WO2016149698A2 - Hiv-1 neutralizing antibodies and uses thereof (v3 antibodies) - Google Patents
Hiv-1 neutralizing antibodies and uses thereof (v3 antibodies) Download PDFInfo
- Publication number
- WO2016149698A2 WO2016149698A2 PCT/US2016/023380 US2016023380W WO2016149698A2 WO 2016149698 A2 WO2016149698 A2 WO 2016149698A2 US 2016023380 W US2016023380 W US 2016023380W WO 2016149698 A2 WO2016149698 A2 WO 2016149698A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- antibodies
- chain
- fragment
- hiv
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/112—Retroviridae (F), e.g. leukemia viruses
- C07K16/114—Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
- C07K16/1145—Env proteins, e.g. gp41, gp110/120, gp160, V3, principal neutralising domain [PND] or CD4-binding site
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF V3 antibodies
- the invention relates to the identification of monoclonal HIV-1 neutralizing antibodies, such as, but not limited to, antibodies that bind to the V3 region of HIV-1 Env glycoprotein, their recombinant expression and purification and uses.
- HIV Neutralizing antibodies capable of binding HIV-1 envelope, but that only a small subset of these antibodies are neutralizing and capable of blocking viral entry in target cells. See e.g. Doria-Rose N. "HIV Neutralizing
- mAbs broad neutralizing monoclonal antibodies
- the invention provides an antibody or fragment thereof with the binding specificity of V3 glycan binding antibody DH542 (e.g. Figure 2B).
- the invention provides an antibody or fragment thereof with the binding specificity of V3 glycan binding antibody DH542 QSA (e.g. Figure 16).
- the invention provides an antibody or fragment thereof with the binding specificity of V3 glycan binding antibody of Example 10.
- the antibody is DH542_L4 (e.g. Figure 25).
- the invention provides a V3 binding antibody wherein the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the VH chain of an antibody from DH270 lineage ( Figures 8, 20B) and a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of an antibody from DH270 lineage ( Figures 8, 16).
- the invention provides a V3 binding antibody wherein the antibody or fragment thereof comprises the VH chain of an antibody from DH270 lineage ( Figures 8, 20B) and the VL chain of an antibody from DH270 lineage ( Figures 8, 16).
- the antibody or fragment thereof is fully human and recombinantly produced.
- some of the VH and VL chains are isolated from a human subject who have been naturally infected with HIV-1.
- the antibody is not naturally occurring.
- the antibody comprises the amino acids of naturally occurring pair of VH and VL chains.
- the antibody comprises amino acids of naturally occurring pair of VH and VL chains wherein the Fc portion of the antibody is not the natural isotype or portion of the naturally occurring pair of VH and VL chains.
- the antibody is computationally designed, for example based on some naturally isolated VH and VL sequences. In certain embodiments the antibody is computationally designed, e.g.
- the antibody comprises a non-naturally occurring pairing of VH and VL chains, wherein the VH or VL individually could be isolated from a subject.
- the antibody comprises VH chain or HCDRs of a VH chain of one clonal member, and VL or LCDRs of another clonal member, i.e., a non-naturally occurring antibody comprising sequences derived from natural pairs.
- the antibody comprises naturally occurring VH and VL chains modified by substituting one or more amino acids.
- the antibody or fragment thereof is fully human.
- the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542 or DH542 QSA, or any of the other lineage members.
- the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542, DH429 or
- the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH542 or DH542 QSA. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the CDRl, CDR2, and CDR3 of antibody DH542 or DH542 QSA.
- the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of any of the V3 antibodies of the invention, including but not limited to antibody DH542, DH542 QSA, DH542-L4, or any of the antibodies listed in Figure 25 and further comprises the complementary VL which comprises the LCDR1, LCDR2, LCDR3 of antibody DH542, DH542 QSA, DH542-L4, or any of the antibodies listed in Figure 25.
- the antibody or fragment thereof comprises VH and VL of antibody DH542, DH429 or DH542 QSA.
- the antibody is DH542. In other embodiments the antibody is DH542 L4. In other embodiments the antibody is DH542-QSA.
- the invention provides at least three V3 antibodies wherein each antibody comprises VH sequence from DH542 (e.g. Figure 8) and VL sequence which can be VL sequence from DH542, VL sequence which is a VL from 542-QSA, or VL sequence from DH429.
- the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention or fragments thereof or any combination thereof. [0020] In certain aspects, the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention, or a combination thereof.
- the composition comprises an antibody or a fragment thereof which is recombinantly produced in CHO cells.
- the invention provides a pharmaceutical composition comprising a vector comprising a nucleic acid encoding anyone of inventive antibodies or fragments.
- the nucleic acids are optimized for expression in human host cells.
- the nucleic acids are optimized for recombinant expression in a suitable host cell.
- the vector is suitable for gene delivery and expression. Non-limiting examples of such vectors include adenoviral vectors (Ads), adeno associated virus based vectors (AAVs), or a combination thereof.
- Ads adenoviral vectors
- AAVs adeno associated virus based vectors
- the invention provides isolated cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof.
- the invention provides compositions of cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof.
- compositions further comprise an additional antibody or fragment thereof.
- compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH540.
- compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH512.
- compositions further comprise an antibody or a fragment thereof comprising VH and VL chain of antibody DH429 or DH270IA1.
- the invention provides a composition which further comprises another therapeutic antibody with a different binding specificity.
- the invention provides an antibody or fragment thereof with the binding specificity of CD4 binding site antibody DH491 or CH493, or CH558, or CH557.
- the invention provides an antibody or fragment with the binding specificity of an MPER antibody.
- the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody CH557, or any of the other lineage members.
- the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the VL chain of antibody CH557, or any of the other lineage members.
- the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493 and further comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493.
- the antibody or fragment thereof comprises VH and VL of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR3 of CH557 and further comprises a VL which comprises the LCDR3 of CH557.
- the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH512, DH512-K3, or a modified variant of DH512 VH.
- the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody DH512 or DH512-K3. See U. S.
- the antibody or antigen binding fragment can include an Fc domain that has been modified compared to a native Fc domain.
- the Fc domain can be modified by amino acid substitution to increase binding to the neonatal Fc receptor and therefore the half-life of the antibody when administered to a subject.
- the invention provides antibodies or fragments comprising a CDR(s) of the VH and/or VL chains, or VH and/or VL chains of the inventive antibodies, as the HIV-1 binding arm(s) of a bispecific molecules, e.g. but not limited to DARTS, diabodies, toxin labeled HIV-1 binding molecules.
- a bispecific molecules e.g. but not limited to DARTS, diabodies, toxin labeled HIV-1 binding molecules.
- the invention provides methods to treat or prevent HIV-1 infection in a subject comprising administering to the subject a pharmaceutical composition comprising any one of the inventive antibodies or fragments thereof in a therapeutically effective amount.
- the methods of the invention contemplate combination therapeutic methods, including but not limited to administering combinations of various antibodies or fragments thereof.
- the pharmaceutical compositions are administered in a therapeutically effective dose and regimen.
- Figure 1A shows index sorting of B cell that produced DH542 antibody
- Figure IB shows the V3 peptide used as a hook to sort B cells from individual CH848.
- Figure 2 A shows the gene information of DH542 and Figure 2B shows DH542 sequences
- Figures 3 A and 3B show that in an ELISA assay DH542 binding to HIV-Env depends on V3 loop glycans.
- Figures 4A-4D show DH542 neutralization data.
- Figure 4 A shows that DH542 neutralizes 71% of HIV-1 pseudoviruses tested in the TZM-bl assay.
- Figure 4B shows neutralization of a panel of 24 viruses.
- Figures 4C and 4D show summary of neutralization data from TZM-bl assay.
- FIG. 5 shows that DH542 binds high-mannose glycans.
- the data represent antibody binding measured with a custom oligomanose glycan array— average from three separate glycan arrays.
- the glycan array is printed by Zbiotech (Aurora, CO) on polymer coated glass slides. Each glycan is printed in triplicate at three different concentrations.
- the antibody DH542 was diluted in PBS supplemented with 1% BSA to a final concentration of 50 ug/mL, and incubated on the glycan array for 1 h at room temperature. Unbound antibody is washed away with 5 washes with PBS- T.
- DH542 The binding of DH542 is detected with an anti-IgG Fc antibody conjugated to Cy3.
- the Cy3 intensity for each glycan is read with a GenePix 4000B array scanner and the means and standard error of the three replicates are shown in the graph.
- the data show that DH542 is a direct glycan binding HIV-1 antibody. It binds most strongly to Man9GlcNAc2 which is similar to known bnAbs such as PGT128 and 2G12. DH542 bound well to Man8GlcNAc2 and Man7GlcNAc2, but at a lower level than Man9GlcNAc2. Binding was also detected for two other lower forms of oligomannose, but at decreased magnitudes.
- DH542 did not exhibit detectable binding to the GlcNAc2 alone, meaning that it requires mannose for glycan recognition, and more specifically, binds the highest forms of oligomannose (Man9GlcNAc2) with the greatest magnitude.
- DH542 is a glycan-reactive antibody that binds directly to the predominant glycan, high mannose, present on HIV-1 Envelope.
- the figure also shows the binding by the non-glycan reactive HIV antibody 19B. It shows no binding to 100 uM glycan printed on the array.
- the figure also shows that the prototypic gly can-dependent HIV-1 antibody PGT128 binds well to Man7GlcNAc2, Man8, and Man9.
- DH542 is shown binding to 100 uM of high mannose glycans. DH542 also binds to Man7GlcNAc2D3, which is not bound by PGT128.
- Figure 6 is summarized data showing that DH542 is not autoreactive by Athena ANA panel. Results are expressed as relative luminescence units. Readings ⁇ 100 are considered negative, results between 100 and 120 are considered “indeterminate” and results >120 are considered positive.
- Figure 7 shows that DH542 binds HEp2 cells as demonstrated by intracellular fluorescence staining— left panel shows DH542/293i 50ug/mL 40x obj 8 sec (2+), right panel shows
- Figure 8 shows the amino acids sequences of VH and VL chains of antibodies of the DH270 lineage, and nucleic acid sequences encoding these amino acids. CDRs are highlighted in each antibody.
- DH270IA1 as listed in Figure 9 is the same antibody referred to as II in the sequence of Figure 8.
- the figure shows SEQ ID NOs: 5-16 (Heavy chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 17-28 (Heavy chain amino acid sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 29-40 (Light chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 41-52 (Light chain amino acid sequences in order of appearance from UCA-DH270H).
- Figure 9 shows Neutralizing Breadth and Potency of various HIV-1 BnAbs that are candidates for being combined with the inventive antibodies or other antibodies in Figure 4 for a potent mixture of bnAbs.
- DH270IA1 is II in the DH270 lineage (See Figure 8).
- Figure 10 shows Neutralizing Breadth and Potency of some candidate bnAbs for single or combination use.
- Figure 11 shows a clonal tree that was estimated using both the heavy and light chains of the listed lineage members.
- Figure 12A shows nucleic acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 53-72).
- Figure 12B shows amino acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 73-93).
- Figures 13A-13D show non-limiting examples of mutations in the VH chain of DH511 and DH512, and non-limiting examples of sequences including mutations in DH512 VH chain.
- Figure 13 A shows positions in the VHCDR3 chain of DH511 which could be mutated. Amino acid positions refer to Kabat numbering. Most mutations are to changes to W, but F, L, or possibly other substitutions can also be tried.
- Figure 13B shows positions in the VHCDR3 chain of DH512 which could be mutated.
- Amino acid positions refer to Kabat numbering for the DH512VH chain: QVQLVQSGGGLVKPGGSLTLSCSASGFFFDNSWMGWVRQAPGKGLEWVGRIRRLKDGAT GEYGAAVKDRFTISRDDSRNMLYLHMRTLKTEDSGTYYCTMDEGTPVTRFLEWGYFYYY MAVWGRGTTVIVSS (SEQ ID NO: 94). Most mutations are to changes to W, but F, L, or possibly other substitutions can also be tried. For both DH511 and DH512 position V100 can be changed to I. Position LlOOd can be changed to F.
- VHCDR3 could include VH LlOOdF together with TlOOaW; VH LlOOdW together with TlOOaW.
- Figure 13C shows positions outside of VHCDR3 which could be mutated. Most mutations are to changes to W, but F, L or possibly other substitutions can also be tried.
- Figure 13D shows amino acid sequences of some of the DH512 mutants from Figure 31 (SEQ ID NOs: 95-112).
- Figure 14A shows summary results of neutralization data of DH542 L4, DH542, PGT128, PGT 121, 10-1074, DH270 and DH471 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC50 in ⁇ g/ml.
- Figure 14B shows the mean IC50 and percent of isolates neutralized at different IC50 values. Median and Geometric Mean titers are calculated only for samples with IC50 ⁇ 50ug/ml. Values less than the lowest concentration assayed were assigned a value 2-fold less for calculation purposes. Indicated in italics.
- Figure 15A shows summary results of neutralization data of DH542 L4, DH542, PGT 128, PGT 121, 10-1074, DH270 and DH471 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC80 in ⁇ g/ml.
