury, pancreatitis, nephritis, myocarditis, encephalitis, pelvic inflammatory disease, vasculitis, uveitis, keratitis and acne vulgaris.
By "chronic inflammatory diseases" it is herein referred to prolonged inflammation that leads to a progressive shift in the type of cells present at the site of inflammation and is characterized by simultaneous destruction and healing of the tissue from the inflammatory process. Examples of chronic inflammatory diseases are Inflammatory Bowel Diseases (IBD) as Crohn's disease and ulcerative colitis, celiac disease, chronic bronchitis, chronic obstructive pulmonary disease, chronic prostatitis, gastritis, atherosclerosis, rheumatoid arthritis, obesity, allergies, asthma, psoriasis, dermatitis, eczema.
In a particular embodiment the inflammatory disease is acute inflammatory disease. In a preferred embodiment the acute inflammatory disease is selected between Systemic Inflammatory Response Syndrome (SIRS), sepsis, peritonitis.
C) CX3CL1 associated disease
The CX3CL1/CX3CR1 pathway has been shown to be involved in the development of autoimmune diseases such as multiple sclerosis (Huang et al. 2006, Faseb J 20(7): 896-905), rheumatoid arthritis (Sawai et al. 20 2007 Arthritis Rheum 56(1 0): 3215-25), lupus erythematosus (lnoue et al. 2005, Arthritis Rheum 52(5): 1522-33), cardiovascular diseases (Moatti et al. 2001, Blood 97(7): 1925-8; Combadiere et al. 2003, Circulation 107(7): 1009- 16; Lesnik et al. 2003, J Clin Invest 111 (3): 333-40; McDermott et al. 2003, J Clin Invest 111 (8): 1241-50), neurodegenerative diseases such as macular degeneration (Combadiere et al. 2007, J Clin Invest 117(10): 2920-8) and Parkinson's disease (Cardona et al. 2006, Nat Neurosci 9(7): 917-24 ), graft versus host disease (Robinson et al. 2000, J Immunol 165(11): 6067-72), cancer (Andre et al. 2006, Ann Oncol 17(6): 945-51; Vitale et al. 2007, Gut 56(3): 365-72), viral infections such as HIV infections (Faure et al. 2000, Science 287(5461 ): 2274- 7; Garin et al.2003, J Immunol 171 (1 0): 5305-12), respiratory syncytial virus infections (Tripp et al. 2001 , Nat Immunol 2(8): 732-8) and West Nile Virus infections (Getts et al.2008, J Exp Med 205(10): 2319-37). The CX3CL 1/CX3CR1 pathway has also been shown to be involved in cicatrisation (lshida et al. 2008, J Immunol 180(l):569-79), pain (Holmes et al. 2008, J Neurochem 1 06(2): 640-9), behavioural disorders (Gordon Research Conferences, 21-26/09/2008), and nucleic acids encoding CX3CCL1 are useful as adjuvant in vaccines (lga et al. 2007, Vaccine 25(23): 4554-63).
Therefore, the invention is directed to a peptide according to the invention for use as a medicament, more specifically for use for the treatment or the prevention of any disease described herein.
A preferred aspect of the invention is directed to:
- a method for treating or preventing a disease selected from the group consisting of an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, a graft versus host disease, a behavioral disorder, a cicatrisation disorder, a viral infection, cancer and pain comprising the step of administering an effective amount of an isolated peptide according to the invention to an individual in need thereof; and/or
- a isolated peptide according to the invention for use in treating or preventing a disease selected from the group consisting of an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, a graft versus host disease, a behavioural disorder, a cicatrisation disorder, a viral infection, cancer and pain.
More generally, the present invention is devoted to the generation of novel therapeutic compounds and drugs with increased efficacy and specificity for the treatment of mental or neurological diseases, or pathologies of the immune system, infectious diseases or cancer. These modulators could also be used as drugs for the treatment of pathological states for which specific therapeutic agents are now lacking. Published studies using a macaque model have already emphasized the potential of chemokine variants in topical drugs (Lederman, 2004, Science, 306, 485-487.).
By "effective amount" is meant an amount sufficient to achieve a concentration of peptide which is capable of preventing, treating or slowing down the disease to be treated. Such concentrations can be routinely determined by those of skilled in the art. The amount of the compound actually administered will typically be determined by a physician, in the light of the relevant circumstances, including the condition to be treated, the chosen route of administration, the actual compound administered, the age, weight, and response of the individual patient, the severity of the patient's symptoms, and the like. It will also be appreciated by those of stalled in the art that the dosage may be dependent on the stability of the administered peptide.
In a preferred embodiment, said disease is selected from the group consisting of an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, cancer and a graft versus host disease. Autoimmune disorders include, e.g., multiple sclerosis, rheumatoid arthritis, lupus erythematosus, inflammatory bowel disease and ulcerative colitis. Cardiovascular diseases include, e.g., atherosclerosis, thrombosis, atherothrombosis and heart failure. Cancer include, e.g., breast cancer, colon cancer, prostate metastasis dissemination, and lymphoma. The neurodegenerative disease may for example correspond to Parkinson's disease.
The invention will be further illustrated by the following figures and examples. However, these examples and figures should not be interpreted in any way as limiting the scope of the present invention. FIGURES:
Figure 1. Adherence of 3D7-iRBC on the CX3CL1 chemokine.
A) Static adherence of 3D7-iRBC at early stages (12% parasitaemia, 10% ring) or at late stages (7% parasitaemia, 1% ring, 6% mature stages) in 96-well plates coated with 25 pmoles of CX3CL1 (grey bars) or not (control, empty bars). The number of adherent cells per
mm2 was expressed as mean values and standard deviations from duplicate wells. Data are representative of three independent experiments.
B) Flow adherence of enriched 3D7-iRBC, on parental L929 cells or on CX3CL1 positive-L929 cells after pretreatment or not with 500 nM of CX3CL1 or 500 nM of CCL2. The number of adherent cells was expressed as percent of the control, as mean values and standard deviations from three independent experiments.
C) Static adherence of normal RBC (black bars) and enriched 3D7-iRBC (grey bars) in 96-well plates coated with 25 pmoles of CX3CL1 or CCL2 per well or not (buffer) as indicated. The number of adherent RBC per mm2 was expressed as in A from three independent experiments.
D) Static adherence of enriched 3D7-iRBC in 96-well plates coated with various concentration of CX3CL1. The number of adherent cells per mm2 was expressed as in A. The use of enriched iRBC difference in panels 1C and ID explains the difference in iRBC adherent number as compared to panel 1 A panel.
Figure 2. Electrophoresis and anti-CX3CRl staining of 3D7-iRBC membranes
A. Static adherence of CX3CL1 of enriched 3D7-iRBC pretreated or not (control) with 0.5 μg/ml of anti-CX3CRl or anti-DARC antibodies, in 96-well plates coated with 25 pmoles. The number of adherent cells was expressed as percent of the control, as mean values and standard deviations from four independent experiments.
B. Membranes proteins of normal RBC and 3D7-iRBC were separated on SDS/PAGE and transferred to PVDF membrane, immunostained with anti-CX3CRl (left panel) or stained with Coomassie blue (right panel). Arrows indicates the gel plug used for mass spectrometry analysis.
Figure 3. Characterization of HEK293 clones expressing CBP candidates.
A) HEK293 clones expressing the five CBP candidates as chimera with EYFP were visualized wide field EYFP fluorescence. Images indicate the membrane expression of the EYFP-fusion proteins.
B) The clones were subjected to static adherence in 96-well plates coated or not
(control) with 25 pmoles of CX3CL1 or CCL2 per well, as indicated. The number of adherent cells per mm2 was expressed as mean values and standard deviations from four replicates wells.
Figure 4. Schematic primary and secondary structure of CBPl and CBP2
Grey box: signal peptide. Empty box: Pexel/VTS motif. Filled box: putative TM domain. The % number indicates the sequence identity between CBPl and CBP2 domain by domain or as a whole (lower). EC means putative "extracellular domain".
Figure 5. The antibodies raised against CBPl and CBP2 stain the external membrane of RBC infected by mature 3D7 Plasmodium falciparum strain.
A) Membranes of untreated RBC and enriched 3D7-iRBC were subjected to Western blotting using anti-CBPl (left panel) or with anti-CBP2 (right panel) antisera (1/500 dilution).
B and C) 3D7-iRBC were visualized by transmitted light, by staining with anti-CBPl
(B) or anti-CBP2 (C) antisera and by Hoechst staining using either RBC infected by 3D7 strain at mature stages (80% parasitaemia, after gel flotation) or at early stage (4,5% parasitaemia, 4% ring). Bar = ΙΟμιη. Figure 6. Static adherence of 3D7-iRBC on the CX3CL1 chemokine is decreased in the presence of anti-CBPl/2 antibodies and in the presence of CBP-EC peptides.
A) Static adherence in 96-well plates coated with 25 pmoles of CX3CL1 of enriched 3D7-iRBC pretreated or not (control) with 0.5 μg/ml of anti-CX3CRl antibodies, of anti- CBPl pAb, of anti-CBP2 pAb or addition of both anti-CBPl and CBP2 pAb, both anti- CX3CR1 and anti-CBPl/2 or with a control pAb. The data are expressed as percent of the control, as mean values and standard deviations from four independent experiments.
B) Static adherence in 96-well plates coated with 25 pmoles of CX3CL1 of enriched 3D7-iRBC pretreated or not (control) with 0.1 μΜ of various peptides as indicated. The data are expressed as percent of the control, as mean values and standard deviations from four independent experiments.
Figure 7. Static adherence of 3D7-iRBC on the CX3CL1 chemokine in the presence of CBP-EC peptides and of their variants.
Static adherence in 96-well plates coated with 25 pmoles of CX3CL1 of enriched 3D7-iRBC pretreated or not (control) with 0.1 μΜ of various peptides as indicated. The data are expressed as percent of the control, as mean values and standard deviations from four independent experiments.
Figure 8. LPS preclinical model.
Seql or Rd-Seql peptides (100 μg) are injected just before intraperiteoneal injection of LPS in WT animals (grey bars). Only LPS is injected in CX3CR1-/- animals (black bar) and only PBS is injected in control animals (left bar). Bars represent mean ± SD of data collected in three animals
Figure 9. Thioglycolate pre-clinical model.
After thioglycolate injection at DO and injection (3 x 30 μg) of Seql/2 or Rd-Seql/2 peptides at Dl either in PBS (Seql) or in PBS plus DMSO (Seq2). The monocytes, either inflammatory (up) or patrolling (down) are analyzed at D2 in peritoneal liquid. Bars represent mean ± SD of data collected in three animals
Figure 10. Chemotaxis of CHO-CX3CR1 cells towards 5 nM CX3CL1 in the presence of 0.5μΜ of CBP-EC peptides and of their variants.
Migration assays were performed in 24-transwell inserts (Corning Costar, Avon, France) with 8μιη polycarbonate filter. Cells were resuspended in chemotaxis buffer (DMEM containing 0.5% BSA and 10 nM HEPES) in presence or not of 0.5μΜ CBP-EC peptides located in the top chamber. The bottom of each well was filled with 600μΕ pre-warmed chemotaxis buffer at indicated chemokine concentration. The plates were then incubated for 4 hours at 37°C in a 5% CO2 atmosphere. Cells that passed the membrane were stained with DAPI (VectaShield, Peterborough, UK) and counted manually with a fluorescence microscope (BX51; Olympus, Rungis, France) as fluorescent spots. Results are expressed as a number of cells migrating in the presence of chemoattractant or peptide minus the number of cells migrating in presence of buffer only. Experiments were run in triplicate, and results are representative of at least three independent experiments.
Figure 11. Specific and functional interaction between CX3CL1 and the CBP-EC peptides assayed by fluorescence.
Solutions of 30μ1 of 500nM of each of the 5-TAMRA fluorescent peptides were prepared at 4°C in the presence or not of 2μΜ of CCL2 or CX3CL1 using the HBSS buffer supplemented with lmM CaCk and ImM MgCk in a 96-well white plate. After 20 minutes of incubation at RT the 5-TAMRA fluorescence was measured (excitation 520 nm, emission 580 nm). Experiments are made in triplicate. The background (fluorescence of the control without chemokine) was subtracted and the data were expressed as mean values and standard deviations from three independent experiments.