- Figure 15B shows the mean IC80 and percent of isolates neutralized at different IC80 ⁇ 50ug/ml values. Median and Geometric Mean titers are calculated only for samples with IC80 ⁇ 50ug/ml. Values less than the lowest concentration assayed were assigned a value 2-fold less for calculation purposes. Indicated in italics.
- Figure 16 shows DH542 QSA sequences (SEQ ID NO: 113-116).
- DH542 QSA is a variant of DH542.
- the heavy chain is identical to that of DH542.
- the light chain has some variation in the N-terminus.
- Figure 17A shows an alignment of amino acid
- Figure 17B shows an alignment of nucleic acid sequences of VH and VL chains for antibodies from the DH270 lineage. CDRs are highlighted and underlined in the UCA.
- the Figure 17A shows SEQ ID NOs: 117-126 (Heavy chain nucleotide sequences in order of appearance from UCA-DH270), SEQ ID NOs: 127-136 (Heavy chain amino acid sequences in order of appearance from UCA-DH270).
- Figure 17B shows SEQ ID NOs: 137-146 (Light chain nucleotide sequences in order of appearance from UCA- DH270), SEQ ID NOs: 147-156 (Light chain amino acid sequences in order of appearance from UCA-DH270H)
- Figure 18 shows neutralization by antibodies DH272, DH272 UCA, DH391 and DH542 identified from subject CH848 and DH563 identified from subject CH0765 measured in TZM-bl cells.
- Pseudoviruses were produced by transfection in 293T cells. Values are the antibody concentration ⁇ g/ml) at which relative luminescence units (RLUs) were reduced 50% compared to virus control wells (no test sample). Values in bold are considered positive for neutralizing antibody activity.
- Figure 19A shows a phylogenetic tree of VH sequences from CH0848 donor.
- the tree includes VH chains from natural VH:VL pairs (identified by single cell sorts) and VH chains identified by Illumina sequencing.
- Figure 19B shows a detailed view of the bottom portion of the tree in 19A.
- Figure 19C shows the IDs of the VH chains.
- Figure 20A shows sequences of VH chains identified from CH0848 donor by Illumina deep sequencing (SEQ ID NOs: 157-166). No natural VL sequence pairing was identified for these VH sequences.
- Figure 20B shows an alignment of the sequences in Figure 20 A.
- Figure 21 shows sequences of CH557 (SEQ ID NOs: 167-170). CDRs are bolded and underlined.
- Figure 22 shows a sequence alignment of the CD540-VRC40 antibodies, listing the heavy and light chain variable region sequences, Kabat and EVIGT CDR and framework regions, and Kabat numbering.
- the heavy (SEQ ID NOs: 171-174) and light (SEQ ID NOs: 175-178) chain variable region sequences of the CH540-VRC40.01, CH540-VRC40.02, CH540-VRC40.03, CH540-VRC40.04 are shown.
- Figure 23 shows amino acid alignment of CH235 lineage antibody heavy chain and light chain (SEQ ID NOs: 179-190, in order of appearance from UCA HC to CH557 HC). Antibodies are listed in ascending order of somatic mutations and compared to the inferred unmutated common ancestor previously published (Gao, Bonsignori, Liao et al. Cell 2014)
- Figure 24 shows amino acid alignment of CH235 lineage antibody light chain (SEQ ID NOs: 191-200, in order of appearance from UCA LC to CH556 LC). Antibodies are listed in ascending order of somatic mutations and compared to the inferred unmutated common ancestor previously published (Gao, Bonsignori, Liao et al. Cell 2014)
- Figure 25 shows the names and VH:VLcomposition of chimeric antibodies of Example 10. Sequences for these antibodies are shown in Figures 8, 16 and 17.
- Figures 26A and 26B show a summary of neutralization data for the chimeric antibodies of Example 10. Viruses used in this TZMBl assay are described in the side line of the table in Figures 26 A and 26B. Antibodies are shown in the top line of the table.
- Figure 27 shows a summary of neutralization data for the chimeric antibodies of Example 10. Dotted line shows median IC50 of all viruses including those not neutralized; ⁇ 0.023 graphed as 0.01; >50 graphed as 50.
- Figure 28 A shows Phylogram of DH270 lineage. Sequences shown were isolated by NGS in longitudinal analysis that overlapped in two separate runs. The phylogeny was computed by collapsing on a radius of 8 base pairs and the 90 sequences shown are representative of a total of 1500 sequences. VH sequences of isolated DH270 lineage antibodies were added and the lineage was inferred using Cloanalyst.
- Figure 28B shows Heatmap analysis of neutralization of 24 pseudoviruses (row) by 11 DH270 lineage mAbs.
- Figure 28C shows Neutralization dendrograms display of DH270.6 (right) neutralization of a genetically diverse panel of 200 HIV-1 isolates. Coloration is by IC50 (red: ⁇ 1 ug/ml; green: 1-50 ug/ml; black: >50 ug/ml).
- Figure 29 shows V H and VL mutation frequencies of the isolated antibodies.
- Figure 30 shows Neutralization of wild-type and N332 mutated HIV-1 strains AC13.8, PV04, TRO. l 1, AC 10.0.29 and RHP A confirmed DH270 lineage N332 sensitivity of
- Figure 31 shows the neutralization profile of DH270.6 most closely paralleled that of 10- 1074.
- Env HIV-1 envelope glycoprotein
- antibodies that bind with high affinity to Env may be useful in eliminating the latent pool of HIV-1 -infected CD4 T cells and curing HIV-1 infection, when either used to sensitize HIV-1 expressing target cells with bispecific bnAbs for NK or CD8 T cell killing or when bnAbs are conjugated with toxins or radionucleotides.
- the invention provides fully human antibodies and fragments that specifically bind to and potently neutralize various isolates of HIV-1.
- the antibodies bind to HIV-1 env V3 glycan.
- the antibodies of the invention are combined in compositions with antibodies to HIV-1 gpl20 Env CD4 binding site and/or MPER antibodies.
- the invention provides pharmaceutical compositions including these human antibodies and a pharmaceutically acceptable carrier.
- the invention provides antibodies for passive immunization against HIV/ AIDS.
- Nucleic acids encoding these antibodies, expression cassettes and vectors including these nucleic acids, and isolated cells that express the nucleic acids which encode the antibodies of the invention are also provided.
- the invention provides antibodies which are clonal variants.
- clonal variants are sequences that differ by one or more nucleotides or amino acids, and have a V region with shared mutations compared to the germline, identical VHDJH or VJH gene usage, identical or similar HCDR3 length, and the same VL and JL usage.
- the germline sequence (unmutated common ancestor "UCA") is intended to be the sequence coding for the antibody/immunoglobulin (or of any fragment thereof) deprived of mutations, for example somatic mutations.
- Antibodies in a clone that are designated as UCA and/or I are typically not identified from a biological sample, but are derived computationally based on VH and/or VL sequences isolated from subjects infected with HIV-1.
- compositions including the human antibodies of the invention can be used for any purpose including but not limited to research, diagnostic and therapeutic purposes.
- the human monoclonal antibodies disclosed herein can be used to detect HIV-1 in a biological sample or interfere with the HIV-1 activity, for example to diagnose or treat a subject having an HIV-1 infection and/or AIDS.
- the antibodies can be used to determine HIV-1 titer in a subject.
- the antibodies disclosed herein also can be used to study the biology of the human immunodeficiency virus.
- the antibodies of the invention can be used for therapeutic purposes for treatment or prevention of HIV-1 infection, alone or in combination with other therapeutic modalities, including ART and/or combination with other HIV-1 targeting antibodies, neutralizing antibodies and/or ADCC inducing antibodies.
- the antibodies of the invention are expected not to exhibit self- reactivity— they do not bind or bind very weakly to self-antigens, such as human protein.
- the antibodies of clone DH51 1 are not self-reactive although their UCA and some IAs are polyreactive.
- DH542 is not.
- DH270IA1 does not show self-reactivity, while DH491 and DH493 antibodies are polyreactive to varying degrees.
- CH557 displays exceptional neutralization breadth and high potency and it is not autoreactive nor polyreactive as determined by lack of binding to known human antigens associated with autoimmune disorders), negativity in Hep-2 cells IF staining and lack of binding to an array of 9,400 human antigens, including UBE3 A and STUB-1 proteins, known to be bound by previously described broadly neutralizing antibodies targeting the CD4bs of gpl20 Env (Liu et al J Virol 2014, Bonsignori et al JCI 2014).
- the neutralization breadth of the inventive antibodies is demonstrated by the diversity of viruses which are neutralized in the TZMbl Env pseudovirus inhibition assay.
- the neutralization breadth and/or binding of the antibodies of the invention can be maintained in the presence of tolerate changes to the epitope. Comparing the sequences of the neutralized viruses, versus viruses that are not neutralized, a skilled artisan can readily determine the % virus changes, including changes in the epitope, which can be tolerated while neutralization and/or binding is maintained.
- sequence identity compare sequence length and determine the % sequence identity and/or changes, including % sequence identity and/or changes in the VH and VL sequences, including % sequence identity and/or changes in the CDRs, as well as the specific positions and types of substitutions which can be tolerated while neutralization potency and breadth is maintained.
- sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are.
- homology is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are.
- homology is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are.
- homologs or variants of a polypeptide will possess a relatively high degree of sequence identity when aligned using standard methods.
- NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
- Homologs and variants of a VL or a VH of an antibody that specifically binds a polypeptide are typically characterized by possession of at least about 75%, for example at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity.
- homologs and variants When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95%) depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
- the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the VH and VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency.
- the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the CDR1, 2, and/or 3 of VH and CDR1, 2, and/or 3 VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency.
- the invention provides antibodies which can tolerate a larger percent variation in the sequences outside of the VH and/VL sequences of the antibodies.
- the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, 70%, 69%, 68%, 67%, 66%, 65% identical, wherein the identity is outside of the VH or VL regions, or the CDRs of the VH or VL chains of the antibodies described herein.
- Antibodies of the invention are expected to have the same binding specificity, for example as intact immunoglobulins and antigen binding variants or fragments e.g. as a number of well characterized fragments produced by digestion with various peptidases.
- Fabs, Fvs, scFvs are fragments which are expected to have the same binding specificities as intact antibodies.
- Binding specificity can be determined by any suitable assay in the art, for example but not limited competition binding assays, epitope mapping, etc. Assays to determine glycan dependence and glycan specificity binding are also known in the art.
- a scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains.
- Provided are also genetically engineered forms such as chimeric antibodies and heteroconjugate antibodies such as bispecific antibodies. See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, 111.); Kuby, Immunology, 3.sup.rd Ed., W.H. Freeman & Co., New York, 1997.
- the invention provides antibody fragments, which have the binding specificity and/or properties of the inventive antibodies.
- Non-limiting examples include: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab', the fragment of an antibody molecule obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule; (3) (Fab 1 ).
- the fragment of the antibody obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; (4) F(ab').sub.2, a dimer of two Fab' fragments held together by two disulfide bonds; (5) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and (6) single chain antibody (“SCA”), a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule.
- the antibody fragments can be produces recombinantly.
- VH refers to the variable region of an immunoglobulin heavy chain, including but not limited to that of an antibody fragment, such as Fv, scFv, dsFv or Fab.
- VL refers to the variable region of an immunoglobulin light chain, including but not limited to that of an Fv, scFv, dsFv or Fab.
- any of the nucleic acids encoding any of the antibodies, or fragment thereof can be expressed in a recombinantly engineered cell such as bacteria, plant, yeast, insect and mammalian cells.
- the nucleic acid sequences include any sequence necessary for expression, including but not limited to a promoter, a leader sequence.
- These antibodies can be expressed as individual VH and/or VL chain, or can be expressed as a fusion protein.
- the antibodies can be expressed by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447).
- scFv single chain antibody
- the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gl Y 4 -Ser) 3 , such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VH and VL domains joined by the flexible linker (see, e.g., Bird et al., Science 242:423-426, 1988; Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988; McCafferty et al., Nature 348:552-554, 1990).
- a cleavage site can be included in a linker, such as a furin cleavage site.
- a single chain antibody may be monovalent, if only a single VH and VL are used, bivalent, if two VH and VL are used, or polyvalent, if more than two VH and VL are used.
- Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope.
- Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope, and/or to another molecule.
- the invention provides monoclonal antibodies.
- the monoclonal antibodies are produced by a clone of B -lymphocytes.
- the monoclonal antibody is a recombinant antibody or fragment thereof and is produced by a host cell into which the light and heavy chain genes of a single antibody have been transfected. Any suitable cell could be used for transfection and expression of the antibodies of the invention. Suitable cell lines include without limitation 293T cells or CHO cells.
- Monoclonal antibodies are produced by any suitable method known to those of skill in the art.
- monoclonal antibodies are produced by immortalizing B-cell expressing an antibody. Methods for immortalizing B-cells are known in the art, for example but not limited to using EBV transformation, treatment with various stimulants, and/or apoptotic inhibitors (Bonsignori et al. J. Virol. 85: 9998-10009, 2011).
- monoclonal antibodies are produced by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells to make hybridomas.
- monoclonal antibodies are identified from a subject, for example but not limited as described in Example 1 (Liao HX et al. J Virol Methods. 2009 Jun; 158(l-2): 171-9). The amino acid and nucleic acid sequences of such monoclonal antibodies can be determined.
- the antibodies described herein, or fragments thereof, may be recombinantly produced in prokaryotic or eukaryotic expression systems. These systems are well described in the art.
- protein therapeutics are produced from mammalian cells.
- the most widely used host mammalian cells are Chinese hamster ovary (CHO) cells and mouse myeloma cells, including NS0 and Sp2/0 cells.
- CHO-K1 and CHO pro-3 Two derivatives of the CHO cell line, CHO-K1 and CHO pro-3, gave rise to the two most commonly used cell lines in large scale production, DUKX-X11 and DG44.
- mammalian cell lines for recombinant antibody expression include, but are not limited to, COS, HeLa, HEK293T, U20S, A549, HT1080, CAD, P19, NIH 3T3, L929, N2a, HEK 293, MCF-7, Y79, SO-Rb50, HepG2, J558L, and BHK. If the aim is large- scale production, the most currently used cells for this application are CHO cells. Guidelines to cell engineering for mAbs production were also reported.
- the invention provides an antibody, or antibody fragment, that is recombinantly produced from a mammalian cell-line, including a CHO cell-line.
- the invention provides a composition comprising an antibody, or antibody fragment, wherein the antibody or antibody fragment was recombinantly produced in a mammalian cell-line, and wherein the antibody or antibody fragment is present in the composition at a concentration of at least 1, 10, 100, 1000 micrograms/mL, or at a concentration of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or 100 milligrams/mL.
- the antibody composition comprises less than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 50, or 100 nanograms of host cell protein (i.e., proteins from the cell-line used to recombinantly produce the antibody)).
- the antibody composition comprises less than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 ng of protein A per milligram of antibody or antibody fragment (i.e., protein A is a standard approach for purifying antibodies from recombinant cell culture, but steps should be done to limit the amount of protein A in the composition, as it may be immunogenic).
- protein A is a standard approach for purifying antibodies from recombinant cell culture, but steps should be done to limit the amount of protein A in the composition, as it may be immunogenic.
- U.S. Patent No. 7,458,704 Reduced protein A leaching during protein A affinity chromatography; which is hereby incorporated-by-reference.
- the antibodies of the invention can be of any isotype.
- the antibodies of the invention can be used as IgGl, IgG2, IgG3, IgG4, whole IgGl or IgG3s, whole monomelic IgAs, dimeric IgAs, secretory IgAs, IgMs as monomelic, pentameric or other polymer forms of IgM.
- the class of an antibody comprising the VH and VL chains described herein can be specifically switched to a different class of antibody by methods known in the art.
- the nucleic acid encoding the VH and VL can encode an Fc domain (immunoadhesin).
- the Fc domain can be an IgA, IgM or IgG Fc domain.
- the Fc domain can be an optimized Fc domain, as described in U.S. Published Patent Application No. 20100093979, incorporated herein by reference.
- the immunoadhesin is an IgGl Fc.
- the immunoadhesin is an IgG3 Fc.
- the antibodies comprise amino acid alterations, or combinations thereof, for example in the Fc region outside of epitope binding, which alterations can improve their properties.
- Fc modifications are known in the art. Amino acid numbering is according to the EU Index in Kabat.
- the invention contemplates antibodies comprising mutations that affect neonatal Fc receptor (FcRn) binding, antibody half-life, and localization and persistence of antibodies at mucosal sites. See e.g. Ko SY et al., Nature 514: 642- 45, 2014, at Figure la and citations therein; Kuo, T.
- the antibodies comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via NK cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4 th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid).
- Other antibody mutations have been reported to improve antibody half-life or function or both and can be incorporated in sequences of the antibodies. These include the DLE set of mutations (Romain G, et al.
- modifications such as but not limited to antibody fucosylation, may affect interaction with Fc receptors (See e.g. Moldt, et al. JVI 86(11): 66189-6196, 2012).
- the antibodies can comprise modifications, for example but not limited to
- the antibodies can comprise modifications in the Fc domain such that the Fc domain exhibits, as compared to an unmodified Fc domain enhanced antibody dependent cell mediated cytotoxicity (ADCC); increased binding to Fc.gamma.RIIA or to Fc.gamma.RIIIA; decreased binding to Fc.gamma.RIIB; or increased binding to Fc.gamma.RIIB. See e.g. US Pub 20140328836.
- ADCC antibody dependent cell mediated cytotoxicity
- antibodies of the invention including but not limited to antibodies comprising a CDR(s) of VH and/or VL chains, or antibody fragments of the inventive antibodies can be used as the HIV-1 binding arm(s) of a bispecific molecule, e.g. DARTS, diabodies, toxin labeled HIV-1 binding molecules.
- a bispecific molecule e.g. DARTS, diabodies, toxin labeled HIV-1 binding molecules.
- either the intact antibody or a fragment thereof can be used.
- Either single chain Fv, bispecific antibody for T cell engagement, or chimeric antigen receptors can be used (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). That is, in non-limiting embodiments, intact antibody, a Fab fragment, a diabody, or a bispecific whole antibody can be used to inhibit HIV-1 infection in a subject (e.g., a human).
- a bispecific F(ab) 2 can also be used with one arm a targeting molecule like CD3 to deliver it to T cells and the other arm the arm of the native antibody (Chow et al, Adv. Exp. Biol.
- Toxins that can be bound to the antibodies or antibody fragments described herein include unbound antibody, radioisotopes, biological toxins, boronated dendrimers, and immunoliposomes (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)).
- Toxins e.g., radionucleotides or other radioactive species
- can be conjugated to the antibody or antibody fragment using methods well known in the art can be used.
- the invention also includes variants of the antibodies (and fragments) disclosed herein, including variants that retain the ability to bind to recombinant Env protein, the ability to bind to the surface of virus-infected cells and/or ADCC- mediating properties of the antibodies specifically disclosed, and methods of using same to, for example, reduce HIV-1 infection risk.
- Combinations of the antibodies, or fragments thereof, disclosed herein can also be used in the methods of the invention.
- Antibodies of the invention and fragments thereof can be produced recombinantly using nucleic acids comprising nucleotide sequences encoding VH and VL sequences selected from those shown in the figures and examples.
- the invention provides intact/whole antibodies.
- the invention provides antigen binding fragments thereof. Typically, fragments compete with the intact antibody from which they were derived for specific binding to the target including separate heavy chains, light chains Fab, Fab', F(ab').sub.2, F(ab)c, diabodies, Dabs, nanobodies, and Fv. Fragments can be produced by recombinant DNA techniques, or by enzymatic or chemical separation of intact immunoglobulins.
- the invention provides a bispecific antibody.
- a bispecific or bifunctional/dual targeting antibody is an artificial hybrid antibody having two different heavy /light chain pairs and two different binding sites (see, e.g., Romain Rouet & Daniel Christ "Bispecific antibodies with native chain structure” Nature Biotechnology 32, 136-137 (2014); Garber
- bispecific antibodies rise again” Nature Reviews Drug Discovery 13, 799-801 (2014), Figure la; Byrne et al. "A tale of two specificities: bispecific antibodies for therapeutic and diagnostic applications” Trends in Biotechnology, Volume 31, Issue 11, November 2013, Pages 621-632 Songsivilai and Lachmann, Clin. Exp. Immunol., 79:315-321 (1990); Kostelny et al., J. Immunol. 148: 1547-53 (1992) (and references therein)).
- the bispecific antibody is a whole antibody of any isotype. In other embodiments it is a bispecific fragment, for example but not limited to F(ab) 2 fragment. In some embodiments, the bispecific antibodies do not include Fc portion, which makes these diabodies relatively small in size and easy to penetrate tissues.
- the bispecific antibodies could include Fc region.
- Fc bearing diabodies for example but not limited to Fc bearing DARTs are heavier, and could bind neonatal Fc receptor, increasing their circulating half-life. See Garber "Bispecific antibodies rise again” Nature Reviews Drug Discovery 13, 799-801 (2014), Figure la; See US Pub 20130295121, incorporated by reference in their entirety.
- the invention encompasses diabody molecules comprising an Fc domain or portion thereof (e.g. a CH2 domain, or CH3 domain).
- the Fc domain or portion thereof may be derived from any immunoglobulin isotype or allotype including, but not limited to, IgA, IgD, IgG, IgE and IgM.
- the Fc domain (or portion thereof) is derived from IgG.
- the IgG isotype is IgGl, IgG2, IgG3 or IgG4 or an allotype thereof.
- the diabody molecule comprises an Fc domain, which Fc domain comprises a CH2 domain and CH3 domain independently selected from any immunoglobulin isotype (i.e. an Fc domain comprising the CH2 domain derived from IgG and the CH3 domain derived from IgE, or the CH2 domain derived from IgGl and the CH3 domain derived from IgG2, etc.).
- the Fc domain may be engineered into a polypeptide chain comprising the diabody molecule of the invention in any position relative to other domains or portions of the polypeptide chain (e.g., the Fc domain, or portion thereof, may be c-terminal to both the VL and VH domains of the polypeptide of the chain; may be n-terminal to both the VL and VH domains; or may be N-terminal to one domain and c-terminal to another (i.e., between two domains of the polypeptide chain)).
- the Fc domain, or portion thereof may be c-terminal to both the VL and VH domains of the polypeptide of the chain; may be n-terminal to both the VL and VH domains; or may be N-terminal to one domain and c-terminal to another (i.e., between two domains of the polypeptide chain)).
- the present invention also encompasses molecules comprising a hinge domain.
- the hinge domain be derived from any immunoglobulin isotype or allotype including IgA, IgD, IgG, IgE and IgM.
- the hinge domain is derived from IgG, wherein the IgG isotype is IgGl, IgG2, IgG3 or IgG4, or an allotype thereof.
- the hinge domain may be engineered into a polypeptide chain comprising the diabody molecule together with an Fc domain such that the diabody molecule comprises a hinge-Fc domain.
- the hinge and Fc domain are independently selected from any immunoglobulin isotype known in the art or exemplified herein.
- a polypeptide chain of the invention comprises a hinge domain, which hinge domain is at the C-terminus of the polypeptide chain, wherein the polypeptide chain does not comprise an Fc domain.
- a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the C-terminus of the polypeptide chain.
- a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the N-terminus of the polypeptide chain.
- the invention encompasses multimers of polypeptide chains, each of which polypeptide chains comprise a VH and VL domain, comprising CDRs as described herein.
- the VL and VH domains comprising each polypeptide chain have the same specificity, and the multimer molecule is bivalent and monospecific.
- the VL and VH domains comprising each polypeptide chain have differing specificity and the multimer is bivalent and bispecific.
- the polypeptide chains in multimers further comprise an Fc domain.
- Fc domains Dimerization of the Fc domains leads to formation of a diabody molecule that exhibits immunoglobulin-like functionality, i.e., Fc mediated function (e.g., Fc-Fc.gamma.R interaction, complement binding, etc.).
- Fc mediated function e.g., Fc-Fc.gamma.R interaction, complement binding, etc.
- diabody molecules of the invention encompass tetramers of polypeptide chains, each of which polypeptide chain comprises a VH and VL domain.
- two polypeptide chains of the tetramer further comprise an Fc domain.
- the tetramer is therefore comprised of two ' heavier polypeptide chains, each comprising a VL, VH and Fc domain, and two lighter polypeptide chains, comprising a VL and VH domain. Interaction of a heavier and lighter chain into a bivalent monomer coupled with dimerization of the monomers via the Fc domains of the heavier chains will lead to formation of a tetravalent immunoglobulin-like molecule.
- the monomers are the same, and the tetravalent diabody molecule is monospecific or bispecific. In other aspects the monomers are different, and the tetra valent molecule is bispecific or tetraspecific.
- Formation of a tetraspecific diabody molecule as described supra requires the interaction of four differing polypeptide chains. Such interactions are difficult to achieve with efficiency within a single cell recombinant production system, due to the many variants of potential chain mispairings.
- One solution to increase the probability of mispairings is to engineer "knobs-into-holes" type mutations into the desired polypeptide chain pairs. Such mutations favor heterodimerization over homodimerization.
- an amino acid substitution (preferably a substitution with an amino acid comprising a bulky side group forming a ' knob ' , e.g., tryptophan) can be introduced into the CH2 or CH3 domain such that steric interference will prevent interaction with a similarly mutated domain and will obligate the mutated domain to pair with a domain into which a complementary, or accommodating mutation has been engineered, i.e., ' the hole ' (e.g., a substitution with glycine).
- Such sets of mutations can be engineered into any pair of polypeptides comprising the diabody molecule, and further, engineered into any portion of the polypeptides chains of the pair.
- the invention also encompasses diabody molecules comprising variant Fc or variant hinge- Fc domains (or portion thereof), which variant Fc domain comprises at least one amino acid modification (e.g. substitution, insertion deletion) relative to a comparable wild-type Fc domain or hinge-Fc domain (or portion thereof).
- Molecules comprising variant Fc domains or hinge-Fc domains (or portion thereof) e.g., antibodies
- the variant phenotype may be expressed as altered serum half-life, altered stability, altered susceptibility to cellular enzymes or altered effector function as assayed in an NK dependent or macrophage dependent assay.