EXAMPLE 1:
Materials & Methods
Chemicals, proteins and antibodies
All chemicals are from Sigma-Aldrich (L'Isle d'Abeau, France) except when stated.
Chemokine CCL2 are from Peprotech (Levallois-Perret, France) and chemokine domain of CX3CL1 from R&D Systems (Lille, France). The peptides CBP1-EC or Seql (STLNLKNEN (SEQ ID NO: l) and CBP2-EC or Seq2 (SKFTNNMLAIAG (SEQ ID NO:2)) as well as the random peptides CBPl-EC-rd or Seql-rd (NLETNSKNL (SEQ ID NO: 15)) and CBP2-EC-rd or Seq2-rd (MATGSAKNLFNI (SEQ ID NO: 16)) were synthetised in the Institut Biologie Paris Seine (UPMC). Anti-CX3CR1 polyclonal antibody (pAb 14-6093) was purchased from eBioscience (SAS, Paris, France). Anti-DARC antibody was a generous gift from O. Bertrand (Inserm U-1134). The anti-CBPl and anti-CBP2 polyclonal antibodies were performed at Proteogenix (Schiltigheim, France) by immunizing rabbit with two synthetic peptides, LSTLNLKNEN (SEQ ID N:7) and AATSKFTNNMLAIAGVG (SEQ ID N: 8) respectively.
Cell cultures
Human embryonic kidney (HEK293) and the fibroblastic L929 cell lines were grown in DMEM medium supplemented with 10% fetal calf serum (Dutscher, Brumath, France), 1% sodium pyruvate and antibiotics. To obtain L929 clone expressing CX3CL1, the CX3CL1- pEYFP plasmid (Hermand et al, 2008) was transfected into L929 cells with the cationic polymer transfection reagent JetPEI (Polyplus transfection, Ozyme, St Quentin-en- Yvelines,France). A stable transformant resistant to 0.5 mg/ml G418 (Invitrogen) was selected with a FACS Aria cell sorter (BD Biosciences, Le Pont de Claix, France).
The Plasmodium falciparum 3D7 cloned strain was cultured in human erythrocytes as described previously (Trager & Jensen, 1976). Enrichment of late-stage infected erythrocytes (parasitaemia greater than 80 %) was obtained by gelatin flotation (Plasmion, Fresenius Kabi, France) according to already published protocol (Pasvol et al, 1978).
Identification of CX3CL1-Binding Protein (CBP) candidates by SDS-PAGE and mass spectrometry
Membranes from RBCs and iRBCs (parasitaemia greater than 80 %) were prepared by hypotonic lysis (Steck & Kant, 1974) by incubation in 5P8 buffer (5 mM NaH2P04/Na2HP04, 0.35 mM EDTA, pH 8) and centrifuged 5 min at 4000 xg at 4°C to remove parasite pellet. The supernatant containing RBC ghost was centrifuged 15 min at 25,000 xg at 4°C. Then the pellet was washed in 5P8 buffer by centrifugation several times
until the ghost pellet became white. Ghosts were lysed in PBS buffer containing 1 % Triton- XI 00, 0.5 % SDS and antiprotease cocktail Complete (Roche Diagnostics, Meylan France). After centrifugation for 45 min at 25,000 xg (4°C), protein concentration of supematants was evaluated (BCA, Pierce, Thermo Fisher Scientific, Courtaboeuf, France). Proteins were separated by 4-20 % SDS-PAGE (Novex 4-20%, Life Technologies). The fractionated proteins were either stained with Coomassie Blue (120 μg of cell lysate per lane) or transferred to PVDF membranes (Dutscher) (50 μg of cell lysate per lane). Immune complexes were visualized with secondary peroxidase-conjugated antibodies using a chemiluminescent kit (GE Healthcare Europe, Saclay, France).
Gel fractions were washed three times with 25 mM NH4HCO3, 50 % ethanol and then dehydrated with pure acetonitrile. Reduction and alkylation of proteins were performed by incubating gel samples in 10 mM DTT, 100 mM NH4HCO3 for 30 min at 56°C and alkylation in 55 mM iodoacetamide, 100 mM NH4HCO3 for 45 min at RT. After wash in 25 mM NH4HC03, 50 % acetonitrile, gel samples were dehydrated with acetonitrile before being rehydrated with 40 μΐ of trypsin solution (400 ng in 50 mM NH4HCO3, 10 % acetonitrile) for overnight digestion at 37°C. Supematants were transferred in a new tube and peptides were extracted twice with 50μ1 of 50 % acetonitrile, 0.1 % TFA. Tryptic peptides were dried and resuspended in 10 μΐ of 50 % acetonitrile, 0.1 % TFA. Liquid Chromatography - Mass Spectrometry (LC-MS/MS) analysis were performed on an Ultimate 3000 Nano HPLC instrument (Thermo Fisher Scientific, Courtaboeuf, France) coupled to an Esquire HCTultra ion trap mass spectrometer (Bruker Daltonics, Mame-la-Vallee, France). The LC separation was performed on a PepMaplOO column (0.075 mm ID, 3 μιη particle size, 15 cm long; Thermo Fisher Scientific) at a flow rate of 200 nL/min, employing a linear gradient from 0% to 50% of H20/acetonitrile/formic acid (5/95/0.1 v/v) for 35 min. A search for protein identity was carried out with MASCOT software (http://www.matrixscience.com) using the PlasmoDB protein database (http://plasmodb.org/plasmo/). Confident matches were defined by a MASCOT score above 28 (threshold score corresponding to statistical significance p<0.05).
CBPs transfectants in the HEK293 cell line
The CBP-DNAs were synthetized by the GeneArt Plasmid Services (Life
Technologies) with the CX3CL1 peptide signal and codons optimization for human cells. They were cloned in pMA gene art vector between Sacl and KpNI restriction sites. These constructs were digested with Hindlll and BamHI and the Hindlll/BamHI fragments were then cloned in pEYFP-NI (Clontech, Ozyme, France). CBP-pEYFP constructs were
trans fected into HEK293 using the cationic polymer transfection reagent jetPEI (Polyp lus transfection, Illkirch, France). Stable transformants resistant to 1 mg/ml G418 (Life Technologies) were selected with Facs Ariall Cell Sorter (Becton-Dickinson, le Pont de Claix, France).
Static adherence assay
CX3CL1 or CCL2 were adsorbed overnight at 4°C on flat-bottom 96-well microtiter plates (Nunc A/S, Roskilde, Denmark) at the indicated concentrations (50 μΐ/well) diluted in 25 mM Tris pH 8 and 150 mM NaCl. Well surfaces were blocked for 2 h at room temperature (RT) with 1 % nonfat milk in the same buffer. Enriched iRBCs were suspended at 5x106 ml-1 in HBSS supplemented with 1 mM CaCk, 1 mM MgCk and 10 mM Hepes (pH 6.8). The CBPs-HEK293 transfectants to be tested were first labelled with 1 mM 5(6) carboxyf uorescein diacetate succinimidyl ester (Interchim, Montlucon, France). Before addition, enriched iRBCs and CBPs-HEK293 transfectants were treated or not for 15 min at RT with 500 nM CX3CL1 or CCL2, or with 0.5 μ^πιΐ of the different Abs. Alternatively, the wells with the immobilized CX3CL1 chemokine were incubated with peptides CBPl-EC and CBP2-EC as well as CBPl-ECrd and CBP2-ECrd at 0.1 μΜ.
The cells (1.5xl06 iRBCs or 104 HEK293 cells per well) were then added and incubated 1 h at 37°C and exactly quantified by measurements of nine different fields per well at 415 nm for iRBCs and 530 nm for HEK293 cells (Flexstation 3, Molecular Devices, Sunnyvale, USA). After washing to remove the non-adherent cells as described as previously (Hermand et al, 2000), the number of adherent cells was calculated as a ratio to the total number of cells loaded in each well, determined by the a new absorbance/fluorescence evaluation and expressed as number of adherent cells per mm2, knowing that the well surface is 0.32 mm2. In experiments evaluating inhibition of iRBC adherence by antibodies and peptides to normalize several experiments, the number of adherent cells was expressed as % of the control, i.e. the number of adherent iRBC on coated CX3CL1 (50 pmoles/well)..
Flow adherence assay
The day prior the assay, CX3CL1-L929 trans fectant and parental cells (104 cells in 20 μΐ DMEM containing 10% FCS) were platted in IbiTreat -^-SlideVI (Ibidi Biovalley, Marne La Vallee, France). The slide was set on the stage of an inverted microscope (TE300, Nikon, Champigny, France) equipped with a phase contrast 10x objective (Nikon, n.a. 0.25) and a cooled CCD camera (Sensicam, PCO, Kelheim, Germany). iRBC (parasitemia superior to 80 %) were resuspended in flow buffer HBSS (GE Healthcare Europe, Velizy- Villacoublay, France) supplemented with 1 mM CaCk, 1 mM MgCk (pH 6.8) at 5xl06mL_1
and incubated 15 min at 37°C in the presence or not or 0,5 μΜ CX3CL1 or CCL2. A syringe pump (PHD 2000; Harvard Apparatus, Les Ulis, France) drove 0.5 ml of iRBC suspension through the IbiTreat slide at a wall shear stress of 0.27 dynes. cm-2. The 37°C temperature was controlled all over the experiment. After a 10-min wash at 0.27 dynes. cm 2, images of fifteen 0.57 mm2 separate fields were recorded to count the adherent cells. The results were expressed as mean ± SD per mm2.
Fluorescence imaging
To prevent nonspecific staining, the rabbit sera diluted were adsorbed on fresh normal human 0+ red blood cells. In order to explore proteins at the membrane surface, unfixed iRBCs were used in liquid phase Pellets (5 μΐ) of cultured iRBC were incubated for 45 min at RT with 100 μΐ of serum diluted 5 times in PBS supplemented with 2 % BSA and 100 μg/ml Hoechst reagent. After washing with PBS supplemented with 2 % BSA, antibodies were detected with Alexafluor 488 conjugated goat anti-rabbit IgG (Life Technologies). Immunofluorescence staining was analyzed with a direct microscope (BX51, Olympus, Rungis, France).
Fluorescence imaging of the HEK293 clones expressing the CBP candidates as EYFP chimera was performed on Lab-Tek II slides (Nunc, Dutscher) after fixation (PFA 4%, 30 min 4°C) using an Olympus IX81-ZDC2 inverted microscope equipped for Total Internal Reflection fluorescence (TIRF). Digital images were captured on a cooled charge-coupled device (CCD) camera (ORCA-ER, Hamamatsu, Massy, France).
Statistical analysis
Data are expressed as mean and standard deviations of replicates as indicated in the legend of figures. Analysis of variance (ANOVA) followed by post hoc analysis with Tukey test was performed using Prism 5.2 (GraphPad Software, San Diego, California, USA) to establish the levels of significance: * p < 0.05, ** p < 0.005, *** p < 0.005.
EXAMPLE: 2
Results Malaria application
Unselected, mature Plasmodium falciparum- infected RBC bind specifically to CX3CL1
RBC infected with mature forms (late trophozoite and schizont) of the 3D7 strain of P. falciparum significantly adhered to the immobilized CX3CL1 protein in a static adhesion assay (Figure 1A) while those infected with parasites at the early stages did not display specific adherence to CX3CL1. So we decided to work with enriched mature RBC infected
with the 3D7 strain (3D7-iRBC). Their adherence was also observed in a flow assay using the L929 fibroblastic cell line that either did or did not express CX3CL1. We saw that 3D7- iRBCs specifically adhered to the CX3CL1 -positive L929 clone, while no adherence was observed on parental cells that did not express CX3CL1 (Figure IB). Pre -incubating 3D7- iRBC with soluble CX3CL1 inhibited the adherence, while preincubation with the chemokine CCL2 had no effect (Figure IB). To further investigate the specificity and selectivity of the 3D7-iRBC adherence, we used a static assay that allows numerous simultaneous conditions. Indeed, we found that 3D7-iRBC adhered to immobilized CX3CL1, while non-infected RBC did not (Figure 1C). Furthermore, this specific adherence was dosedependent (Figure ID) and saturation was reached at 25 pmoles of CX3CL1 per well. Moreover, 3D7-iRBC did not bind to CCL2 (Figure 1C). Finally, we found that several rounds of selection of 3D7-iRBC on CX3CL1 -expressing L929 did not result in the selection of a subpopulation of iRBC with greater adherence to CX3CLl(data not shown).
Identification of two CBPs expressed at the surface of iRBC
As shown by Hatabu et al. (Hatabu et al, 2003), 3D7-iRBC adherence is significantly decreased in the presence of an anti-CX3CRl antibody. In comparison, an antibody raised against DARC (Duffy Antigen Receptor for Chemokines), which is an antigen expressed by both uninfected and infected RBC (Tournamille et al, 2004), had no effect on adherence (Figure 2A). We therefore hypothesized that the anti-CX3CRl antibody could recognize a parasitic component expressed on the surface of 3D7-iRBC, which likely shares structural features with CX3CR1. Several proteins were recognized by the anti-CX3CRl antibody in the extract of 3D7-iRBC membranes; however only one band at 20-25 kDa (Figure 2B left, arrow) was absent from the membranes of uninfected RBC. Peptides from trypsin-digested extracts of the corresponding ID gel band from both uninfected and infected RBC (Figure 2B right, arrow) were analyzed by mass spectrometry (LC-MS/MS) and their sequences were compared to those of proteins encoded by Plasmodium genomes in PlasmoDB. Among the hits with significant scores found only in the ID gel band from iRBC, we selected the corresponding genes coding for proteins with a 20-35 kDa molecular mass and containing a Pexel motif (Marti et al, 2004) or VTS (Vacuolar transport signal) (Hiller et al, 2004), assuming that the potential CX3CL1 ligand should be expressed at the external iRBC membrane (Table 1). These five genes have only one intron but different chromosomal locations. Three of these genes encode for proteins containing a signal peptide and two potential transmembrane domains, similar to most of the Pexel/VTS-containing proteins (Lavazec et al, 2006).
The five candidate genes were then cloned as fusion proteins with YFP (Yellow fluorescent protein) in HEK293 cells that do not adhere to CX3CL1 or CCL2. The five HEK293 clones expressed the YFP fusion proteins at their cell surface (Figure 3A), as observed using wide field fluorescence (Figure 3A,). Functional adhesion tests revealed that two candidate cell clones, PF3D7 0113900 and PF3D7 1301700, specifically adhered to immobilized CX3CL1 while three others did not (Figure 3B). For simplicity, PF3D7 0113900 and PF3D7 1301700 are herein referred to CBPl and CBP2. Adherence of the CBPl- and CPB2-expressing HEK293 clones was dose-dependent (data not shown) and specific for CX3CL1 (data not shown). In addition to the 3D7 reference strain, transcripts of both cbpl and cbp2 genes were present in samples prepared from the peripheral blood samples of seven patients infected in various African locations (data not shown).
CBPl and CBP2 are unique, homologous, monogenic exported proteins with two transmembrane domains, and are expressed on the external surface of iRBC
According to PlasmoDB, CBPl and CBP2 are monogenic proteins of 243 and 245 amino acids in length, respectively. They are encoded by single-copy genes and their sequences share 32% identity (Table 1, Figure 4), making them the only two members of the hypothetical family of Plasmodium exported protein called "hyp8" (PlasmoDB) (Freeh & Chen, 2013). Similar to all Pexel-containing genes, cbpl and cbp2 contain one intron flanked by two exons; there are no homologs in the 3D7 genome and no orthologs in genomes of other Plasmodium strains/species. Both CBPl and CBP2 have a signal peptide (hence their calculated molecular masses without signal peptide of 25320 Da and 25328 Da, respectively) and two short 9- and 12-amino acid extracellular domains. Their topology may be similar to STEVOR, RIFIN and PfMC-2TM, in that both N- and C-termini are intracellular (Lavazec et al, 2006). Of all the available sequences in the PlasmoDB, the cbpl gene has 49 singlenucleotide polymorphisms (SNP) and among them 41 are synonymous; cbp2 has 15 SNP among them 13 are synonymous. Remarkably, the non- synonymous SNP of both genes exist outside the regions encoding for the transmembrane and extracellular domains.
We next raised rabbit polyclonal antibodies against peptides corresponding to the sequences of the short central domains of CBPl and CBP2 located between the two transmembrane domains (Figure 4). In 3D7-iRBC membrane lysates, both anti-CBPs antibodies specifically recognized a 25 kDa band (Figure 5A, arrows), that matched in size to the band stained by the anti-CX3CRl serum (Figure 2 left, arrow). RBC infected with mature - but not immature -forms of 3D7 using the anti-CBPl and anti-CBP2 antibodies showed a
peripheral staining (Figure 5B and 5C) reminiscent of a typical PfEMPl surface staining on iRBC.
Finally, these anti-CBPl and anti-CBP2 antibodies were used to stain iRBC samples from a patient after a maturation period of 24 hours in vitro (Figure E4). This showed that CBPl and CBP2 are expressed at the surface of iRBC during natural infection. Taken together, these data strongly suggest that CBPl and CBP2 parasitic proteins are expressed at the external membrane of the iRBC and that the antibodies raised against their potential extracellular domain recognized their respective target.
Anti-CBP antibodies and CBP-EC peptides inhibit iRBC binding to CX3CL1 Anti-CBPl and anti-CBP2 antibodies inhibited the adherence of 3D7-iRBC to immobilized CX3CL1 by 33% and 38% respectively i.e. at a similar level to the anti- CX3CR1 antibody (Figure 6A), while a control rabbit antibody did not have any effect on adherence. When anti-CBP antibodies were incubated simultaneously, the inhibitory effect on adherence was not enhanced. Similarly, incubating the anti-CX3CRl with either of the anti- CBP antibodies, we did not observe any change in the inhibitory effect (Figure 6A). Along with surface staining (Figures 5B and 5C), these observations provided additional evidence to support that CBPl and CBP2 were both expressed at the surface of iRBC, and that the short central domains were accessible to antibodies and can act as external ligands to host receptors.
We thus hypothesized that peptides corresponding to the predicted extracellular domain (EC) of each CBP (called CBPl -EC and CBP2-EC, Figure 4) could directly bind to CX3CL1 thereby inhibiting iRBC adherence. Both CBPl -EC and CBP2-EC peptides ignificantly inhibited iRBC adherence to CX3CL1 by 41-48% (Figure 6B), while their random counterparts (CBPl-EC-rd, CBP2-ECrd, i.e. peptides with the same residues in a different order) had no such effect. Lastly the simultaneous addition of both CBPl -EC and CBP2-EC peptides did not enhance this inhibition.
Knowing that chemokines are of basic nature, we infer their binding to the CBP-EC could be facilitated by the presence of additional acidic residues. So we mutated the basic residues of CBP-EC (Xaa4, Xaa5, Xaa8 and XaalO) in either acidic residues (D) or neutral ones (A). These replacements did not change significantly the potency of the CBP-EC peptides on the iRBC adhesion to CX3CL1 (Figure 7).
DISCUSSION
We report here on two parasitic proteins CBPl and CBP2 that act as P. falciparum ligands to CX3CL1, thereby contributing to cytoadherence of iRBC. CBPs are coded by
genes of the P. falciparum 3D7 reference strain and also in field isolates, as demonstrated by the detection of mRNA transcripts in all patient samples analyzed to date (data not shown). Anti-CBPl and anti-CBP2 antibodies stained the surface of iRBC from a patient as well as 3D7-iRBC (Figures 5B and 5C), suggesting that both CBPl and CBP2 are expressed at the surface of iRBC.
The intensity of iRBC adherence to immobilized CX3CL1 reached a plateau at 25 pmol of CX3CL1 per well. This concentration is very close to that of CD36 and ICAM-1, which supports optimal in vitro static adherence of 3D7-iRBC (Gray et al, 2003). This CX3CL1- mediated cytoadherence is at least partially mediated by CBPl and CBP2, since peptides corresponding to their predicted extracellular domains (called CBPl -EC and CBP2- EC), inhibit the binding of iRBC to CX3CL1 (Figure 6B) as do anti-CBPl and anti-CBP2 antibodies directed against these short domains (Figure 6A). Similar to the majority of described P. falciparum Pexel/VTS-containing genes, the cbpl and cbp2 transcripts are present early in erythrocyte development, while proteins are expressed later at trophozoite and schizont stages, according to PlasmoDB. We showed here that both are expressed at iRBC surface at the late stages (Figures 5B and 5C). Our work confirms and extends a previous proteomics approach showing the expression of CBPl (PF3D7 0113900) at the surface of iRBC (Florens et al, 2004). This expression profile was consistent with the iRBC adherence to CX3CL1 primarily observed by Hatabu et al. (Hatabu et al, 2003), so it is likely that CPB1 and CBP2 are at least partially responsible of the cytoadherence phenotype observed by this group.
Finally, both proteins have been shown to be putatively exported protein in early gametocyte proteome (Silvestrini et al, 2010), are hence named GEXP10 and GEXP07 (Table 1) and could contribute to the gametocyte sequestration. Interestingly, immature gametocytes accumulate in the extravascular spaces of the human bone marrow (Farfour et al, 2012; Joice et al, 2014; Sinton et al, 1926) and it is known that CX3CL1 is well expressed in bone marrow stromal cells (Honczarenko et al, 2006), where it contributes to the retention of monocytes (Jacquelin et al, 2013). So CX3CL1 could arguably contribute to the gametocyte accumulation in specific body sites, including bone marrow.
The exact motif responsible for CBPs binding to CX3CL1 of CBPs remains to be indisputably identified. Interestingly however, cytoadherence-inhibiting-EC domains of CBPl and CBP2 short TXN motif (TEN in CX3CR1, TLN in CBPl and TNN in CBP2). The multiple asparagine residues in the extracellular domain of CBPs are not expected to bind to basic proteins like chemokines. The replacements of these basic residues by acidic ones
(Figure 7) did not induce significant changes in the inhibitory activity of the peptides. Furthermore simultaneous incubation with both CBP1-EC and CBP2-EC peptides (Figure 6B) did not lead to any synergistic inhibition (compared to the single-peptide effect) and suggested that both peptides bind to the same site on the CX3CL1 protein. Beyond the context of malaria infection, CBP1-EC and CBP2-EC peptides are very interesting potential hits to initiate the identification of a CX3CL1 -specific "neutraligand" (a molecule directly neutralizing the chemokine but not antagonizing the cognate receptor), as recently described for CXCL12 (Galzi et al, 2010; Hachet-Haas et al, 2008). In analogy with ICAM1 as a host-receptor for P. falciparum cytoadherence, CX3CL1 expression is induced on endothelia by inflammation (Fong et al, 1998; Harrison et al, 1999). This could facilitate the cytoadherence of additional iRBC through CBP-CX3CL1 interaction once the malaria infection has triggered inflammation (Avril et al, 2012; Claessens et al, 2012; Lavstsen et al, 2012). Whether CBPs act independently from the dominant P. falciparum ligand for cytoadherence PfEMPl, or rather in combination with it as a co-ligand, remains to be elucidated.
Although CBP1 and CBP2 induce an iRBC phenotype similar to that induced by PfEMPl (translation at the ring stage, surface expression and cytoadherence at the mature stage), they differ markedly regarding their structural and genetic features. Our staining (Figure 5B) and functional data (Figure 6A) using antibodies strongly suggest that the N- and the C-terminus of CBP1 and CBP2 are intracytoplasmic (Figure 4) leaving only short 9- or 12-amino acid domains exposed at the external side of the host red blood cell. In comparison, the PfEMPl ectodomain is large (250-350 kDa) and built from a combination of multiple domains (Smith et al, 2000). By Western blot (Figure 5A, left panel), anti-CBP antisera recognized proteins markedly smaller than 200 kDa, thus unequivocally different from PfEMPl . This is consistent with binding assays (Janes et al, 2011) ruling out the intervention of PfEMPl in the adherence phenotype to CX3CL1. Our experiment showing that selection produced no increase in binding (data not shown) supports the same conclusion. The simplest explanation for the Western blot results with anti-CBP antisera on iRBC membrane lysates (Figure 5 A) is that the 50, 70 and 110 kDa bands represent multimers of the 20-25 kDa CBPs.