- Fc domain variants identified as altering effector function are known in the art. For example International Application WO04/063351, U.S. Patent Application Publications 2005/0037000 and 2005/0064514.
- the bispecific diabodies of the invention can simultaneously bind two separate and distinct epitopes.
- the epitopes are from the same antigen.
- the epitopes are from different antigens.
- at least one epitope binding site is specific for a determinant expressed on an immune effector cell (e.g. CD3, CD16, CD32, CD64, etc.) which are expressed on T lymphocytes, natural killer (NK) cells or other mononuclear cells.
- an immune effector cell e.g. CD3, CD16, CD32, CD64, etc.
- NK natural killer
- diabody molecules of the invention may exhibit Ig-like functionality independent of whether they further comprise an Fc domain (e.g., as assayed in any effector function assay known in the art or exemplified herein (e.g., ADCC assay).
- Fc domain e.g., as assayed in any effector function assay known in the art or exemplified herein (e.g., ADCC assay).
- Non-limiting examples of bispecific antibodies can also be (1) a dual-variable-domain antibody (DVD-Ig), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage (Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-Ig.
- DVD-Ig dual-variable-domain antibody
- TM. Molecule, In: Antibody Engineering, Springer Berlin Heidelberg (2010)); (2) a Tandab, which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (3) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (4) a so called “dock and lock” molecule, based on the "dimerization and docking domain" in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to a different Fab fragment; (5) a so-called Scorpion molecule, comprising, e.g., two scFvs fused to both termini of a human Fc-region.
- Examples of platforms useful for preparing bispecific antibodies include but are not limited to BiTE (Micromet), DART (MacroGenics) (e,g, US Patents 8,795,667; No. 2014-0099318; 2013-0295121; 2010- 0174053 and 2009-0060910; European Patent Publication No. EP 2714079; EP 2601216; EP 2376109; EP 2158221 and PCT Publications No.
- BiTE Meromet
- DART MicroGenics
- the bispecific antibody comprises an HIV envelope binding fragment, for example but not limited to an HIV envelope binding fragment from any of the antibodies described herein.
- the bispecific antibody further comprises a second antigen-interaction-site/fragment.
- the bispecific antibody further comprises at least one effector domain.
- the bispecific antibodies engage cells for Antibody -Dependent Cell- mediated Cytotoxicity (ADCC). In certain embodiments the bispecific antibodies engage natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. In certain embodiments the bispecific antibodies are T-cell engagers. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD3 binding fragment. Various CD3 antibodies are known in the art. See for example US Patent 8,784,821. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD 16 binding fragment.
- the invention provides antibodies with dual targeting specificity.
- the invention provides bi-specific molecules that are capable of localizing an immune effector cell to an HIV-1 envelope expressing cell, so as facilitate the killing of the HIV-1 envelope expressing cell.
- bispecific antibodies bind with one "arm” to a surface antigen on target cells, and with the second "arm” to an activating, invariant component of the T cell receptor (TCR) complex. The simultaneous binding of such an antibody to both of its targets will force a temporary interaction between target cell and T cell, causing activation of any cytotoxic T cell and subsequent lysis of the target cell.
- the immune response is re-directed to the target cells and is independent of peptide antigen presentation by the target cell or the specificity of the T cell as would be relevant for normal MHC -restricted activation of CTLs.
- CTLs are only activated when a target cell is presenting the bispecific antibody to them, i.e. the immunological synapse is mimicked.
- bispecific antibodies that do not require lymphocyte preconditioning or co-stimulation in order to elicit efficient lysis of target cells.
- BiTE bispecific T cell engager
- BiTEs are tandem scFv molecules wherein two scFv molecules are fused by a flexible linker.
- Further bispecific formats being evaluated for T cell engagement include diabodies (Holliger et al., Prot Eng 9, 299-305 (1996)) and derivatives thereof, such as tandem diabodies (Kipriyanov et al., J Mol Biol 293, 41-66 (1999)).
- DART dual affinity retargeting molecules are based on the diabody format that separates cognate variable domains of heavy and light chains of the two antigen binding specificities on two separate polypeptide chains but feature a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011)).
- the invention also contemplates Fc-bearing DARTs.
- triomabs which are whole hybrid mouse/rat IgG molecules and also currently being evaluated in clinical trials, represent a larger sized format (reviewed in Seimetz et al., Cancer Treat Rev 36, 458-467 (2010)).
- the invention also contemplates bispecific molecules with enhanced pharmacokinetic properties.
- such molecules are expected to have increased serum half-life.
- these are Fc-bearing DARTs (see supra).
- such bispecific molecules comprise one portion which targets HIV- 1 envelope and a second portion which binds a second target.
- the first portion comprises VH and VL sequences, or CDRs from the antibodies described herein.
- the second target could be, for example but not limited to an effector cell.
- the second portion is a T-cell engager.
- the second portion comprises a sequence/paratope which targets CD3, CD16, or another suitable target.
- the second portion is an antigen-binding region derived from a CD3 antibody, optionally a known CD3 antibody.
- the anti-CD antibody induce T cell- mediated killing.
- the bispecific antibodies are whole antibodies. In other embodiments, the dual targeting antibodies consist essentially of Fab fragments. In other embodiments, the dual targeting antibodies comprise a heavy chain constant region (CHI). In certain embodiments, the bispecific antibody does not comprise Fc region. In certain embodiments, the bispecific antibodies have improved effector function. In certain embodiments, the bispecific antibodies have improved cell killing activity.
- CHI heavy chain constant region
- the invention provides human, humanized and/or chimeric antibodies.
- the invention provides a pharmaceutical composition comprising an antibody of the invention wherein the composition is used for therapeutic purposes such as but not limited to prophylaxis, treatments, prevention, and/or cure.
- the invention provides a pharmaceutical composition comprising an antibody of the invention in combination with any other suitable antibody.
- the pharmaceutical compositions comprise nucleic acids which encode the antibodies of the invention. In certain embodiments, these nucleic acids can be expressed by any suitable vector for expression of antibodies.
- Non- limiting examples include attenuated viral hosts or vectors or bacterial vectors, recombinant vaccinia virus, adenovirus, adeno-associated virus (AAV), herpes virus, retrovirus, cytomegalovirus or other viral vectors can be used to express the antibody.
- attenuated viral hosts or vectors or bacterial vectors recombinant vaccinia virus, adenovirus, adeno-associated virus (AAV), herpes virus, retrovirus, cytomegalovirus or other viral vectors can be used to express the antibody.
- compositions include excipient suitable for a biologic molecule such as the antibodies of the invention.
- the antibodies could be produced in specific cell lines and conditions so as to control glycosylation of the antibody.
- the antibody framework for example, could comprise specific modification so as to increase stability of the antibody.
- the invention provides that the antibodies, and fragments thereof, described herein can be formulated as a composition (e.g., a pharmaceutical composition).
- a composition e.g., a pharmaceutical composition.
- Suitable compositions can comprise an inventive antibody (or antibody fragment) dissolved or dispersed in a pharmaceutically acceptable carrier (e.g., an aqueous medium).
- the compositions can be sterile and can be in an injectable form (e.g. but not limited to a form suitable for intravenous injection, intramascular injection).
- the antibodies (and fragments thereof) can also be formulated as a composition appropriate for topical administration to the skin or mucosa.
- Such compositions can take the form of liquids, ointments, creams, gels and pastes.
- the antibodies (and fragments thereof) can also be formulated as a composition appropriate for intranasal administration.
- the antibodies (and fragments thereof) can be formulated so as to be administered as a post-coital douche or with a condom. Standard formulation techniques can be used in preparing suitable compositions.
- the antibody (and fragments thereof), described herein have utility, for example, in settings including but not limited to the following: i) in the setting of anticipated known exposure to HIV-1 infection, the antibodies described herein (or fragments thereof) and be administered prophylactically (e.g., IV, topically or intranasally) as a microbiocide, ii) in the setting of known or suspected exposure, such as occurs in the setting of rape victims, or commercial sex workers, or in any homosexual or heterosexual transmission without condom protection, the antibodies described herein (or fragments thereof) can be administered as post-exposure prophylaxis, e.g., IV or topically, and iii) in the setting of Acute HIV infection (AHI), the antibodies described herein (or fragments thereof) can be administered as a treatment for AHI to control the initial viral load or for the elimination of virus-infected CD4 T cells.
- prophylactically e.g., IV, topically or intranasally
- the antibodies (or antibody fragments) described herein can be administered prior to contact of the subject or the subject's immune system/cells with HIV-1 or within about 48 hours of such contact. Administration within this time frame can maximize inhibition of infection of vulnerable cells of the subject with HIV-1.
- various forms of the antibodies described herein can be administered to chronically or acutely infected HIV patients and used to kill remaining virus infected cells by virtue of these antibodies binding to the surface of virus infected cells and being able to deliver a toxin to these reservoir cells.
- Suitable dose ranges can depend on the antibody (or fragment) and on the nature of the formulation and route of administration. Optimum doses can be determined by one skilled in the art without undue experimentation. For example but not limited, doses of antibodies in the range of 0.1-50 mg/kg, 1-50 mg/kg, 1-10 mg/kg, 1, 1.25, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg/kg of unlabeled or labeled antibody (with toxins or radioactive moieties) can be used.
- the antibodies of the invention can be administered at a suitable fixed dose, regardless of body size or weight. See Bai et al. Clinical Pharmacokinetics February 2012, Volume 51, Issue 2, pp 119-135.
- the invention provides use of the antibodies of the invention, including bispecific antibodies, in methods of treating and preventing HIV-1 infection in an individual, comprising administering to the individual a therapeutically effective amount of a composition comprising the antibodies of the invention in a pharmaceutically acceptable form.
- the methods include a composition which includes more than one HIV-1 targeting antibody.
- the HIV-1 targeting antibodies in such combination bind different epitopes on the HIV-1 envelope.
- such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased killing of HIV-1 infected cells.
- such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased breadth in recognition of different HIV-1 subtypes.
- the composition comprising the antibodies of the invention alone or in any combination can be administered via EVI, subcutaneous, or IV delivery, or could be deposited at mucosal sites, such as the oral cavity to prevent maternal to child transmission, the rectal space or the vagina as a microbicide.
- the antibodies can be administered locally in the rectum, vagina, or in the oral cavity, and can be formulated as a microbiocide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525.; Multipurpose prevention technologies for reproductive and sexual health. Stone A. Reprod Health Matters. 2014 Nov;22(44):213-7.
- antibodies can be formulated such that the therapeutic antibody or combination thereof is impregnated on a vaginal ring (Chen Y et al. Drug Des. Devel. Ther 8: 1801-15, 2014;Malcolm RK et al BJOG 121 Suppl 5: 62-9, 2014). Antibodies can be administered alone or with anti -retroviral drugs for a combination microbicide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525).
- the antibodies can be administered in complex with a form of HIV Env, optimally gpl20, but also an Env trimer, to enhance Env immunogenicity.
- the antibodies can be delivered by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447).
- the antibodies can be administered in viral vector, for example but not limited to adenoassociated viral vector, for expression in muscle and plasma.
- antibodies with different binding specificities are combined for use in pharmaceutical compositions and therapeutic methods.
- CD4 binding site antibodies are combined with V3 antibodies, MPER antibodies and so forth.
- Figures 8, 9 and 10 show a selection of potent HIV-1 neutralizing antibodies which can be used in pharmaceutical compositions, and therapeutic methods.
- Non-limiting examples of selections of combinations of certain antibodies include: DH542, DH542 L4, DH542 QSA, DH429 and DH512 (or any of the DH512 variants); DH512 and CH31 (See US Publication 20140205607); DH512 (or any of the other DH512 variants) and DH540 (See Example 8, and this antibody will be described elsewhere); DH542, DH542 L4, DH542 QSA, DH429, DH512 and DH540; DH542, DH542 L4,
- a combination therapy envisions a composition which combines various antibodies.
- a combination therapy is provided wherein antibodies are administered as individual compositions, for example at different times, by different means, or at administered at different locations.
- a combination therapy is provides wherein a therapeutic antibody or antibodies is combined with other therapeutic means, for example anti -retroviral drug cocktails, or drugs which activate latently infected HIV-1 cells.
- the disclosed antibodies or antigen binding fragments thereof are used to determine whether HIV-1 envelope(s) is a suitable antigen for inclusion in a vaccine composition.
- the antibodies can be used to determine whether an antigen in a vaccine composition including gpl20 assumes a conformation including an epitope bound by the inventive antibodies or fragments thereof.
- This can be readily determined by a method which includes contacting a sample containing the vaccine, such as a gpl20 antigen, with a disclosed antibody or antigen binding fragment under conditions sufficient for formation of an immune complex, and detecting the immune complex, to detect an HIV-1 antigen including an epitope of an inventive antibody in the sample.
- the detection of the immune complex in the sample indicates that vaccine component, such as a HIV-1 Env antigen assumes a conformation capable of binding the antibody or antigen binding fragment.
- Example 1 Isolating antibodies from natural HIV-1 infected individuals
- these cultures are grown and supernatants are functionally characterized.