The PfEMPl family is encoded by the highly diverse and polymorphic var gene family associated with very broad antigenic diversity. In striking contrast, CBPs are monogenic members of a small family and exhibit no variant in their extracellular domain (PlasmoDB), which is consistent with the fact that we could not select for a subpopulation of
iRBC with higher binding affinity even after several cycles of panning(data not shown). PfEMPl antigens are highly immunogenic; however intra-clonal diversity and poorly overlapping antigenic repertoires between clones/strains is a major drawback in vaccine development. Conversely, CBPs are constitutively expressed and monogenic and, as such, expected to be poorly immunogenic. The existence of a constitutively expressed, highly immunogenic antigen would have indeed turned P. falciparum malaria, an infection against which immunity is acquired very slowly, into a single-episode disease. If the putative poor immunogenicity of CBPs can be circumvented by an innovative vaccine design, the final outcome may have a major impact on vaccine-induced control of P. falciparum malaria.
In conclusion, the identification of parasite ligands for the endothelial CX3CL1 offers new ways to prevent malaria, and provides a novel, non-polymorphic target on iRBC that could be used for vaccination, a long-awaited weapon in times of increasing parasite resistance to antimalarial agents (Ariey et al, 2014; Dondorp et al, 2011). Table 1: Characteristics of the first five parasite proteins (20-35 kDa, PEXEL positive) selected using proteomics as potential CBPs
EXAMPLE 3: Effects of CBP-EC peptides in vivo in inflammatory disease
The Seql and Seq2 peptides correspond to the external domain of the two invariant parasite ligands of CX3CL1, a chemokine mediating cytoadherence of Plasmodium falciparum-infected erythrocytes. These peptides were assayed as "neutraligands", i.e. molecules binding the ligand CX3CL1 to inhibit its binding to its receptor CX3CR1. The CX3CR1/CX3CL1 axis is known to contribute to the recruitment of monocytes to inflammatory sites [Fong AM et al 1998, Auffray C et al 2009, Poupel L et al 2013] to sequester monocytes in the bone marrow (BM) [Jacquelin S et al 2013] and to induce macrophage survival [Kim K-W et al 2011].
We tested here Seql and Seq2 peptides in two preclinical models of non-infectious peritonitis, a short-term one (LPS-induced, Figure 8) and a long term one (thioglycolate- induced, Figure 9))
LPS-induced peritonitis
This model consists in injecting LPS or PBS for control in the peritoneum immediately after the intravenous injection of the peptides (10(^g) or PBS for control. After 4h, the mice are sacrificed and the inflammatory monocytes in peritoneal fluid are analysed by flow cytometry. When injected intraperiteonally (IP), LPS induced after 4h, the recruitment of inflammatory monocytes from the BM. As show in Figure 8, this recruitment is significantly increased in the presence of Seql peptide and reaches a level similar to the recruitment observed in the CX3CR1-/- animals. This recruitment results in a greater accumulation of inflammatory monocytes in the peritoneum as compared to mice treated with the control peptide (Rd-Seql) i.e. the Seql peptide with the same residues in a different order.
Thioglycolate-induced peritonitis
This model consists in injecting thioglycolate in the peritoneum at DO. At Dl, the peptides are IP injected (3 x 30 μg) and at D2, the mice are sacrificed and the monocytes in peritoneal liquid are analysed by flow cytometry.
In the presence of Seql or Seq2, the number of inflammatory and patrolling monocytes is significantly decreased as compared to the number of corresponding monocytes in the presence of the Rd version of the same peptides (see Figure 9). Consequently Seql and Seq2 peptides reduce the CX3CR1 -driven accumulation of monocytes in the inflammatory site and could probably act on the survival of macrophages.
Both of these in vivo effects of the CBP-EC peptides are presumably caused by a decrease CX3CL1 -driven chemotaxis. We finally checked directly this activity in vitro (Figure 10) using CHO clone cells stably expressing CX3CR1. We indeed found that the cognate chemotaxis was significantly inhibited by the CBP-EC peptides, while their "random" versions had no effect.
In conclusion, we have found short peptides that are able to specifically inhibit the function of the CX3CL1/CX3CR1 by binding to the CX3CL1 ligand, hence their generic
name "neutraligand". Beyond of dissecting the exact nature of the CX3CL1-CX3CR1 bindign sites, these peptides represent useful potential anti-inflammatory compounds, that could complement the CX3CR1 antagonists (Dorgham, K., A. Ghadiri, P. Hermand, M. Rodero, L. Poupel, M. Iga, O. Hartley, G. Gorochov, C. Combadiere and P. Deterre (2009). "An engineered CX3CR1 antagonist endowed with anti-inflammatory activity." J Leukoc Biol 86(4): 903-11; Karlstrom, S., G. Nordvall, D. Sohn, A. Hettman, D. Turek, K. Ahlin, A. Kers, M. Claesson, C. Slivo, Y. Lo-Alfredsson, C. Petersson, G. Bessidskaia, P. H. Svensson, T. Rein, E. Jerning, A. Malmberg, C. Ahlgen, C. Ray, L. Vares, V. Ivanov and R. Johansson (2013). "Substituted 7-amino-5-thio-thiazolo[4,5-d]pyrimidines as potent and selective antagonists of the fractalkine receptor (CX3CR1)." Journal of Medicinal Chemistry 56(8): 3177-90 ; Poupel, L., A. Boissonnas, P. Hermand, K. Dorgham, E. Guyon, C. Auvynet, F. S. Charles, P. Lesnik, P. Deterre and C. Combadiere (2013). "Pharmacological inhibition of the chemokine receptor, CX3CR1, reduces atherosclerosis in mice." Arterioscler Thromb Vase Biol 33(10): 2297-305.)
Table 2: Useful amino acid sequences for practicing the invention
SEQ ID NO Nucleotide or amino acid sequence
1 (CBP1-EC) STLNLKNEN
2 (CBP2-EC) SKFTNNMLAIAG
3 (CBP1-EC-AA) STLALKAEA
4 (CBP1-EC-DD) STLDLKDED
5 (CBP2-EC-AA) SKFTAAMLAIAG
6 (CBP1-EC-DD) SKFTDDMLAIAG
7 (synthetic peptide CBP1-EC for LSTLNLKNEN
immunisation)
8 (synthetic peptide CBP2-EC for AATSKFTNNMLAIAGVG
immunisation)
9 (CBP1 polypeptide or PfGEXPIO) MNIYIRTIFFAPFICLLIFSSNHGLFQKKDNQNC
NSHKFCLNCSGSYLKNSRWLSETSVSYSDEGEP LKYG ANDNN YD SNLLKSEEQKQEI SEHMKMLI KL YID S SHD S AKEEKLFQ Q VKKYFKNNE YKDF MRTFIKVIKIHNDLTHLKKQMASTEKRYRIISC VAAFLSTVSLAFTVVMLSTLNLKNENVIVTIIL GLLGFIISLPVISYILSPYLNSSLEKGYRIADLYSE KILRQILHFQ
10 (CBP2 polypeptide or PfGEXP07) MSFCYVRTISIALFLFIFLFLNNGNFKNNFYRKD
NKYSSIKIRSFRSLAENQKVETEQSTPAKPEPTE
FVNNDIHQNKNTFKKLKNNEKKKEILEEKMKD
FVKLYVNKSSGECQRYRLQQHLKNYSSSNEYK
KFMNKF VKFLKVHNDLN ALKS QLHFNN VRAA
TIIFIAGFLSIFAILLTISAVAATSKFTNNMLAIA
GVGALGSALSLPGMALLFVPAMLYVLNRK EI
TNHYSERIIKQVSNF
11 (CBP1-EC with cysteine) CSTLNLK ENC
12 (CBP2-EC with cysteine) CSKFTNNMLAIAGC
13 cyclic CBP1-EC CSTLNLKNENC
1 1
14 cyclic CBP2-EC CSKFTNNMLAIAGC|
15 random peptides CBP1-EC NLETNSKNL
16 random peptides CBP2-EC MATGSAKNLFNI
17 random peptides CBP1-EC-AA ALETASKAL
18 random peptides CBP1-EC-DD DLETDSKDL
19 random peptides CBP2-EC-AA MATGSAKALFAI
20 random peptides CBP2-EC-DD MATGSAKDLFDI
EXAMPLE 4 :
CBP extracellular peptides directly and specifically interact with CX3CL1.
The inventors demonstrated that peptides corresponding to the predicted extracellular domain (EC) of each CBP (called CBP 1 -EC and CBP2-EC) could directly bind to CX3CL1. This assertion was borne out using fluorescent version of the CBP-EC peptides. While the fluorescence of CBP 1 -EC and CBP2-EC only slightly increased in the presence of the control chemokine (CCL2, empty bars), it was significantly enhanced in the presence of CX3CL1 (filled bars) (Figure 1 1). By contrast, this increase was minimal using the random counterparts of the CBP-EC peptides (CBPl-EC-rd, CBP2-ECrd, i.e. peptides with the same residues in a different order) (Figure 1 1). So the interaction between CBP and CX3CL1 appears to be direct and specific of the chemokine on one hand and of the CBP-EC sequence on the other hand. The anti-CBPl and anti-CBP2 antibodies stain specifically the gamatocytes.
The inventors also demonstrated that anti-CBPl and anti-CBP2 stain specifically the gamatocytes. The inhibition of the interaction between CBP1/CBP2 and CX3CL1 by the peptides and antibodies of the invention may inhibit gamatocytes maturation by inhibiting their sequestration in the bone marrow. These results demonstrate that the peptides and antibodies of the invention may be used in the treatment of Malaria, as well as in the inhibition of human-to-mosquito transmission.
REFERENCES:
Throughout this application, various references describe the state of the art to which this invention pertains. The disclosures of these references are hereby incorporated by reference into the present disclosure.
Ariey F, Witkowski B, Amaratunga C, Beghain J, Langlois AC, Khim N, Kim S, Duru V, Bouchier C, Ma L, Lim P, Leang R, Duong S, Sreng S, Suon S, Chuor CM, Bout DM, Menard S, Rogers WO, Genton B, Fandeur T, Miotto O, Ringwald P, Le Bras J, Berry A, Barale JC, Fairhurst RM, Benoit-Vical F, Mercereau-Puijalon O, Menard D (2014) A molecular marker of artemisinin-resistant Plasmodium falciparum malaria. Nature 505: 50-55
Avril M, Tripathi AK, Brazier AJ, Andisi C, Janes JH, Soma VL, Sullivan DJ, Jr., Bull PC, Stins MF, Smith JD (2012) A restricted subset of var genes mediates adherence of Plasmodium falciparum-infected erythrocytes to brain endothelial cells. Proc Natl Acad Sci USA 109: E1782-1790
Auffray C, Fogg DK, Narni-Mancinelli E, Senechal B, Trouillet C, et al. (2009)
CX3CR1+ CD115+ CD135+ common macrophage/DC precursors and the role of CX3CR1 in their response to inflammation. J Exp Med 206: 595-606.
Baggiolini M (1998) Chemokines and leucocyte traffic. Nature 392: 565-568
Bignami A, Bastiannelli G (1890) Osservazioni suile febbri malariche estive- autunnali. La Riforma Medica 232: 1334-1335
Brabin BJ, Romagosa C, Abdelgalil S, Menendez C, Verhoeff FH, McGready R, Fletcher KA, Owens S, dAlessandro U, Nosten F, Fischer PR, Ordi J (2004) The Sick Placenta— The Role of Malaria. Placenta 25: 359-378
Bray RS, Sinden RE (1979) The sequestration of Plasmodium falciparum infected erythrocytes in the placenta. Trans R Soc Trop Med Hyg 73: 716-719
Buffet PA, Safeukui I, Milon G, Mercereau-Puijalon O, David PH (2009) Retention of erythrocytes in the spleen: a double-edged process in human malaria. Curr Opin Hematol 16: 157-164
Cammas L, Reinaud P, Dubois O, Bordas N, Germain G, Charpigny G (2005) Identification of Differentially Regulated Genes During Elongation and Early Implantation in the Ovine Trophoblast Using Complementary DNA Array Screening. Biology of Reproduction 72: 960-967
Claessens A, Adams Y, Ghumra A, Lindergard G, Buchan CC, Andisi C, Bull PC, Mok S, Gupta AP, Wang CW, Turner L, Arman M, Raza A, Bozdech Z, Rowe JA (2012) A
subset of group A-like var genes encodes the malaria parasite ligands for binding to human brain endothelial cells. Proc Natl Acad Sci USA 109: El 772- 1781.