- PCR on these cells is carried out according to the protocol in Liao HX et al. J. Virol.
- VH and VL genes are selected and made in linear cassettes (essentially as described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009, see for example Figure 1, Section 3.3) to produce recombinant monoclonal antibodies by transient transfection, e.g. in 293T cells.
- Recombinant antibodies are grown and supernatants and/or purified antibodies are functionally characterized.
- Pairs of VH and VL genes as selected above can also be used to produce plasmids for stable expression of recombinant antibodies.
- the plasmids or linear constructs for recombinant antibody expression also comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via K cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4 th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid).
- the antibodies of the invention were selected based on a combination of criteria including sequence analyses, and functional analyses including but not limited as neutralization breadth, and potency.
- the antibodies of the invention comprise naturally rearranged VH and VL gene pairs isolated as nucleic acids, wherein the rest of the Ig gene is not naturally occurring with the isolated rearranged VH and VL fragments. In certain embodiments, the antibodies of the invention are recombinantly produced.
- Antibodies II (DH270IA1), 12, 14, 13 and UCA in Figure 8 are not isolated from human subjects but are derived computationally based on VH and VL sequences of other clonal antibodies identified from memory B cells: DH471, DH429, DH473, DH391 and DH270.
- the VH and VL sequences of DH471, DH429, DH473, DH391 and DH270 are derived from a human subject infected with HIV- 1.
- VH and VL sequences of DH471, DH429 and DH473 are derived essentially as described in Example 1, using Consensus C gpl20 Env and Consensus C gpl20 N332A Env glycopeptides and by sorting cells that bound to Consensus C gpl20 Env but not to Consensus C gpl20 N332A Env.
- DH270 and DH391 were recombinantly produced from VH and VL chains isolated from clonal memory B cell cultures that bound to Consensus C gpl20 Env but not to Consensus C gpl20 N332A Env using the method previously described (Bonsignori et al J Virol 2011, Gao Bonsignori Liao et al Cell 2014).
- Neutralization data for antibodies II (DH270IA1) and DH429 is summarized in Figure 9, and Figure 10.
- Biotinylated Man 9 GlcNac 2 V3 peptides were tetramerized via streptavidin and conjugated with either AF647 or BV421 (Invitrogen) dyes. Peptide tetramer quality following conjugation was assessed by flow cytometry to a panel of well-characterized HIV-1 V3 glycan antibodies (PGT128, and 2G12) and linear V3 antibodies (F39F). The sequence of Man9V3 glycopeptide is
- EINCTRPNNNTRPGEIIGDIRQAHCNISRA This is a synthetic glycopeptide which has N-linked glycans (Man9GlcNac2) placed at the Asparagine residues in bold/underlined.
- the cysteine residues at the N and C terminal form a disulfide linkage under oxidative conditions creating a very stable cyclical conformation that expresses the epitope bound by V3 glycan bnAbs such as PGT128, 125, and 2G12, and now DH542 and other DH270 lineage members.
- PBMCs peripheral blood mononuclear cells
- PBMCs that were AquaVital dye " , CD14 “ , CD16 “ , CD3 “ , CD235a “ , IgD “ , CD19 + , CD38 + , and Man 9 GlcNac 2 V3 + were single-cell sorted using a BD FACS Aria II into 96-well plates containing 20 ⁇ of reverse transcriptase buffer (RT). cDNA synthesis was performed as previously described (1).
- Immunoglobulin (Ig) heavy (VH) chains were PCR amplified using a nested approach. VH genes were amplified in the first round of amplification with primers grouped in Table la-le as previously described (2).
- Nested amplification of VH genes was performed as in (Liao et al., 2009) with primers grouped in Table 2a. Kappa and lambda were amplified as in (Liao et al., 2009), with primers grouped in Table 2b- 2c. PCR products were analyzed on 2% SYBR Safe E-Gels (Invitrogen). PCR-amplified VH and VL genes were purified and sequenced. Sequences were analyzed and VDJ arrangements were inferred using computational methods as previously described (3, 4).
- VH1 Leader B ATGGACTGGACCTGGAGCAT
- VH1 Leader C ATGGACTGGACCTGGAGAAT
- VH1 Leader E ATGGACTGGACCTGGAGGGT
- VH1 Leader F ATGGACTGGATTTGGAGGAT
- VH2 Leader A ATGGACATACTTTGTTCCACGCTC
- VH2 Leader B ATGGACACACTTTGCTCCACGCT
- VH2 Leader C ATGGACACACTTTGCTACACACTC
- VH1 Leader A ATGGACTGGACCTGGAGGAT
- VH1 Leader B ATGGACTGGACCTGGAGCAT
- VH1 Leader C ATGGACTGGACCTGGAGAAT
- VH1 Leader E ATGGACTGGACCTGGAGGGT
- VH1 Leader F ATGGACTGGATTTGGAGGAT
- VH2 Leader A ATGGACATACTTTGTTCCACGCTC
- VH2 Leader B ATGGACACACTTTGCTCCACGCT
- VH2 Leader C ATGGACACACTTTGCTACACACTC
- VH4 Leader D ATGAAACATCTGTGGTTCTT
- VLB Leader DGCTATTTTTAAAGGTGTCCAGTGT VH4 Leader AATGAAACACCTGTGGTTCTTCC VH4 Leader B ATGAAACACCTGTGGTTCTT
- VH4 Leader C ATGAAGCACCTGTGGTTCTT
- VL4c Ext ACAGGTCTCTGTGCTCTGC
- DH270 N332 dependent V3 glycan bnAb lineage [0152] DH270 N332 dependent V3 glycan bnAb lineage.
- pseudoviruses reduced CH848 plasma neutralization of these viruses, and demonstrated the presence of plasma N332-sensitive bnAbs (reference Georgiev paper).
- memory B cells from weeks 205, 232 and 234 post-transmission using clonal memory B cell cultures and antigen-specific memory B cell sorting and isolated 6 naturally paired VH + VL N332- sensitive antibodies, designated DH270.1-6.
- V H mutation frequencies of the isolated antibodies ranged from 5.6% (DH270.1) to 12.9% (DH270.6) ( Figure 29).
- the DH270 unmutated common ancestor antibody (DH270.UCA) did not neutralize heterologous HIV-1, but intermediate antibody 4 (DH270.IA4), which differed from UCA by 4 amino acids in the VH gene segment and one amino acid in VL neutralized 4/24 strains (16.7%) ( Figure 28B).
- DH270.IA4 acquired neutralizing activity while retaining the unmutated CDR H3 of the UCA.
- DH270-lineage heterologous neutralization evolved in two phases: first, early mutations conferred neutralization breadth , and second, further mutations enhanced neutralization potency.
- DH270.1, DH270.5 and DH270.6 neutralization breadth was further evaluated in a large multi-clade panel of 201 HIV-1 heterologous strains (Figure 28C).
- Kepler TB Reconstructing a B-cell clonal lineage. I. Statistical inference of unobserved ancestors. FlOOOResearch. 2013;2: 103. Epub 2014/02/21. doi: 10.12688/fl000research.2-103.vl . PubMed PMID: 24555054; PubMed Central PMCID: PMCPmc3901458.
- PubMed PMID 21987658; PubMed Central PMCID: PMCPmc3201211. 6. Liao HX, Levesque MC, Nagel A, Dixon A, Zhang R, Walter E, Parks R, Whitesides J, Marshall DJ, Hwang KK, Yang Y, Chen X, Gao F, Munshaw S, Kepler TB, Denny T, Moody MA, Haynes BF. High-throughput isolation of immunoglobulin genes from single human B cells and expression as monoclonal antibodies. Journal of virological methods. 2009; 158(l-2): 171-9. Epub 2009/201712. doi: 10.1016/j .jviromet.2009.02.014. PubMed PMID: 19428587; PubMed Central PMCID: PMCPmc2805188.
- DH542 is a V3 glycan bnAb from individual CH848 identified at 234 weeks post infection. This antibody was produced recombinantly from VH and VL sequences amplified by PCR from single cells sorted from PBMCs using Man9V3 glycopeptide tetramer ( Figure 1). DH542 is a member of the DH270 V3 glycan BnAb lineage ( Figure 8).
- Figure 2A shows the gene information of DH542 and Figure 2B shows DH542 sequences.
- Example 3 TZM-bl cells pseudo-viruses neutralization assay
- TZMbl neutralization assay is a standard way to evaluate antibody breadth and potency. See Montefiori, D. Methods Mol Biol. 2009;485:395-405; HIV-1 Env-pseudoviruses infection of TZM-bl cells. Exemplary pseudovirus neutralization assays and panels of HIV-1 pseudovirus are described for example, in Li et al., J Virol 79, 10108-10125, 2005, Seaman et al, J. Virol., 84: 1439-1452, 2010; Sarzotti-Kelsoe et al., J. Immunol. Methods, 409: 131-46, 2014; and
- WO2011/038290 each of which is incorporated by reference herein.
- Various HIV-1 isolates, both Tier 1 and Tier 2 viruses can be included in this assay.
- the TZMbl assay was conducted to determine neutralization potency and breadth of the various antibodies of the invention on different HIV-1 pseudoviruses.
- Kd measurements of antibody binding to HIV-1 envelope will be determined by Surface Plasmon Resonance measurements, for example using Biacore, or any other suitable technology which permits detection of interaction between two molecules in a quantitative way.
- Example 5 Assay for self-reactivity
- AtheNA Multi- Lyte ANA Plus Test System is one such assay. This is luminex-based assay, which is also used to screen patient sera. In our experiments the criteria for positivity is as follows: an antibody is positive for autoreactivity if reactive at 25 ⁇ g/ml.
- Table 4 Summary of immunoflourescent (IF) staining of Hep2 cells data for antibodies DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
- IF immunoflourescent
- Figures 6 and 7 show a summary of binding to autoantigen in the AtheNA assay and HEp-2 cell IF staining for DH542.
- Table 5 Summary of Athena data for DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
- CH557 is a potent and extremely broad CD4 mimic CD4bs bnAb
- UCA CH235 antibody lineage
- IA4, IA3, IA2, IA1, CH235, CH236, CH239, CH240 and CH241 reactivity against autoantigens developed among early CH235 lineage members with maturation.
- Table 6 Summary of Athena assay results for CH557. Results are expressed as relative luminescence units. Readings ⁇ 100 are considered negative, results between 100 and 120 are considered “indeterminate” and results >120 are considered positive. CH557 is negative for all the antigens tested at all antibody concentrations ranging from 6.25 ug/ml to 50 ug/ml.
- Table 7 Summary of Athena assay results for various other antibodies of the CH235 lineage. Results are expressed as relative luminescence units. Readings ⁇ 100 are considered negative, results between 100 and 120 are considered “indeterminate” and results >120 are considered positive. CH236, CH239, CH235 IA1 and IA2 are positive for multiple antigens.
- Table 8 Summary of ELISA cardiolipin assay results for CH557 and various other antibodies. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm (OD450). OD450 ⁇ 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. CH557 did not bind to cardiolipin.
- Table 9 Summary of binding of listed antibodies to cardiolipin in ELIS A. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm 3333333 (.OD450). OD450 ⁇ 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. The majority of CH235 lineage antibodies, with the exception of CH235 IA3, IA4, CH235 and 1111111 . CH240 (the former has borderline binding), bound to cardiolipin.
- CH557 is one example of a CD4 binding site antibody which can be used in combination with the V3 glycan antibodies of the invention.
- VH and VL sequences of CD4 binding site antibodies are described in Figures 21 and 23.
- MPER antibodies from the DH511 lineage and variants as described herein, can be used in combination with the V3 antibodies of the invention.
- MPER antibodies sequences are described for example in Figures 12A and 12B, Figure 13.
- DH512 K3 is a combination of VH from DH512 and VL called DH511 2AVK
- Example 8 DH540 antibody is described elsewhere.
- DH540 sequences are described in Figure 22 and the antibody is described in detail in US Ser. No. 62/170,558, filed June 3, 2015.
- TZM-bl neutralization assay was conducted to determine neutralization potency and breadth of different viruses by DH542-L4, DH542, PGT128, PGT121, 10-1074, DH270 and DH471.
- Figures 14 and 15 show the results of neutralization against a panel of HIV isolates in the TZM-bl pseudovirus neutralization assay. Figures 14 and 15 also show the mean IC50, IC80 and percent of isolates neutralized at an different IC50 or IC80 values.
- This example describes chimeric antibodies comprising non-natural VH and VL chain pairs.
- Lines 2-4 in Figure 25 show antibodies having DH542 VH chain paired with VLs from other antibodies from the DH270 lineage.
- VH chains (I0848_00001_L1_4A; I0848_00004_L1_4A;
- VH chains which were identified by Illumina sequences and not as natural VH:VL pair, were paired with VL sequences from a VELVL pair with the closest VH sequence— lines 5-9 in Figure 25. In other instances, VH chains
- VH sequences are referenced interchangeably as I0848_00001 or I0848_00001 _L1_4A, .
- I0848_00004 or I0848_00004 _L1_4A I0848_00005 or I0848_00005 _L1_4A, I0848_00006 or I0848_00006 _L1_4A, I0848_00007 or I0848_00007 _L1_4A.