Dondorp AM, Fairhurst RM, Slutsker L, Macarthur JR, Breman JG, Guerin PJ, Wellems TE, Ringwald P, Newman RD, Plowe CV (2011) The threat of artemisinin-resistant malaria. N Engl J Med 365: 1073-1075
Farfour E, Charlotte F, Settegrana C, Miyara M, Buffet P (2012) The extravascular compartment of the bone marrow: a niche for Plasmodium falciparum gametocyte maturation? Malaria journal 11 : 285
Florens L, Liu X, Wang Y, Yang S, Schwartz O, Peglar M, Carucci DJ, Yates JR, 3rd, Wub Y (2004) Proteomics approach reveals novel proteins on the surface of malaria-infected erythrocytes. Mol Biochem Parasitol 135: 1-11
Fong AM, Robinson LA, Steeber DA, Tedder TF, Yoshie O, Imai T, Patel DD (1998) Fractalkine and CX3CR1 mediate a novel mechanism of leukocyte capture, firm adhesion, and activation under physiologic flow. JExpMed 188: 1413-1419
Freeh C, Chen N (2013) Variant surface antigens of malaria parasites: functional and evolutionary insights from comparative gene family classification and analysis. BMC Genomics 14: 427
Galzi J-L, Hachet-Haas M, Bonnet D, Daubeuf F, Lecat S, Hibert M, Haiech J, Frossard N (2010) Neutralizing endogenous chemokines with small molecules: Principles and potential therapeutic applications. Pharmacology and Therapeutics 126: 39-55
Gray C, McCormick C, Turner G, Craig A (2003) ICAM-1 can play a major role in mediating P. falciparum adhesion to endothelium under flow. Mol Biochem Parasitol 128: 187-193
Hachet-Haas M, Balabanian K, Rohmer F, Pons F, Franchet C, Lecat S, Chow KYC, Dagher R, Gizzi P, Didier B, Lagane B, Kellenberger E, Bonnet D, Baleux F, Haiech J, Parmentier M, Frossard N, Arenzana-Seisdedos F, Hibert M, Galzi J-l (2008) Small Neutralizing Molecules to Inhibit Actions of the Chemokine CXCL12. J Biol Chem 283: 23189-23199
Harrison JK, Jiang Y, Wees EA, Salafranca MN, Liang HX, Feng L, Belardinelli L (1999) Inflammatory agents regulate in vivo expression of fractalkine in endothelial cells of the rat heart. J Leukoc Biol 66: 937-944
Hatabu T, Kawazu S, Aikawa M, Kano S (2003) Binding of Plasmodium falciparum- infected erythrocytes to the membrane-bound form of Fractalkine/CX3CL1. Proc Natl Acad Sci USA 100: 15942-15946.
Hermand P, Huet M, Callebaut I, Gane P, Ihanus E, Gahmberg CG, Cartron JP, Bailly P (2000) Binding sites of leukocyte beta 2 integrins (LFA-1, Mac-1) on the human ICAM- 4/LW blood group protein. J Biol Chem 275: 26002-26010.
Hermand P, Pincet F, Carvalho S, Ansanay H, Trinquet E, Daoudi M, Combadiere C, Deterre P (2008) Functional Adhesiveness of the CX3CL1 Chemokine Requires Its Aggregation: role of the transmembrane domain. J Biol Chem 283: 30225-30234
Hiller NL, Bhattacharjee S, van Ooij C, Liolios K, Harrison T, Lopez-Estrano C, Haldar K (2004) A host-targeting signal in virulence proteins reveals a secretome in malarial infection. Science 306: 1934-1937
Honczarenko M, Le Y, Swierkowski M, Ghiran I, Glodek AM, Silberstein LE (2006)
Human Bone Marrow Stromal Cells Express a Distinct Set of Biologically Functional Chemokine Receptors. Stem Cells 24: 1030-1041
Jacquelin S, Licata F, Dorgham K, Hermand P, Poupel L, Guyon E, Deterre P, Hume DA, Combadiere C, Boissonnas A (2013) CX3CR1 reduces Ly6Chigh-monocyte motility within and release from the bone marrow after chemotherapy in mice. Blood 122: 674-683
Janes JH, Wang CP, Levin-Edens E, Vigan-Womas I, Guillotte M, Melcher M, Mercereau-Puijalon O, Smith JD (2011) Investigating the host binding signature on the Plasmodium falciparum PfEMPl protein family. PLoS pathogens 7: el 002032
Joice R, Nilsson SK, Montgomery J, Dankwa S, Egan E, Morahan B, Seydel KB, Bertuccini L, Alano P, Williamson KC, Duraisingh MT, Taylor TE, Milner DA, Marti M (2014) Plasmodium falciparum transmission stages accumulate in the human bone marrow. Science Translational Medicine 6: 244re245
Kirchgatter K, Del Portillo HA (2005) Clinical and molecular aspects of severe malaria. An Acad Bras Cienc 77: 455-475
Kim K-W, Vallon-Eberhard A, Zigmond E, Farache J, Shezen E, et al. (2011) In vivo structure/function and expression analysis of the CX3C chemokine fractalkine. Blood 118: el56-el67
Lavazec C, Sanyal S, Templeton TJ (2006) Hypervariability within the Rifin, Stevor and Pfmc-2TM superfamilies in Plasmodium falciparum. Nucleic Acids Res 34: 6696-6707 Lavstsen T, Turner L, Saguti F, Magistrado P, Rask TS, Jespersen JS, Wang CW,
Berger SS, Baraka V, Marquard AM, Seguin-Orlando A, Willerslev E, Gilbert MT, Lusingu J, Theander TG (2012) Plasmodium falciparum erythrocyte membrane protein 1 domain cassettes 8 and 13 are associated with severe malaria in children. Proc Natl Acad Sci U S A 109: E1791-1800
Marti M, Good RT, Rug M, Knuepfer E, Cowman AF (2004) Targeting malaria virulence and remodeling proteins to the host erythrocyte. Science 306: 1930-1933
Mebius RE, Kraal G (2005) Structure and function of the spleen. Nat Rev Immunol 5: 606-616
Moser B, Loetscher P (2001) Lymphocyte traffic control by chemokines. Nat
Immunol 2: 123-128.
Pasvol G, Wilson RJ, Smalley ME, Brown J (1978) Separation of viable schizont- infected red cells of Plasmodium falciparum from human blood. Ann Trap Med Parasitol 72: 87-88
Planche T, Dzeing A, Ngou-Milama E, Kombila M, Stacpoole PW (2005) Metabolic complications of severe malaria. Curr Top Microbiol Immunol 295: 105-136
Poupel L, Boissonnas A, Hermand P, Dorgham K, Guyon E, et al. (2013)
Pharmacological inhibition of the chemokine receptor, CX3CR1, reduces atherosclerosis in mice. Arterioscler Thromb Vase Biol 33: 2297-2305
Rot A, Von Andrian UH (2004) Chemokines in Innate and Adaptive Host Defense:
Basic Chemokinese Grammar for Immune Cells. Ann Rev Imm 22: 891-928.
Rowe JA, Claessens A, Corrigan RA, Arman M (2009) Adhesion of Plasmodium falciparum infected erythrocytes to human cells: molecular mechanisms and therapeutic implications. Expert Rev Mol Med 11 : el 6
Shimoya K, Zhang Q, Tenma K, Ota Y, Hashimoto K, Shizusawa Y, Kimura T,
Koyama M, Murata Y (2003) Fractalkine (FRK) levels in amniotic fluid and its production during pregnancy. Mol Hum Reprod 9: 97-101.
Silvestrini F, Lasonder E, Olivieri A, Camarda G, van Schaijk B, Sanchez M, Younis
Younis S, Sauerwein R, Alano P (2010) Protein Export Marks the Early Phase of Gametocytogenesis of the Human Malaria Parasite Plasmodium falciparum. Molecular &
Cellular Proteomics 9: 1437-1448
Silvestrini F, Tibiircio M, Bertuccini L, Alano P (2012) Differential Adhesive
Properties of Sequestered Asexual and Sexual Stages of <italic>Plasmodium falciparum</italic> on Human Endothelial Cells Are Tissue Independent. PLoS ONE 7: e31567
Sinton JA, Baily JD, Chand D (1926) Studies in malaria, with special reference to treatment Part IV The occurrence of sexual forms of Plasmodium falciparum in the peripheral circulation. Indian J Medical Research 13: 895-916
Smith JD, Rowe JA, Higgins MK, Lavstsen T (2013) Malaria's deadly grip: cytoadhesion of Plasmodium falciparum-infected erythrocytes. Cellular Microbiology 15: 1976-1983
Smith JD, Subramanian G, Gamain B, Baruch DI, Miller LH (2000) Classification of adhesive domains in the Plasmodium falciparum erythrocyte membrane protein 1 family. Mol Biochem Parasitol 110: 293-310
Steck TL, Kant JA (1974) Preparation of impermeable ghosts and inside-out vesicles from human erythrocyte membranes. Methods Enzymol 31 : 172-180
Tarozzo G, Campanella M, Ghiani M, Bulfone A, Beltramo M (2002) Expression of fractalkine and its receptor, CX3CR1, in response to ischaemia-reperfusion brain injury in the rat. Eur J Neurosci 15: 1663-1668.
Tournamille C, Blancher A, Le Van Kim C, Gane P, Apoil PA, Nakamoto W, Cartron JP, Colin Y (2004) Sequence, evolution and ligand binding properties of mammalian Duffy antigen/receptor for chemokines. Immunogenetics 55: 682-694
Trager W, Jensen JB (1976) Human malaria parasites in continuous culture. Science
193: 673-675
Turner L, Lavstsen T, Berger SS, Wang CW, Petersen JE, Avril M, Brazier AJ, Freeth J, Jespersen JS, Nielsen MA, Magistrado P, Lusingu J, Smith JD, Higgins MK, Theander TG (2013) Severe malaria is associated with parasite binding to endothelial protein C receptor. Nature 498: 502-505
Viola A, Luster AD (2008) Chemokines and their receptors: drug targets in immunity and inflammation. Annu Rev Pharmacol Toxicol 48: 171-197 WHO (2011) Malaria, Fact sheet N°94, decembre 201 1. http://wwwwhoint/mediacentre/factsheets/fs094/en/
Zougbede S, Miller F, Ravassard P, Rebollo A, Ciceron L, Couraud PO, Mazier D, Moreno A (2010) Metabolic acidosis induced by Plasmodium falciparum intraerythrocytic stages alters blood-brain barrier integrity. J Cereb Blood Flow Metab
Zujovic V, Benavides J, Vige X, Carter C, Taupin V (2000) Fractalkine modulates TNF-alpha secretion and neurotoxicity induced by microglial activation. Glia 29: 305-315
Claims
1. An isolated peptide comprising an amino acid sequence of formula (I):
Xaal -Xaa2~Xaa3-Threonine-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaal 0-Xaal 1
, wherein :
Xaal is serine (S) or absent;
Xaa2 is lysine (K), or absent;
Xaa3 is serine (S) or Phenylalanine (F);
Xaa4 is leucine (L), asparagine (N), alanine (A), aspartic acid (D) or glutamic acid (E);
Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
Xaa6 is leucine (L), or methionin (M);
Xaa7 is lysine (K) or leucine (L);
Xaa8 is alanine (A), asparagine (N) or aspartic acid (D).
Xaa9 is glutamic acid (E) or isoleucine (I);
XaalO is asparagine (N), alanine (A), aspartic acid (D).
Xaal 1 is Glycine (G), or absent;
2. The isolated peptide according to Claim 1, wherein the peptide is selected from the group consisting of :
(i) the amino acids sequence consisting of STLNLK EN (SEQ ID N 0: 1) ;
(ii) the amino acids sequence consisting of SKFTNNMLAIAG ( SEQ ID NO: 2);
(iii) the amino acids sequence consisting of STLALKAEA (SEQ ID N 0:3)
(iv) the amino acids sequence consisting of STLDLKDED (SEQ ID N 0:4)
(v) the amino acids sequence consisting of SKFTAAMLAIAG ( SEQ ID NO: 5);
(vi) the amino acids sequence consisting of SKFTNNMLAIAG ( SEQ ID NO: 6);
(vii) an amino acid sequence substantially homologous to the sequence of (i), to (vi) preferably an amino acid a sequence at least 80% identical to the sequence of (i) to (vi).
3. The isolated peptide of any one of Claims 1-2 of at most 100 amino-acid.
4. An antibody that specifically binds to an isolated peptide of any one of claims 1 to
5. The antibody according to claim 4 wherein the antibody is polyclonal or monoclonal.
6. A cyclic peptide comprising an amino acid sequence of formula (III):
C-PepXl -Xaal -Xaa2-Xaa3-T-Xaa4-Xaa5-Xaa6-Xaa7-Xaa8-Xaa9-Xaal 0-Xaal 1 -PepX2-C
I I
, wherein:
Xaal is serine (S) or absent;
Xaa2 is lysine (K), or absent;
Xaa3 is Phenylalanine (F) or serine (S);
Xaa4 is asparagine (N), leucine (L), alanine (A), aspartic acid (D) or glutamic acid
(E);
Xaa5 is asparagine (N), alanine (A) or aspartic acid (D);
Xaa6 is methionine (M) or leucine (L);
Xaa7 is leucine (L) or lysine (K);
Xaa8 is alanine (A), asparagine (N) or aspartic acid (D).
Xaa9 is isoleucine (I) or glutamic acid (E);
XaalO is alanine (A), asparagine (N) or aspartic acid (D).
Xaal 1 is Glycine (G) or absent;
"PepXl" and "PepX2" each consists of, one independently from the other, a spacer polypeptide having an amino acid length varying from 0 to 10 amino acid residues.
7. The cyclic peptides according to claim 6 wherein the cyclic peptide is selected from the group consisting of :
CSTLNLK ENC (SEQ ID NO: 13) and
I I
C SKFTNNML AI AGC(SEQ ID NO: 14)
I I
8. A pharmaceutical composition, comprising an isolated peptide according to any one of claims 1 to 3 or an antibody according to claim 4-5, or cyclic peptide according to claim 6-7 and one or more pharmaceutically acceptable excipient.
9. A vaccine composition comprising an isolated peptide according to claims 1-3 or a cyclic peptide according to claim 6-7 and an immunoadjuvant compound.
10. The vaccine composition according to claim 9, wherein said antigenic compound has the following formula (IV) :
NH2-PepNt-[(I)n-PepXn]n-PepCt- COOH (IV),
wherein :
- "PepNt" consists of a polypeptide having an amino acid length varying from 0 to 100 amino acid residues and located at the N-terminal end of the polypeptide of formula (III) ;
- "[(I)n-PepXn]" consists of a polypeptide unit wherein :
- "(1)1" to - "(I)n" each consists of, one independently from each other, a isolated peptide according to any one of claims 1 to 3 and/or cyclic peptide according to claim 6-7 with n being an integer from 1 to 12; and
- "PepXl" to "PepXn" each consists of, one independently from the other, a spacer polypeptide having an amino acid length varying from 0 to 30 amino acid residues, with n being an integer from 1 to 12; and
- n is the number of [(I)n-PepXn] polypeptide units in said polypeptide, with n being an integer from 1 to 12; and
- "PepCt" consists of a polypeptide having an amino acid length varying from 0 to 100 amino acid residues and located at the C-terminal end of the polypeptide of formula (II).
11. The isolated peptide according to claim 1 to 3, the antibody according to claim 4-5, the pharmaceutical according to claim 8, the vaccine composition according to claim 7 to 9, for use for preventing and/or treating Malaria disease.
12. The isolated peptide according to claim 1 to 3, the cyclic peptide according to claim 6, for use for treating inflammatory disease.
13. The isolated peptide for use according to claim 11, the cyclic peptide according to claim 6, wherein the inflammatory disease is selected between acute inflammatory diseases and chronic inflammatory diseases.
14. The isolated peptide for use according to claim 12, wherein said acute inflammatory disease is selected between Systemic Inflammatory Response Syndrome (SIRS), sepsis, peritonitis.
15. The isolated peptide according to claim 1 to 3, the cyclic peptide according to claim
6, for use for treating CX3CL1 associated disease.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP15305731 | 2015-05-15 | ||
| EP15305731.0 | 2015-05-15 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016184784A1 true WO2016184784A1 (en) | 2016-11-24 |
Family
ID=53180679
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2016/060755 Ceased WO2016184784A1 (en) | 2015-05-15 | 2016-05-12 | Peptides including binding domain of plasmodium falciparum proteins (cbp1 and cbp2) to chemokine cx3cl1 |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2016184784A1 (en) |
Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3929758A (en) | 1974-09-12 | 1975-12-30 | Armour Pharma | Cyclization of cysteine-containing peptides |
| US4102877A (en) | 1976-07-28 | 1978-07-25 | Merck & Co., Inc. | Cyclization of peptides |
| US4216141A (en) | 1978-07-19 | 1980-08-05 | The Salk Institute For Biological Studies | Method for cyclization of peptides |
| US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
| US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
| WO1993010152A1 (en) | 1991-11-16 | 1993-05-27 | Smithkline Beecham Biologicals S.A. | HYBRID PROTEIN BETWEEN CS FROM PLASMODIUM AND HBsAG |
| WO2003079746A2 (en) * | 2001-02-05 | 2003-10-02 | Bristol-Myers Squibb Company | A novel human g-protein coupled receptor, hgprbmy14, related to the orphan gpcr, gpr73 |
| WO2006029887A2 (en) | 2004-09-16 | 2006-03-23 | Glaxosmithkline Biologicals Sa | Vaccines comprising plasmodium antigens |
| WO2007003384A1 (en) | 2005-06-30 | 2007-01-11 | Glaxosmithkline Biologicals Sa | Anti-malaria vaccine |
| US20070184015A1 (en) | 2006-02-03 | 2007-08-09 | Soonkap Hahn | Novel PEGylation agent |
| WO2009021931A1 (en) | 2007-08-13 | 2009-02-19 | Glaxosmithkline Biologicals S.A. | Vaccines |
| WO2009080715A2 (en) | 2007-12-21 | 2009-07-02 | Glaxosmithkline Biologicals S.A. | Vaccines for malaria |
| WO2009094726A1 (en) * | 2008-02-01 | 2009-08-06 | The Walter And Eliza Hall Institute Of Medical Research | Plasmodial polynucleotides, proteins and uses thereof |
| WO2015038708A1 (en) | 2013-09-12 | 2015-03-19 | Stc.Unm | Malaria vaccine |
-
2016
- 2016-05-12 WO PCT/EP2016/060755 patent/WO2016184784A1/en not_active Ceased
Patent Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3929758A (en) | 1974-09-12 | 1975-12-30 | Armour Pharma | Cyclization of cysteine-containing peptides |
| US4102877A (en) | 1976-07-28 | 1978-07-25 | Merck & Co., Inc. | Cyclization of peptides |
| US4216141A (en) | 1978-07-19 | 1980-08-05 | The Salk Institute For Biological Studies | Method for cyclization of peptides |
| US4751180A (en) | 1985-03-28 | 1988-06-14 | Chiron Corporation | Expression using fused genes providing for protein product |
| US4935233A (en) | 1985-12-02 | 1990-06-19 | G. D. Searle And Company | Covalently linked polypeptide cell modulators |
| WO1993010152A1 (en) | 1991-11-16 | 1993-05-27 | Smithkline Beecham Biologicals S.A. | HYBRID PROTEIN BETWEEN CS FROM PLASMODIUM AND HBsAG |
| WO2003079746A2 (en) * | 2001-02-05 | 2003-10-02 | Bristol-Myers Squibb Company | A novel human g-protein coupled receptor, hgprbmy14, related to the orphan gpcr, gpr73 |
| WO2006029887A2 (en) | 2004-09-16 | 2006-03-23 | Glaxosmithkline Biologicals Sa | Vaccines comprising plasmodium antigens |
| WO2007003384A1 (en) | 2005-06-30 | 2007-01-11 | Glaxosmithkline Biologicals Sa | Anti-malaria vaccine |
| US20070184015A1 (en) | 2006-02-03 | 2007-08-09 | Soonkap Hahn | Novel PEGylation agent |
| WO2009021931A1 (en) | 2007-08-13 | 2009-02-19 | Glaxosmithkline Biologicals S.A. | Vaccines |
| WO2009080715A2 (en) | 2007-12-21 | 2009-07-02 | Glaxosmithkline Biologicals S.A. | Vaccines for malaria |
| WO2009094726A1 (en) * | 2008-02-01 | 2009-08-06 | The Walter And Eliza Hall Institute Of Medical Research | Plasmodial polynucleotides, proteins and uses thereof |
| WO2015038708A1 (en) | 2013-09-12 | 2015-03-19 | Stc.Unm | Malaria vaccine |
Non-Patent Citations (115)
| Title |
|---|
| ABBAS ET AL.: "Cellular and Molecular Immunology", 2011 |
| ALGIN ET AL., TETRAHEDRON LETT., vol. 35, 1994, pages 9633 - 9636 |
| ANDRE ET AL., ANN ONCOL, vol. 17, no. 6, 2006, pages 945 - 51 |
| ARIEY F; WITKOWSKI B; AMARATUNGA C; BEGHAIN J; LANGLOIS AC; KHIM N; KIM S; DURU V; BOUCHIER C; MA L: "A molecular marker of artemisinin-resistant Plasmodium falciparum malaria.", NATURE, vol. 505, 2014, pages 50 - 55, XP055183438, DOI: doi:10.1038/nature12876 |
| ATASSI ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 670, 1981, pages 300 - 302 |
| AUFFRAY C; FOGG DK; NARNI-MANCINELLI E; SENECHAL B; TROUILLET C ET AL.: "CX3CR1+ CD115+ CD135+ common macrophage/DC precursors and the role of CX3CRl in their response to inflammation", J EXP MED, vol. 206, 2009, pages 595 - 606 |
| AVRIL M; TRIPATHI AK; BRAZIER AJ; ANDISI C; JANES JH; SOMA VL; SULLIVAN DJ, JR.; BULL PC; STINS MF; SMITH JD: "A restricted subset of var genes mediates adherence of Plasmodium falciparum-infected erythrocytes to brain endothelial cells", PROC NATL ACAD SCI USA, vol. 109, 2012, pages E1782 - 1790 |
| BAGGIOLINI M: "Chemokines and leucocyte traffic", NATURE, vol. 392, 1998, pages 565 - 568 |
| BAUMINGER ET AL., METHODS ENZYMOL, vol. 70, 1980, pages 151 - 159 |
| BIGNAMI A; BASTIANNELLI G: "Osservazioni suile febbri malariche estive-autunnali", LA RIFORMA MEDICA, vol. 232, 1890, pages 1334 - 1335 |
| BOLL, E.; J. P. EBRAN; H. DROBECQ; O. EL-MAHDI; L. RAIBAUT; N. OLLIVIER; O. MELNYK: "Access to large cyclic peptides by a one-pot two-peptide segment ligation/cyclization process", ORGANIC LETTERS, vol. 17, no. 1, 2015, pages 130 - 3 |
| BRABIN BJ; ROMAGOSA C; ABDELGALIL S; MENENDEZ C; VERHOEFF FH; MCGREADY R; FLETCHER KA; OWENS S; D'ALESSANDRO U; NOSTEN F: "The Sick PlacentaThe Role of Malaria", PLACENTA, vol. 25, 2004, pages 359 - 378 |