- VH and/or VL chain pairs are contemplated.
- these pairings include VH and/or VL chains from antibodies DH542, DH542QSA, DH429, DH471, DH391, and/or DH473.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Communicable Diseases (AREA)
- Tropical Medicine & Parasitology (AREA)
- AIDS & HIV (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The invention is directed to HIV-1 neutralizing antibodies, CD4 binding site and V3 glycan antibodies, and methods for their uses.
Description
HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF (V3 antibodies)
[0001] This application claims the benefit of and priority to U.S. Application Serial No. 62/191,054 filed July 10, 2015, U.S. Application Serial No. 62/222, 175 filed September 22, 2015, U.S.
Application Serial No. 62/261,233 filed November 30, 2015, U.S. Application Serial No.
62/135,309 filed March 19, 2015, and U.S. Application 62/260,100 filed November 25, 2015 the entire content of each application is herein incorporated by reference in its entirety.
[0002] This patent disclosure contains material that is subject to copyright protection. The copyright owner has no objection to the facsimile reproduction by anyone of the patent document or the patent disclosure as it appears in the U.S. Patent and Trademark Office patent file or records, but otherwise reserves any and all copyright rights.
[0003] All patents, patent applications and publications cited herein are hereby incorporated by reference in their entirety. The disclosure of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art as known to those skilled therein as of the date of the invention described herein.
GOVERNMENT SUPPORT
[0004] This invention was made with government support under Center for HIV/ AIDS Vaccine
Immunology-Immunogen Design grant UM1-AI100645 from the NIH, NIAID, Division of AIDS. The government has certain rights in the invention.
FIELD OF THE INVENTION
[0005] The invention relates to the identification of monoclonal HIV-1 neutralizing antibodies, such as, but not limited to, antibodies that bind to the V3 region of HIV-1 Env glycoprotein, their recombinant expression and purification and uses.
BACKGROUND
[0006] It is well documented that essentially all HIV-1 infected individuals develop antibodies capable of binding HIV-1 envelope, but that only a small subset of these antibodies are neutralizing and capable of blocking viral entry in target cells. See e.g. Doria-Rose N. "HIV Neutralizing
Antibodies: Clinical Correlates and Implications for Vaccines" The Journal of Infectious Diseases
(2010) Volume 201, Issue 7 Pp. 981-983. Over the time of an infection, some individuals develop neutralizing antibodies, and with some of these neutralizing antibodies having activity against diverse primary HIV-1 isolates. A number of broad neutralizing monoclonal antibodies (mAbs) have been identified from HIV-1 infected individuals and these define specific regions on the virus
envelope, e.g. CD4 binding site, V3 loop, membrane proximal region (MPER) of gp41, that are vulnerable to neutralizing Abs.
[0007] Broadly neutralizing HIV-1 antibodies have been identified only from natural HIV-1 infection. See e.g. Mascola and Haynes, Immunological Reviews (2013) Vol. 254: 225-244. Some examples of broadly neutralizing antibodies (bnAbs) targeting CD4 binding site or V3 loop are VRCOl, CH103, CH31, CH98, 8ANC131, PGT121, PGT128. Unfortunately, so far none of these antibodies have been developed for HIV prevention or treatment. Thus, the need exists for monoclonal broadly neutralizing antibodies that can be developed and used for prevention and treatment for an infectious agent, such as HIV.
SUMMARY OF THE INVENTION
[0008] In certain aspects the invention provides an antibody or fragment thereof with the binding specificity of V3 glycan binding antibody DH542 (e.g. Figure 2B).
[0009] In certain aspects the invention provides an antibody or fragment thereof with the binding specificity of V3 glycan binding antibody DH542 QSA (e.g. Figure 16).
[0010] In certain aspects the invention provides an antibody or fragment thereof with the binding specificity of V3 glycan binding antibody of Example 10. In a non-limiting example the antibody is DH542_L4 (e.g. Figure 25).
[0011] In certain aspects the invention provides a V3 binding antibody wherein the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the VH chain of an antibody from DH270 lineage (Figures 8, 20B) and a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of an antibody from DH270 lineage (Figures 8, 16).
[0012] In certain aspects the invention provides a V3 binding antibody wherein the antibody or fragment thereof comprises the VH chain of an antibody from DH270 lineage (Figures 8, 20B) and the VL chain of an antibody from DH270 lineage (Figures 8, 16).
[0013] In certain embodiments, the antibody or fragment thereof is fully human and recombinantly produced. In certain embodiments, some of the VH and VL chains are isolated from a human subject who have been naturally infected with HIV-1. In certain embodiments the antibody is not naturally occurring. In certain embodiments the antibody comprises the amino acids of naturally occurring pair of VH and VL chains. In certain embodiments the antibody comprises amino acids of naturally occurring pair of VH and VL chains wherein the Fc portion of the antibody is not the natural isotype or portion of the naturally occurring pair of VH and VL chains. In certain embodiments the antibody is computationally designed, for example based on some naturally
isolated VH and VL sequences. In certain embodiments the antibody is computationally designed, e.g. UCA, Intermediates in the antibody lineages. In certain embodiments the antibody comprises a non-naturally occurring pairing of VH and VL chains, wherein the VH or VL individually could be isolated from a subject. In some embodiments, the antibody comprises VH chain or HCDRs of a VH chain of one clonal member, and VL or LCDRs of another clonal member, i.e., a non-naturally occurring antibody comprising sequences derived from natural pairs. In certain embodiments the antibody comprises naturally occurring VH and VL chains modified by substituting one or more amino acids.
[0014] In certain embodiments the antibody or fragment thereof is fully human.
[0015] In certain embodiments, the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542 or DH542 QSA, or any of the other lineage members. In certain embodiments, the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542, DH429 or
DH542 QSA, or any of the other lineage members.
[0016] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH542 or DH542 QSA. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the CDRl, CDR2, and CDR3 of antibody DH542 or DH542 QSA.
[0017] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of any of the V3 antibodies of the invention, including but not limited to antibody DH542, DH542 QSA, DH542-L4, or any of the antibodies listed in Figure 25 and further comprises the complementary VL which comprises the LCDR1, LCDR2, LCDR3 of antibody DH542, DH542 QSA, DH542-L4, or any of the antibodies listed in Figure 25. In certain embodiments, the antibody or fragment thereof comprises VH and VL of antibody DH542, DH429 or DH542 QSA.
[0018] In certain embodiments, the antibody is DH542. In other embodiments the antibody is DH542 L4. In other embodiments the antibody is DH542-QSA. Thus in certain embodiments, the invention provides at least three V3 antibodies wherein each antibody comprises VH sequence from DH542 (e.g. Figure 8) and VL sequence which can be VL sequence from DH542, VL sequence which is a VL from 542-QSA, or VL sequence from DH429.
[0019] In certain aspects, the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention or fragments thereof or any combination thereof.
[0020] In certain aspects, the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention, or a combination thereof.
[0021] In certain embodiments, the composition comprises an antibody or a fragment thereof which is recombinantly produced in CHO cells.
[0022] In certain aspects, the invention provides a pharmaceutical composition comprising a vector comprising a nucleic acid encoding anyone of inventive antibodies or fragments. In certain embodiments, the nucleic acids are optimized for expression in human host cells. In other embodiments, the nucleic acids are optimized for recombinant expression in a suitable host cell. In certain embodiments, the vector is suitable for gene delivery and expression. Non-limiting examples of such vectors include adenoviral vectors (Ads), adeno associated virus based vectors (AAVs), or a combination thereof. In certain aspects, the invention provides isolated cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof. In certain aspects, the invention provides compositions of cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof.
[0023] In certain embodiments, the compositions further comprise an additional antibody or fragment thereof. In certain embodiments, the compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH540. In certain embodiments, the compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH512.
[0024] In certain embodiments, the compositions further comprise an antibody or a fragment thereof comprising VH and VL chain of antibody DH429 or DH270IA1.
[0025] In certain embodiments the invention provides a composition which further comprises another therapeutic antibody with a different binding specificity. In certain embodiments, the invention provides an antibody or fragment thereof with the binding specificity of CD4 binding site antibody DH491 or CH493, or CH558, or CH557. In certain embodiments, the invention provides an antibody or fragment with the binding specificity of an MPER antibody.
[0026] In certain embodiments, the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody CH557, or any of the other lineage members. In certain embodiments, the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the VL chain of antibody CH557, or any of the other lineage members.
[0027] In certain embodiments, the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of
antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493 and further comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493.
[0028] In certain embodiments, the antibody or fragment thereof comprises VH and VL of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR3 of CH557 and further comprises a VL which comprises the LCDR3 of CH557.
[0029] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH512, DH512-K3, or a modified variant of DH512 VH. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody DH512 or DH512-K3. See U. S.
Application 62/260,100 filed November 25, 2015 incorporating by reference the sequences of the various MPER antibodies.
[0030] In certain embodiments, the antibody or antigen binding fragment can include an Fc domain that has been modified compared to a native Fc domain. In non-limiting embodiments, the Fc domain can be modified by amino acid substitution to increase binding to the neonatal Fc receptor and therefore the half-life of the antibody when administered to a subject.
[0031] In certain embodiments, the invention provides antibodies or fragments comprising a CDR(s) of the VH and/or VL chains, or VH and/or VL chains of the inventive antibodies, as the HIV-1 binding arm(s) of a bispecific molecules, e.g. but not limited to DARTS, diabodies, toxin labeled HIV-1 binding molecules.
[0032] In certain aspects the invention provides methods to treat or prevent HIV-1 infection in a subject comprising administering to the subject a pharmaceutical composition comprising any one of the inventive antibodies or fragments thereof in a therapeutically effective amount. The methods of the invention contemplate combination therapeutic methods, including but not limited to administering combinations of various antibodies or fragments thereof.
[0033] In certain embodiments of the methods, the pharmaceutical compositions are administered in a therapeutically effective dose and regimen.
BRIEF DESCRIPTION OF THE DRAWINGS
[0034] To conform to the requirements for PCT patent applications, many of the figures presented herein are black and white representations of images originally created in color.
[0035] Figure 1A shows index sorting of B cell that produced DH542 antibody, and Figure IB shows the V3 peptide used as a hook to sort B cells from individual CH848.
[0036] Figure 2 A shows the gene information of DH542 and Figure 2B shows DH542 sequences
(CDRs are bolded and underlined) (SEQ ID NOs: 1-4).
[0037] Figures 3 A and 3B show that in an ELISA assay DH542 binding to HIV-Env depends on V3 loop glycans.
[0038] Figures 4A-4D show DH542 neutralization data. Figure 4 A shows that DH542 neutralizes 71% of HIV-1 pseudoviruses tested in the TZM-bl assay. Figure 4B shows neutralization of a panel of 24 viruses. Figures 4C and 4D show summary of neutralization data from TZM-bl assay.
[0039] Figure 5 shows that DH542 binds high-mannose glycans. The data represent antibody binding measured with a custom oligomanose glycan array— average from three separate glycan arrays. The glycan array is printed by Zbiotech (Aurora, CO) on polymer coated glass slides. Each glycan is printed in triplicate at three different concentrations. The antibody DH542 was diluted in PBS supplemented with 1% BSA to a final concentration of 50 ug/mL, and incubated on the glycan array for 1 h at room temperature. Unbound antibody is washed away with 5 washes with PBS- T. The binding of DH542 is detected with an anti-IgG Fc antibody conjugated to Cy3. The Cy3 intensity for each glycan is read with a GenePix 4000B array scanner and the means and standard error of the three replicates are shown in the graph. The data show that DH542 is a direct glycan binding HIV-1 antibody. It binds most strongly to Man9GlcNAc2 which is similar to known bnAbs such as PGT128 and 2G12. DH542 bound well to Man8GlcNAc2 and Man7GlcNAc2, but at a lower level than Man9GlcNAc2. Binding was also detected for two other lower forms of oligomannose, but at decreased magnitudes. DH542 did not exhibit detectable binding to the GlcNAc2 alone, meaning that it requires mannose for glycan recognition, and more specifically, binds the highest forms of oligomannose (Man9GlcNAc2) with the greatest magnitude. Overall, DH542 is a glycan-reactive antibody that binds directly to the predominant glycan, high mannose, present on HIV-1 Envelope. The figure also shows the binding by the non-glycan reactive HIV antibody 19B. It shows no binding to 100 uM glycan printed on the array. The figure also shows that the prototypic gly can-dependent HIV-1 antibody PGT128 binds well to Man7GlcNAc2, Man8, and Man9. PGT128 is reported to bind best to Man8GlcNAc2and Man9GlcNAc2, which was confirmed here as well. DH542 is shown binding to 100 uM of high mannose glycans. DH542 also binds to Man7GlcNAc2D3, which is not bound by PGT128.
[0040] Figure 6 is summarized data showing that DH542 is not autoreactive by Athena ANA panel. Results are expressed as relative luminescence units. Readings <100 are considered negative, results between 100 and 120 are considered "indeterminate" and results >120 are considered positive.
[0041] Figure 7 shows that DH542 binds HEp2 cells as demonstrated by intracellular fluorescence staining— left panel shows DH542/293i 50ug/mL 40x obj 8 sec (2+), right panel shows
DH542/293i 25ug/mL 40x obj 8 sec (1+).
[0042] Figure 8 shows the amino acids sequences of VH and VL chains of antibodies of the DH270 lineage, and nucleic acid sequences encoding these amino acids. CDRs are highlighted in each antibody. DH270IA1 as listed in Figure 9 is the same antibody referred to as II in the sequence of Figure 8. The figure shows SEQ ID NOs: 5-16 (Heavy chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 17-28 (Heavy chain amino acid sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 29-40 (Light chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 41-52 (Light chain amino acid sequences in order of appearance from UCA-DH270H).
[0043] Figure 9 shows Neutralizing Breadth and Potency of various HIV-1 BnAbs that are candidates for being combined with the inventive antibodies or other antibodies in Figure 4 for a potent mixture of bnAbs. DH270IA1 is II in the DH270 lineage (See Figure 8).
[0044] Figure 10 shows Neutralizing Breadth and Potency of some candidate bnAbs for single or combination use.
[0045] Figure 11 shows a clonal tree that was estimated using both the heavy and light chains of the listed lineage members.
[0046] Figure 12A shows nucleic acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 53-72). Figure 12B shows amino acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 73-93).
[0047] Figures 13A-13D show non-limiting examples of mutations in the VH chain of DH511 and DH512, and non-limiting examples of sequences including mutations in DH512 VH chain. Figure 13 A shows positions in the VHCDR3 chain of DH511 which could be mutated. Amino acid positions refer to Kabat numbering. Most mutations are to changes to W, but F, L, or possibly other substitutions can also be tried. Figure 13B shows positions in the VHCDR3 chain of DH512 which could be mutated. Amino acid positions refer to Kabat numbering for the DH512VH chain: QVQLVQSGGGLVKPGGSLTLSCSASGFFFDNSWMGWVRQAPGKGLEWVGRIRRLKDGAT GEYGAAVKDRFTISRDDSRNMLYLHMRTLKTEDSGTYYCTMDEGTPVTRFLEWGYFYYY MAVWGRGTTVIVSS (SEQ ID NO: 94). Most mutations are to changes to W, but F, L, or
possibly other substitutions can also be tried. For both DH511 and DH512 position V100 can be changed to I. Position LlOOd can be changed to F. For both DH511 and DH512 combination mutations in the DH512 or DH511 VHCDR3 could include VH LlOOdF together with TlOOaW; VH LlOOdW together with TlOOaW. Figure 13C shows positions outside of VHCDR3 which could be mutated. Most mutations are to changes to W, but F, L or possibly other substitutions can also be tried. Figure 13D shows amino acid sequences of some of the DH512 mutants from Figure 31 (SEQ ID NOs: 95-112).
[0048] Figure 14A shows summary results of neutralization data of DH542 L4, DH542, PGT128, PGT 121, 10-1074, DH270 and DH471 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC50 in μg/ml. Figure 14B shows the mean IC50 and percent of isolates neutralized at different IC50 values. Median and Geometric Mean titers are calculated only for samples with IC50 <50ug/ml. Values less than the lowest concentration assayed were assigned a value 2-fold less for calculation purposes. Indicated in italics.
[0049] Figure 15A shows summary results of neutralization data of DH542 L4, DH542, PGT 128, PGT 121, 10-1074, DH270 and DH471 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC80 in μg/ml. Figure 15B shows the mean IC80 and percent of isolates neutralized at different IC80 <50ug/ml values. Median and Geometric Mean titers are calculated only for samples with IC80 <50ug/ml. Values less than the lowest concentration assayed were assigned a value 2-fold less for calculation purposes. Indicated in italics.
[0050] Figure 16 shows DH542 QSA sequences (SEQ ID NO: 113-116). DH542 QSA is a variant of DH542. The heavy chain is identical to that of DH542. The light chain has some variation in the N-terminus.
[0051] Figure 17A shows an alignment of amino acid and Figure 17B shows an alignment of nucleic acid sequences of VH and VL chains for antibodies from the DH270 lineage. CDRs are highlighted and underlined in the UCA. The Figure 17A shows SEQ ID NOs: 117-126 (Heavy chain nucleotide sequences in order of appearance from UCA-DH270), SEQ ID NOs: 127-136 (Heavy chain amino acid sequences in order of appearance from UCA-DH270). Figure 17B shows SEQ ID NOs: 137-146 (Light chain nucleotide sequences in order of appearance from UCA- DH270), SEQ ID NOs: 147-156 (Light chain amino acid sequences in order of appearance from UCA-DH270H)
[0052] Figure 18 shows neutralization by antibodies DH272, DH272 UCA, DH391 and DH542 identified from subject CH848 and DH563 identified from subject CH0765 measured in TZM-bl cells. Pseudoviruses were produced by transfection in 293T cells. Values are the antibody concentration ^g/ml) at which relative luminescence units (RLUs) were reduced 50% compared to
virus control wells (no test sample). Values in bold are considered positive for neutralizing antibody activity. DH542 IC50 neutralization summary: mean IC50 = 0.21 μg/ml; geometric mean = 0.08 μg/ml; median IC50 = 0.06 μg/ml.
[0053] Figure 19A shows a phylogenetic tree of VH sequences from CH0848 donor. The tree includes VH chains from natural VH:VL pairs (identified by single cell sorts) and VH chains identified by Illumina sequencing. Figure 19B shows a detailed view of the bottom portion of the tree in 19A. Figure 19C shows the IDs of the VH chains.
[0054] Figure 20A shows sequences of VH chains identified from CH0848 donor by Illumina deep sequencing (SEQ ID NOs: 157-166). No natural VL sequence pairing was identified for these VH sequences. Figure 20B shows an alignment of the sequences in Figure 20 A.
[0055] Figure 21 shows sequences of CH557 (SEQ ID NOs: 167-170). CDRs are bolded and underlined.
[0056] Figure 22 shows a sequence alignment of the CD540-VRC40 antibodies, listing the heavy and light chain variable region sequences, Kabat and EVIGT CDR and framework regions, and Kabat numbering. The heavy (SEQ ID NOs: 171-174) and light (SEQ ID NOs: 175-178) chain variable region sequences of the CH540-VRC40.01, CH540-VRC40.02, CH540-VRC40.03, CH540-VRC40.04 are shown.
[0057] Figure 23 shows amino acid alignment of CH235 lineage antibody heavy chain and light chain (SEQ ID NOs: 179-190, in order of appearance from UCA HC to CH557 HC). Antibodies are listed in ascending order of somatic mutations and compared to the inferred unmutated common ancestor previously published (Gao, Bonsignori, Liao et al. Cell 2014)
[0058] Figure 24 shows amino acid alignment of CH235 lineage antibody light chain (SEQ ID NOs: 191-200, in order of appearance from UCA LC to CH556 LC). Antibodies are listed in ascending order of somatic mutations and compared to the inferred unmutated common ancestor previously published (Gao, Bonsignori, Liao et al. Cell 2014)
[0059] Figure 25 shows the names and VH:VLcomposition of chimeric antibodies of Example 10. Sequences for these antibodies are shown in Figures 8, 16 and 17.
[0060] Figures 26A and 26B show a summary of neutralization data for the chimeric antibodies of Example 10. Viruses used in this TZMBl assay are described in the side line of the table in Figures 26 A and 26B. Antibodies are shown in the top line of the table.
[0061] Figure 27 shows a summary of neutralization data for the chimeric antibodies of Example 10. Dotted line shows median IC50 of all viruses including those not neutralized; <0.023 graphed as 0.01; >50 graphed as 50.
[0062] Figure 28 A shows Phylogram of DH270 lineage. Sequences shown were isolated by NGS in longitudinal analysis that overlapped in two separate runs. The phylogeny was computed by collapsing on a radius of 8 base pairs and the 90 sequences shown are representative of a total of 1500 sequences. VH sequences of isolated DH270 lineage antibodies were added and the lineage was inferred using Cloanalyst. Figure 28B shows Heatmap analysis of neutralization of 24 pseudoviruses (row) by 11 DH270 lineage mAbs. Figure 28C shows Neutralization dendrograms display of DH270.6 (right) neutralization of a genetically diverse panel of 200 HIV-1 isolates. Coloration is by IC50 (red: <1 ug/ml; green: 1-50 ug/ml; black: >50 ug/ml).
[0063] Figure 29 shows VH and VL mutation frequencies of the isolated antibodies.
[0064] Figure 30 shows Neutralization of wild-type and N332 mutated HIV-1 strains AC13.8, PV04, TRO. l 1, AC 10.0.29 and RHP A confirmed DH270 lineage N332 sensitivity of
neutralization.
[0065] Figure 31 shows the neutralization profile of DH270.6 most closely paralleled that of 10- 1074.
DETAILED DESCRIPTION
[0066] Broadly neutralizing and potent HIV-1 envelope glycoprotein (Env) antibodies are now being developed for both prevention of HIV-1 (Rudicell RS et al. J. Virol 88: 12669,-82, 2014) and for treatment of HIV-1 infected individuals (Barouch DH, et al. Nature 503 : 224-8, 2013; Shingai M et al. Nature 503 : 277-80, 2013). Thus, human recombinant antibodies either alone or in combinations have great prophylactic and therapeutic potential for the prevention and treatment of HIV-1 infection. Moreover, antibodies that bind with high affinity to Env may be useful in eliminating the latent pool of HIV-1 -infected CD4 T cells and curing HIV-1 infection, when either used to sensitize HIV-1 expressing target cells with bispecific bnAbs for NK or CD8 T cell killing or when bnAbs are conjugated with toxins or radionucleotides.
[0067] In certain aspects the invention provides fully human antibodies and fragments that specifically bind to and potently neutralize various isolates of HIV-1. In some embodiments, the antibodies bind to HIV-1 env V3 glycan. In some embodiments, the antibodies of the invention are combined in compositions with antibodies to HIV-1 gpl20 Env CD4 binding site and/or MPER antibodies.
[0068] In certain aspects the invention provides pharmaceutical compositions including these human antibodies and a pharmaceutically acceptable carrier. In certain aspects the invention provides antibodies for passive immunization against HIV/ AIDS. Nucleic acids encoding these
antibodies, expression cassettes and vectors including these nucleic acids, and isolated cells that express the nucleic acids which encode the antibodies of the invention are also provided.
[0069] In some embodiments, the invention provides antibodies which are clonal variants. In some embodiments, clonal variants are sequences that differ by one or more nucleotides or amino acids, and have a V region with shared mutations compared to the germline, identical VHDJH or VJH gene usage, identical or similar HCDR3 length, and the same VL and JL usage. The germline sequence (unmutated common ancestor "UCA") is intended to be the sequence coding for the antibody/immunoglobulin (or of any fragment thereof) deprived of mutations, for example somatic mutations. Antibodies in a clone that are designated as UCA and/or I (for "Intermediate") are typically not identified from a biological sample, but are derived computationally based on VH and/or VL sequences isolated from subjects infected with HIV-1.
[0070] Compositions including the human antibodies of the invention, including V3 glycan and CD4 binding site antibodies, can be used for any purpose including but not limited to research, diagnostic and therapeutic purposes. In non-limiting embodiments, the human monoclonal antibodies disclosed herein can be used to detect HIV-1 in a biological sample or interfere with the HIV-1 activity, for example to diagnose or treat a subject having an HIV-1 infection and/or AIDS. For example, the antibodies can be used to determine HIV-1 titer in a subject. The antibodies disclosed herein also can be used to study the biology of the human immunodeficiency virus. The antibodies of the invention can be used for therapeutic purposes for treatment or prevention of HIV-1 infection, alone or in combination with other therapeutic modalities, including ART and/or combination with other HIV-1 targeting antibodies, neutralizing antibodies and/or ADCC inducing antibodies.
[0071] In some embodiments, the antibodies of the invention are expected not to exhibit self- reactivity— they do not bind or bind very weakly to self-antigens, such as human protein. For example, the antibodies of clone DH51 1 are not self-reactive although their UCA and some IAs are polyreactive. For use as preventive or therapeutic agents, what matters is whether the mature antibody will be polyreactive or not, and for example DH542 is not. DH270IA1 does not show self-reactivity, while DH491 and DH493 antibodies are polyreactive to varying degrees. Broadly neutralizing antibody CH557 displays exceptional neutralization breadth and high potency and it is not autoreactive nor polyreactive as determined by lack of binding to known human antigens associated with autoimmune disorders), negativity in Hep-2 cells IF staining and lack of binding to an array of 9,400 human antigens, including UBE3 A and STUB-1 proteins, known to be bound by previously described broadly neutralizing antibodies targeting the CD4bs of gpl20 Env (Liu et al J Virol 2014, Bonsignori et al JCI 2014).
[0072] The neutralization breadth of the inventive antibodies is demonstrated by the diversity of viruses which are neutralized in the TZMbl Env pseudovirus inhibition assay. In certain embodiments, the neutralization breadth and/or binding of the antibodies of the invention can be maintained in the presence of tolerate changes to the epitope. Comparing the sequences of the neutralized viruses, versus viruses that are not neutralized, a skilled artisan can readily determine the % virus changes, including changes in the epitope, which can be tolerated while neutralization and/or binding is maintained.