| BRAD E. SLEEBS ET AL: "Inhibition of Plasmepsin V Activity Demonstrates Its Essential Role in Protein Export, PfEMP1 Display, and Survival of Malaria Parasites", PLOS BIOLOGY, vol. 12, no. 7, 1 July 2014 (2014-07-01), US, pages e1001897, XP055219926, ISSN: 1544-9173, DOI: 10.1371/journal.pbio.1001897 * |
| BRADLEY L ET AL., ANNU REV BIOPHYS BIOMOL STRUCT., vol. 34, 2005, pages 91 - 118 |
| BRAY RS; SINDEN RE: "The sequestration of Plasmodium falciparum infected erythrocytes in the placenta", TRANS R SOC TROP MED HYG, vol. 73, 1979, pages 716 - 719, XP023098716, DOI: doi:10.1016/0035-9203(79)90028-2 |
| BUFFET PA; SAFEUKUI I; MILON G; MERCEREAU-PUIJALON O; DAVID PH: "Retention of erythrocytes in the spleen: a double-edged process in human malaria", CURR OPIN HEMATOL, vol. 16, 2009, pages 157 - 164, XP008118242, DOI: doi:10.1097/MOH.0b013e32832a1d4b |
| CAMMAS L; REINAUD P; DUBOIS O; BORDAS N; GERMAIN G; CHARPIGNY G: "Identification of Differentially Regulated Genes During Elongation and Early Implantation in the Ovine Trophoblast Using Complementary DNA Array Screening", BIOLOGY OF REPRODUCTION, vol. 72, 2005, pages 960 - 967 |
| CARDONA ET AL., NAT NEUROSCI, vol. 9, no. 7, 2006, pages 917 - 24 |
| CLAESSENS A; ADAMS Y; GHUMRA A; LINDERGARD G; BUCHAN CC; ANDISI C; BULL PC; MOK S; GUPTA AP; WANG CW: "A subset of group A-like var genes encodes the malaria parasite ligands for binding to human brain endothelial cells", PROC NATL ACAD SCI USA, vol. 109, 2012, pages E1772 - 1781 |
| COMBADIERE ET AL., CIRCULATION, vol. 107, no. 7, 2003, pages 1009 - 16 |
| COMBADIERE ET AL., J CLIN INVEST, vol. 117, no. 10, 2007, pages 2920 - 8 |
| DATABASE UniProt [online] 2 August 2005 (2005-08-02), "SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAY91466.1};", XP002746032, retrieved from EBI accession no. UNIPROT:Q4KEN4 Database accession no. Q4KEN4 * |
| DAVIES JS: "The cyclisation of peptides and depsipeptides", J PEPT SCI, vol. 8, 2003, pages 471 - 501 |
| DONDORP AM; FAIRHURST RM; SLUTSKER L; MACARTHUR JR; BREMAN JG; GUERIN PJ; WELLEMS TE; RINGWALD P; NEWMAN RD; PLOWE CV: "The threat of artemisinin-resistant malaria", N ENGL J MED, vol. 365, 2011, pages 1073 - 1075 |
| DORGHAM KARIM ET AL: "An engineered CX3CR1 antagonist endowed with anti-inflammatory activity", JOURNAL OF LEUKOCYTE BIOLOGY, FEDERATION OF AMERICAN SOCIETIES FOR EXPERIMENTAL BIOLOGY, US, vol. 86, no. 4, 1 October 2009 (2009-10-01), pages 903 - 911, XP009126257, ISSN: 0741-5400 * |
| DORGHAM, K; A. GHADIRI; P. HERMAND; M. RODERO; L. POUPEL; M. IGA; O. HARTLEY; G. GOROCHOV; C. COMBADIERE; P. DETERRE: "An engineered CX3CR1 antagonist endowed with anti-inflammatory activity", J LEUKOC BIOL, vol. 86, no. 4, 2009, pages 903 - 11, XP009126257 |
| DURGAPRASAD L ET AL., INFLAMMATION & ALLERGY- DRUG TARGETS, vol. 12, 2013, pages 349 - 361 |
| FARFOUR E; CHARLOTTE F; SETTEGRANA C; MIYARA M; BUFFET P: "The extravascular compartment of the bone marrow: a niche for Plasmodium falciparum gametocyte maturation?", MALARIA JOURNAL, vol. 11, 2012, pages 285, XP021107378, DOI: doi:10.1186/1475-2875-11-285 |
| FAURE ET AL., SCIENCE, vol. 287, no. 5461, 2000, pages 2274 - 7 |
| FITTING C, PLOS ONE, vol. 7.6, 2012, pages E38916 |
| FLORENS L; LIU X; WANG Y; YANG S; SCHWARTZ O; PEGLAR M; CARUCCI DJ; YATES JR; WUB Y: "Proteomics approach reveals novel proteins on the surface of malaria-infected erythrocytes", MOL BIOCHEM PARASITOL, vol. 135, 2004, pages 1 - 11 |
| FONG AM; ROBINSON LA; STEEBER DA; TEDDER TF; YOSHIE O; IMAI T; PATEL DD: "Fractalkine and CX3CR1 mediate a novel mechanism of leukocyte capture, firm adhesion, and activation under physiologic flow", JEXPMED, vol. 188, 1998, pages 1413 - 1419, XP002158115, DOI: doi:10.1084/jem.188.8.1413 |
| FRECH C; CHEN N: "Variant surface antigens of malaria parasites: functional and evolutionary insights from comparative gene family classification and analysis", BMC GENOMICS, vol. 14, 2013, pages 427, XP021154524, DOI: doi:10.1186/1471-2164-14-427 |
| GALZI J-L; HACHET-HAAS M; BONNET D; DAUBEUF F; LECAT S; HIBERT M; HAIECH J; FROSSARD N: "Neutralizing endogenous chemokines with small molecules: Principles and potential therapeutic applications", PHARMACOLOGY AND THERAPEUTICS, vol. 126, 2010, pages 39 - 55 |
| GARIN ET AL., J IMMUNOL, vol. 171, no. 1 0, 2003, pages 5305 - 12 |
| GETTS ET AL., J EXP MED, vol. 205, no. 10, 2008, pages 2319 - 37 |
| GORDON, RESEARCH CONFERENCES, 21 September 2008 (2008-09-21) |
| GRAY C; MCCORMICK C; TURNER G; CRAIG A: "ICAM-1 can play a major role in mediating P. falciparum adhesion to endothelium under flow", MOL BIOCHEM PARASITOL, vol. 128, 2003, pages 187 - 193 |
| H. SULEYMAN ET AL., PHARMACOLOGICAL REPORTS, vol. 59, 2007, pages 247 - 258 |
| HACHET-HAAS M; BALABANIAN K; ROHMER F; PONS F; FRANCHET C; LECAT S; CHOW KYC; DAGHER R; GIZZI P; DIDIER B: "Small Neutralizing Molecules to Inhibit Actions of the Chemokine CXCL12.", J BIOL CHEM, vol. 283, 2008, pages 23189 - 23199, XP002642451, DOI: doi:10.1074/JBC.M803947200 |
| HARRISON JK; JIANG Y; WEES EA; SALAFRANCA MN; LIANG HX; FENG L; BELARDINELLI L: "Inflammatory agents regulate in vivo expression of fractalkine in endothelial cells of the rat heart", J LEUKOC BIOL, vol. 66, 1999, pages 937 - 944 |
| HATABU T; KAWAZU S; AIKAWA M; KANO S: "Binding of Plasmodium falciparum-infected erythrocytes to the membrane-bound form of Fractalkine/CX3CL1", PROC NATL ACAD SCI USA, vol. 100, 2003, pages 15942 - 15946, XP055220146, DOI: doi:10.1073/pnas.2534560100 |
| HERMAND P; HUET M; CALLEBAUT I; GANE P; IHANUS E; GAHMBERG CG; CARTRON JP; BAILLY P: "Binding sites of leukocyte beta 2 integrins (LFA-1, Mac-1) on the human ICAM-4/LW blood group protein", J BIOL CHEM, vol. 275, 2000, pages 26002 - 26010, XP002273537, DOI: doi:10.1074/jbc.M002823200 |
| HERMAND P; PINCET F; CARVALHO S; ANSANAY H; TRINQUET E; DAOUDI M; COMBADIERE C; DETERRE P: "Functional Adhesiveness of the CX3CL1 Chemokine Requires Its Aggregation: role of the transmembrane domain", J BIOL CHEM, vol. 283, 2008, pages 30225 - 30234, XP009121177, DOI: doi:10.1074/jbc.M802638200 |
| HILLER NL; BHATTACHARJEE S; VAN OOIJ C; LIOLIOS K; HARRISON T; LOPEZ-ESTRANO C; HALDAR K: "A host-targeting signal in virulence proteins reveals a secretome in malarial infection", SCIENCE, vol. 306, 2004, pages 1934 - 1937 |
| HOLMES ET AL., J NEUROCHEM, vol. 1 06, no. 2, 2008, pages 640 - 9 |
| HONCZARENKO M; LE Y; SWIERKOWSKI M; GHIRAN I; GLODEK AM; SILBERSTEIN LE: "Human Bone Marrow Stromal Cells Express a Distinct Set of Biologically Functional Chemokine Receptors", STEM CELLS, vol. 24, 2006, pages 1030 - 1041, XP055050705, DOI: doi:10.1634/stemcells.2005-0319 |
| HRUBY ET AL., REACTIVE POLYMERS, vol. 22, 1994, pages 231 - 241 |
| HUANG ET AL., FASEB J, vol. 20, no. 7, 2006, pages 896 - 905 |
| J. P. TAM, PROC. NATL. ACAD. SCI. U.S.A., vol. 85, 1988, pages 5409 - 5413 |
| JACQUELIN S; LICATA F; DORGHAM K; HERMAND P; POUPEL L; GUYON E; DETERRE P; HUME DA; COMBADIERE C; BOISSONNAS A: "CX3CR1 reduces Ly6Chigh-monocyte motility within and release from the bone marrow after chemotherapy in mice", BLOOD, vol. 122, 2013, pages 674 - 683 |
| JANES JH; WANG CP; LEVIN-EDENS E; VIGAN-WOMAS I; GUILLOTTE M; MELCHER M; MERCEREAU-PUIJALON O; SMITH JD: "Investigating the host binding signature on the Plasmodium falciparum PfEMPI protein family", PLOS PATHOGENS, vol. 7, 2011, pages E 1002032 |
| JOICE R; NILSSON SK; MONTGOMERY J; DANKWA S; EGAN E; MORAHAN B; SEYDEL KB; BERTUCCINI L; ALANO P; WILLIAMSON KC: "Plasmodium falciparum transmission stages accumulate in the human bone marrow", SCIENCE TRANSLATIONAL MEDICINE, vol. 6, 2014, pages 244RE245 |
| KARLSTROM, S.; G. NORDVALL; D. SOHN; A. HETTMAN; D. TUREK; K. AHLIN; A. KERS; M. CLAESSON; C. SLIVO; Y. LO-ALFREDSSON: "Substituted 7-amino-5-thio-thiazolo[4,5-d]pyrimidines as potent and selective antagonists of the fractalkine receptor (CX3CR1", JOURNAL OF MEDICINAL CHEMISTRY, vol. 56, no. 8, 2013, pages 3177 - 90, XP055334582, DOI: doi:10.1021/jm3012273 |
| KATES ET AL., TETRAHEDRON LETT., vol. 34, 1993, pages 1549 - 1552 |
| KENT S.B.H., CHEM. SOC. REV., vol. 38, 2009, pages 338 - 351 |
| KIM K-W; VALLON-EBERHARD A; ZIGMOND E; FARACHE J; SHEZEN E ET AL.: "In vivo structure/function and expression analysis of the CX3C chemokine fractalkine", BLOOD, vol. 118, 2011, pages EL56 - EL67 |
| KIRCHGATTER K; DEL PORTILLO HA: "Clinical and molecular aspects of severe malaria", AN ACAD BRAS CIENC, vol. 77, 2005, pages 455 - 475 |
| LAVAZEC C; SANYAL S; TEMPLETON TJ: "Hypervariability within the Rifin, Stevor and Pfmc-2TM superfamilies in Plasmodium falciparum", NUCLEIC ACIDS RES, vol. 34, 2006, pages 6696 - 6707 |
| LAVSTSEN T; TURNER L; SAGUTI F; MAGISTRADO P; RASK TS; JESPERSEN JS; WANG CW; BERGER SS; BARAKA V; MARQUARD AM: "Plasmodium falciparum erythrocyte membrane protein 1 domain cassettes 8 and 13 are associated with severe malaria in children", PROC NATL ACAD SCI USA, vol. 109, 2012, pages E1791 - 1800 |
| LEDERMAN, SCIENCE, vol. 306, 2004, pages 485 - 487 |
| LESNIK ET AL., J CLIN INVEST, vol. 111, no. 3, 2003, pages 333 - 40 |
| LGA ET AL., VACCINE, vol. 25, no. 23, 2007, pages 4554 - 63 |
| LI; ROLLER: "PPCyclisation strategies in peptide derived drug design", CURR. TP MED. CHEM., vol. 3, 2002, pages 325 - 41, XP055094202, DOI: doi:10.2174/1568026023394209 |
| LIU ET AL., BIOCHEM., vol. 18, 1979, pages 690 - 697 |
| LNOUE ET AL., ARTHRITIS RHEUM, vol. 52, no. 5, 2005, pages 1522 - 33 |
| LSHIDA ET AL., J IMMUNOL, vol. 180, no. 1, 2008, pages 569 - 79 |
| MALARIA, FACT SHEET N°94, December 2011 (2011-12-01), Retrieved from the Internet <URL:http://wwwwhoint/mediacentre/factsheets/fs094/en> |
| MARATEA ET AL., GENE, vol. 40, 1985, pages 39 - 46 |
| MARLOWE, BIORG. MED. CHEM. LETT, vol. 3, 1993, pages 437 - 44 |
| MARTI M; GOOD RT; RUG M; KNUEPFER E; COWMAN AF: "Targeting malaria virulence and remodeling proteins to the host erythrocyte", SCIENCE, vol. 306, 2004, pages 1930 - 1933 |
| MCDERMOTT ET AL., J CLIN INVEST, vol. 111, no. 8, 2003, pages 1241 - 50 |
| MCMURRAY ET AL., PEPTIDE RES., vol. 7, 1994, pages 195 - 206 |
| MEBIUS RE; KRAAL G: "Structure and function of the spleen", NAT REV IMMUNOL, vol. 5, 2005, pages 606 - 616 |
| MOATTI ET AL., BLOOD, vol. 97, no. 7, 2001, pages 1925 - 8 |
| MOSER B; LOETSCHER P: "Lymphocyte traffic control by chemokines", NAT IMMUNOL, vol. 2, 2001, pages 123 - 128 |
| MURPHY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 8258 - 8262 |
| PALLIN; TAM, J. CHEM. SOC. CHEM. COMM., 1995, pages 2021 - 2022 |
| PARKER ET AL.: "Cold Spring Harbor Symposium - Modern Aoproaches to Vaccines", 1984, COLD SPRING HARBOR PRESS |
| PASVOL G; WILSON RJ; SMALLEY ME; BROWN J: "Separation of viable schizont-infected red cells of Plasmodium falciparum from human blood", ANN TROP MED PARASITOL, vol. 72, 1978, pages 87 - 88 |
| PLANCHE T; DZEING A; NGOU-MILAMA E; KOMBILA M; STACPOOLE PW: "Metabolic complications of severe malaria", CURR TOP MICROBIOL IMMUNOL, vol. 295, 2005, pages 105 - 136 |
| POUPEL L; BOISSONNAS A; HERMAND P; DORGHAM K; GUYON E ET AL.: "Pharmacological inhibition of the chemokine receptor, CX3CR1, reduces atherosclerosis in mice", ARTERIOSCLER THROMB VASC BIOL, vol. 33, 2013, pages 2297 - 2305 |
| POUPEL, L.; A. BOISSONNAS; P. HERMAND; K. DORGHAM; E. GUYON; C. AUVYNET; F. S. CHARLES; P. LESNIK; P. DETERRE; C. COMBADIERE: "Pharmacological inhibition of the chemokine receptor, CX3CR1, reduces atherosclerosis in mice", ARTERIOSCLER THROMB VASC BIOL, vol. 33, no. 10, 2013, pages 2297 - 305 |
| R. B. MERRIFIELD: "Solid-phase peptide synthesis", ADVANCES IN ENZYMOLOGY AND RELATED AREAS OF MOLECULAR BIOLOGY, vol. 32, 1969, pages 221 - 96, XP002957003 |
| R. B. MERRIFIELD: "The synthesis of biologically active peptides and proteins", JAMA, vol. 210, no. 7, 1969, pages 1247 - 54 |
| RAIBAUT, L.; O. EL MAHDI; O. MELNYK: "Solid Phase Protein Chemical Synthesis", TOPICS IN CURRENT CHEMISTRY, 2015 |
| REICHLIN, METHODS ENZYMOL., vol. 70, 1980, pages 159 - 165 |
| ROBINSON ET AL., J IMMUNOL, vol. 165, no. 11, 2000, pages 6067 - 72 |
| ROT A; VON ANDRIAN UH: "Chemokines in Innate and Adaptive Host Defense: Basic Chemokinese Grammar for Immune Cells", ANN REV IMM, vol. 22, 2004, pages 891 - 928 |
| ROWE JA; CLAESSENS A; CORRIGAN RA; ARMAN M: "Adhesion of Plasmodium falciparum infected erythrocytes to human cells: molecular mechanisms and therapeutic implications", EXPERT REV MOL MED, vol. 11, 2009, pages E16 |
| SAWAI ET AL., ARTHRITIS RHEUM, vol. 56, no. 1 0, 2007, pages 3215 - 25 |
| SCHMIDT; LANGER, J. PEPTIDE RES., vol. 49, 1997, pages 67 - 73 |
| SHIMOYA K; ZHANG Q; TENMA K; OTA Y; HASHIMOTO K; SHIZUSAWA Y; KIMURA T; KOYAMA M; MURATA Y: "Fractalkine (FRK) levels in amniotic fluid and its production during pregnancy", MOL HUM REPROD, vol. 9, 2003, pages 97 - 101 |
| SILVESTRINI F; LASONDER E; OLIVIERI A; CAMARDA G; VAN SCHAIJK B; SANCHEZ M; YOUNIS YOUNIS S; SAUERWEIN R; ALANO P: "Protein Export Marks the Early Phase of Gametocytogenesis of the Human Malaria Parasite Plasmodium falciparum", MOLECULAR & CELLULAR PROTEOMICS, vol. 9, 2010, pages 1437 - 1448 |
| SILVESTRINI F; TIBURCIO M; BERTUCCINI L; ALANO P: "Differential Adhesive Properties of Sequestered Asexual and Sexual Stages of <italic>Plasmodium falciparum</italic> on Human Endothelial Cells Are Tissue Independent", PLOS ONE, vol. 7, 2012, pages E31567 |
| SINTON JA; BAILY JD; CHAND D: "Studies in malaria, with special reference to treatment Part IV The occurrence of sexual forms of Plasmodium falciparum in the peripheral circulation", INDIAN J MEDICAL RESEARCH, vol. 13, 1926, pages 895 - 916 |
| SMITH JD; ROWE JA; HIGGINS MK; LAVSTSEN T: "Malaria's deadly grip: cytoadhesion of Plasmodium falciparum-infected erythrocytes", CELLULAR MICROBIOLOGY, vol. 15, 2013, pages 1976 - 1983 |
| SMITH JD; SUBRAMANIAN G; GAMAIN B; BARUCH DI; MILLER LH: "Classification of adhesive domains in the Plasmodium falciparum erythrocyte membrane protein 1 family", MOL BIOCHEM PARASITOL, vol. 110, 2000, pages 293 - 310, XP002279716, DOI: doi:10.1016/S0166-6851(00)00279-6 |
| STECK TL; KANT JA: "Preparation of impermeable ghosts and inside-out vesicles from human erythrocyte membranes", METHODS ENZYMOL, vol. 31, 1974, pages 172 - 180, XP008146384, DOI: doi:10.1016/0076-6879(74)31019-1 |
| T. HATABU ET AL: "Binding of Plasmodium falciparum-infected erythrocytes to the membrane-bound form of Fractalkine/CX3CL1", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 100, no. 26, 23 December 2003 (2003-12-23), US, pages 15942 - 15946, XP055220146, ISSN: 0027-8424, DOI: 10.1073/pnas.2534560100 * |
| TAM ET AL., J. IMMUN, vol. 148, 1992, pages 914 - 920 |
| TAROZZO G; CAMPANELLA M; GHIANI M; BULFONE A; BELTRAMO M: "Expression of fractalkine and its receptor, CX3CR1, in response to ischaemia-reperfusion brain injury in the rat", EUR J NEUROSCI, vol. 15, 2002, pages 1663 - 1668 |
| TOURNAMILLE C; BLANCHER A; LE VAN KIM C; GANE P; APOIL PA; NAKAMOTO W; CARTRON JP; COLIN Y: "Sequence, evolution and ligand binding properties of mammalian Duffy antigen/receptor for chemokines", IMMUNOGENETICS, vol. 55, 2004, pages 682 - 694 |
| TRAGER W; JENSEN JB: "Human malaria parasites in continuous culture", SCIENCE, vol. 193, 1976, pages 673 - 675 |
| TRIPP ET AL., NAT, vol. 2, no. 8, 2001, pages 732 - 8 |
| TUMELTY ET AL., J. CHEM. SOC. CHEM. COMM., 1994, pages 1067 - 1068 |
| TURNER L; LAVSTSEN T; BERGER SS, WANG CW; PETERSEN JE; AVRIL M; BRAZIER AJ; FREETH J; JESPERSEN JS; NIELSEN MA; MAGISTRADO P: "Severe malaria is associated with parasite binding to endothelial protein C receptor", NATURE, vol. 498, 2013, pages 502 - 505 |
| U.WEISS, NATURE INSIGHT, vol. 454, no. 7203, 2008 |
| VIOLA A; LUSTER AD: "Chemokines and their receptors: drug targets in immunity and inflammation", ANNU REV PHARMACOL TOXICOL, vol. 48, 2008, pages 171 - 197, XP002579388, DOI: doi:10.1147/annurev.pharmtox.48.121806.154841 |
| VITALE ET AL., GUT, vol. 56, no. 3, 2007, pages 365 - 72 |
| WALENSKY ET AL., SCIENCE, vol. 305, 2004, pages 1466 - 70 |
| WALTER ET AL., PROC. NAT. ACAD. SCI. USA, vol. 77, 1980, pages 5197 - 5200 |
| WANG ET AL., SCIENCE, vol. 254, 1991, pages 285 - 288 |
| ZOUGBEDE S; MILLER F; RAVASSARD P; REBOLLO A; CICERON L; COURAUD PO; MAZIER D; MORENO A: "Metabolic acidosis induced by Plasmodium falciparum intraerythrocytic stages alters blood-brain barrier integrity", J CEREB BLOOD FLOW METAB, 2010 |
| ZUJOVIC V; BENAVIDES J; VIGE X; CARTER C; TAUPIN V: "Fractalkine modulates TNF-alpha secretion and neurotoxicity induced by microglial activation", GLIA, vol. 29, 2000, pages 305 - 315 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8101186B2 (en) | Peptides that block the binding of IgG to FcRn | |
| JP4949844B2 (en) | A novel peptide that binds to the erythropoietin receptor | |
| EP3004152B1 (en) | Designed ankyrin repeat proteins binding to hepatocyte growth factor | |
| CN107074928B (en) | Novel feline erythropoietin receptor agonist | |
| JP2007530441A (en) | A novel peptide that binds to the erythropoietin receptor | |
| KR20180012856A (en) | Methods for the modulation of immune responses and polypeptides | |
| CN103533949A (en) | High-affinity, dimeric inhibitors of psd-95 as efficient neuroprotectants against ischemic brain damage and for treatment of pain | |
| EA019516B1 (en) | Treatment of microbial infections | |
| DK2453914T3 (en) | ANTIGEN-SPECIFIC MULTIPLE PIT-BASED ANTI-INFECTIOUS VACCINES | |
| RS58164B1 (en) | Peptides with antagonistic activities against natural cxcr4 | |
| WO2017192594A1 (en) | Binding moieties for biofilm remediation | |
| CA2746976A1 (en) | Modulators of the cx3cr1 receptor and therapeutic uses thereof | |
| CA2343924A1 (en) | Peptide derivative | |
| CZ303409B6 (en) | Shortened and mutated human chemokine | |
| KR20110015571A (en) | Peptidyl Diacylglycerides | |
| CN101421297A (en) | Peptides that block the binding of igg to fcrn | |
| WO2016184784A1 (en) | Peptides including binding domain of plasmodium falciparum proteins (cbp1 and cbp2) to chemokine cx3cl1 | |
| EP2658867A1 (en) | Non-natural mic proteins | |
| WO2018206732A9 (en) | Means and methods for treating bacterial infections | |
| US12129278B2 (en) | High-affinity peptide for tumor necrosis factor alpha and application thereof | |
| KR101467453B1 (en) | FGF 2 binding peptides and uses thereof | |
| US12006373B1 (en) | Identification and evaluation of novel peptide ligands specific to human CD3 epsilon | |
| EP3272768A1 (en) | Chimeric peptides useful in malaria prophylaxis or treatment | |
| JP2009506986A (en) | Peptidyl diacylglyceride | |
| WO2006050977A1 (en) | Recombinant trl-md-2 fusion proteins |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16725786 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16725786 Country of ref document: EP Kind code of ref document: A1 |