[0073] Comparing the sequences of the antibodies and their neutralization properties, a skilled artisan can readily determine sequence identity, compare sequence length and determine the % sequence identity and/or changes, including % sequence identity and/or changes in the VH and VL sequences, including % sequence identity and/or changes in the CDRs, as well as the specific positions and types of substitutions which can be tolerated while neutralization potency and breadth is maintained.
[0074] Various algorithms for sequence alignment are known in the art. The similarity between amino acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide will possess a relatively high degree of sequence identity when aligned using standard methods.
[0075] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math. 2:482, 1981; Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988; Higgins and Sharp, Gene 73 :237, 1988; Higgins and Sharp, CABIOS 5: 151, 1989; Corpet et al., Nucleic Acids Research 16: 10881, 1988; and Pearson and Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988. Altschul et al., Nature Genet. 6: 119, 1994, presents a detailed consideration of sequence alignment methods and homology calculations.
[0076] The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403, 1990) is available from several sources, including the National Center for Biotechnology Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
[0077] Homologs and variants of a VL or a VH of an antibody that specifically binds a polypeptide are typically characterized by possession of at least about 75%, for example at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity counted over
the full length alignment with the amino acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95%) depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
[0078] In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the VH and VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency. In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the CDR1, 2, and/or 3 of VH and CDR1, 2, and/or 3 VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency.
[0079] In certain embodiments, the invention provides antibodies which can tolerate a larger percent variation in the sequences outside of the VH and/VL sequences of the antibodies. In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, 70%, 69%, 68%, 67%, 66%, 65% identical, wherein the identity is outside of the VH or VL regions, or the CDRs of the VH or VL chains of the antibodies described herein.
[0080] Antibodies of the invention are expected to have the same binding specificity, for example as intact immunoglobulins and antigen binding variants or fragments e.g. as a number of well characterized fragments produced by digestion with various peptidases. For instance and without limitation, Fabs, Fvs, scFvs are fragments which are expected to have the same binding specificities as intact antibodies. Binding specificity can be determined by any suitable assay in the art, for example but not limited competition binding assays, epitope mapping, etc. Assays to determine glycan dependence and glycan specificity binding are also known in the art. A scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain
variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains. Provided are also genetically engineered forms such as chimeric antibodies and heteroconjugate antibodies such as bispecific antibodies. See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, 111.); Kuby, Immunology, 3.sup.rd Ed., W.H. Freeman & Co., New York, 1997.
[0081] In certain embodiments the invention provides antibody fragments, which have the binding specificity and/or properties of the inventive antibodies. Non-limiting examples include: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab', the fragment of an antibody molecule obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule; (3) (Fab1). sub.2, the fragment of the antibody obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; (4) F(ab').sub.2, a dimer of two Fab' fragments held together by two disulfide bonds; (5) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and (6) single chain antibody ("SCA"), a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule. In certain embodiments, the antibody fragments can be produces recombinantly.
[0082] In certain embodiments, VH refers to the variable region of an immunoglobulin heavy chain, including but not limited to that of an antibody fragment, such as Fv, scFv, dsFv or Fab. In certain embodiments, VL refers to the variable region of an immunoglobulin light chain, including but not limited to that of an Fv, scFv, dsFv or Fab.
[0083] Any of the nucleic acids encoding any of the antibodies, or fragment thereof can be expressed in a recombinantly engineered cell such as bacteria, plant, yeast, insect and mammalian cells. The nucleic acid sequences include any sequence necessary for expression, including but not limited to a promoter, a leader sequence. These antibodies can be expressed as individual VH and/or VL chain, or can be expressed as a fusion protein. In certain embodiments, the antibodies can be expressed by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447).
[0084] To create a single chain antibody, (scFv) the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gl Y4-Ser)3, such that the VH and VL sequences can be expressed as a contiguous
single-chain protein, with the VH and VL domains joined by the flexible linker (see, e.g., Bird et al., Science 242:423-426, 1988; Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988; McCafferty et al., Nature 348:552-554, 1990). Optionally, a cleavage site can be included in a linker, such as a furin cleavage site.
[0085] In some embodiments, a single chain antibody may be monovalent, if only a single VH and VL are used, bivalent, if two VH and VL are used, or polyvalent, if more than two VH and VL are used. Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope. Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope, and/or to another molecule.
[0086] There are numerous expression systems available for expression of proteins including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO, HeLa and myeloma cell lines.
[0087] In certain embodiments, the invention provides monoclonal antibodies. In certain embodiments the monoclonal antibodies are produced by a clone of B -lymphocytes. In certain embodiments the monoclonal antibody is a recombinant antibody or fragment thereof and is produced by a host cell into which the light and heavy chain genes of a single antibody have been transfected. Any suitable cell could be used for transfection and expression of the antibodies of the invention. Suitable cell lines include without limitation 293T cells or CHO cells.
[0088] Monoclonal antibodies are produced by any suitable method known to those of skill in the art. In some embodiments, monoclonal antibodies are produced by immortalizing B-cell expressing an antibody. Methods for immortalizing B-cells are known in the art, for example but not limited to using EBV transformation, treatment with various stimulants, and/or apoptotic inhibitors (Bonsignori et al. J. Virol. 85: 9998-10009, 2011). In some embodiments, monoclonal antibodies are produced by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells to make hybridomas. In some embodiments monoclonal antibodies are identified from a subject, for example but not limited as described in Example 1 (Liao HX et al. J Virol Methods. 2009 Jun; 158(l-2): 171-9). The amino acid and nucleic acid sequences of such monoclonal antibodies can be determined.
[0089] The antibodies described herein, or fragments thereof, may be recombinantly produced in prokaryotic or eukaryotic expression systems. These systems are well described in the art. In general, protein therapeutics are produced from mammalian cells. The most widely used host mammalian cells are Chinese hamster ovary (CHO) cells and mouse myeloma cells, including NS0 and Sp2/0 cells. Two derivatives of the CHO cell line, CHO-K1 and CHO pro-3, gave rise to the two most commonly used cell lines in large scale production, DUKX-X11 and DG44. (See, e.g.,
Kim, J., et al., "CHO cells in biotechnology for production of recombinant proteins: current state and further potential," Appl. Microbiol. Biotechnol., 2012, 93 :917-30, which is hereby
incorporated-by-reference.) Other mammalian cell lines for recombinant antibody expression include, but are not limited to, COS, HeLa, HEK293T, U20S, A549, HT1080, CAD, P19, NIH 3T3, L929, N2a, HEK 293, MCF-7, Y79, SO-Rb50, HepG2, J558L, and BHK. If the aim is large- scale production, the most currently used cells for this application are CHO cells. Guidelines to cell engineering for mAbs production were also reported. (Costa et al., "Guidelines to cell engineering for monoclonal antibody production," Eur JPharm Biopharm, 2010, 74: 127-38, which is hereby incorporated-by-reference.) Using heterologous promoters, enhancers and amplifiable genetic markers, the yields of antibody and antibody fragments can be increased. Thus, in certain embodiments, the invention provides an antibody, or antibody fragment, that is recombinantly produced from a mammalian cell-line, including a CHO cell-line. In certain embodiments, the invention provides a composition comprising an antibody, or antibody fragment, wherein the antibody or antibody fragment was recombinantly produced in a mammalian cell-line, and wherein the antibody or antibody fragment is present in the composition at a concentration of at least 1, 10, 100, 1000 micrograms/mL, or at a concentration of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or 100 milligrams/mL.
[0090] Furthermore, large-scale production of therapeutic-grade antibodies are much different than those for laboratory scale. There are extreme purity requirements for therapeutic-grade. Large- scale production of therapeutic-grade antibodies requires multiples steps, including product recovery for cell-culture harvest (removal of cells and cell debris), one or more chromatography steps for antibody purification, and formulation (often by tangential filtration). Because mammalian cell culture and purification steps can introduce antibody variants that are unique to the recombinant production process (i.e., antibody aggregates, N- and C- terminal variants, acidic variants, basic variants, different glycosylation profiles), there are recognized approaches in the art for analyzing and controlling these variants. (See, Fahrner, et al., Industrial purification of pharmaceutical antibodies: Development, operation, and validation of chromatography processes, Biotech. Gen. Eng. Rev., 2001, 18:301-327, which is hereby incorporated-by-reference.) In certain embodiments of the invention, the antibody composition comprises less than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 50, or 100 nanograms of host cell protein (i.e., proteins from the cell-line used to recombinantly produce the antibody)). In other embodiments, the antibody composition comprises less than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 ng of protein A per milligram of antibody or antibody fragment (i.e., protein A is a standard approach for purifying antibodies from recombinant cell culture, but steps should be done to limit the amount of protein A in the composition, as it may
be immunogenic). (See, e.g., U.S. Patent No. 7,458,704, Reduced protein A leaching during protein A affinity chromatography; which is hereby incorporated-by-reference.)
[0091] The antibodies of the invention can be of any isotype. In certain embodiments, the antibodies of the invention can be used as IgGl, IgG2, IgG3, IgG4, whole IgGl or IgG3s, whole monomelic IgAs, dimeric IgAs, secretory IgAs, IgMs as monomelic, pentameric or other polymer forms of IgM. The class of an antibody comprising the VH and VL chains described herein can be specifically switched to a different class of antibody by methods known in the art.
[0092] In some embodiments, the nucleic acid encoding the VH and VL can encode an Fc domain (immunoadhesin). The Fc domain can be an IgA, IgM or IgG Fc domain. The Fc domain can be an optimized Fc domain, as described in U.S. Published Patent Application No. 20100093979, incorporated herein by reference. In one example, the immunoadhesin is an IgGl Fc. In one example, the immunoadhesin is an IgG3 Fc.
[0093] In certain embodiments the antibodies comprise amino acid alterations, or combinations thereof, for example in the Fc region outside of epitope binding, which alterations can improve their properties. Various Fc modifications are known in the art. Amino acid numbering is according to the EU Index in Kabat. In some embodiments, the invention contemplates antibodies comprising mutations that affect neonatal Fc receptor (FcRn) binding, antibody half-life, and localization and persistence of antibodies at mucosal sites. See e.g. Ko SY et al., Nature 514: 642- 45, 2014, at Figure la and citations therein; Kuo, T. and and Averson, V., mAbs 3(5): 422-430, 2011, at Table 1, US Pub 20110081347 (an aspartic acid at Kabat residue 288 and/or a lysine at Kabat residue 435), US Pub 20150152183 for various Fc region mutation, incorporated by reference in their entirety. In certain embodiments, the antibodies comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via NK cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid). Other antibody mutations have been reported to improve antibody half-life or function or both and can be incorporated in sequences of the antibodies. These include the DLE set of mutations (Romain G, et al. Blood 124: 3241, 2014), the LS mutations M428L/N434S, alone or in a combination with other Fc region mutations, (Ko SY et al. Nature 514: 642-45, 2014, at Figure la and citations therein; Zlevsky et al., Nature Biotechnology, 28(2): 157-159, 2010; US Pub 20150152183); the YTE Fc mutations (Robbie G et al Antimicrobial Agents and Chemotherapy 12: 6147-53, 2013) as well as other engineered mutations to the antibody such as QL mutations, IHH mutations (Ko SY et al. Nature 514: 642-45, 2014, at Figure la and relevant citations; See also Rudicell R et al. J. Virol 88: 12669-82, 201). In
some embodiments, modifications, such as but not limited to antibody fucosylation, may affect interaction with Fc receptors (See e.g. Moldt, et al. JVI 86(11): 66189-6196, 2012). In some embodiments, the antibodies can comprise modifications, for example but not limited to
glycosylation, which reduce or eliminate polyreactivity of an antibody. See e.g. Chuang, et al. Protein Science 24: 1019-1030, 2015. In some embodiments the antibodies can comprise modifications in the Fc domain such that the Fc domain exhibits, as compared to an unmodified Fc domain enhanced antibody dependent cell mediated cytotoxicity (ADCC); increased binding to Fc.gamma.RIIA or to Fc.gamma.RIIIA; decreased binding to Fc.gamma.RIIB; or increased binding to Fc.gamma.RIIB. See e.g. US Pub 20140328836.
[0094] In certain embodiments, antibodies of the invention including but not limited to antibodies comprising a CDR(s) of VH and/or VL chains, or antibody fragments of the inventive antibodies can be used as the HIV-1 binding arm(s) of a bispecific molecule, e.g. DARTS, diabodies, toxin labeled HIV-1 binding molecules.
[0095] In accordance with the methods of the present invention, either the intact antibody or a fragment thereof can be used. Either single chain Fv, bispecific antibody for T cell engagement, or chimeric antigen receptors can be used (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). That is, in non-limiting embodiments, intact antibody, a Fab fragment, a diabody, or a bispecific whole antibody can be used to inhibit HIV-1 infection in a subject (e.g., a human). A bispecific F(ab)2 can also be used with one arm a targeting molecule like CD3 to deliver it to T cells and the other arm the arm of the native antibody (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). Toxins that can be bound to the antibodies or antibody fragments described herein include unbound antibody, radioisotopes, biological toxins, boronated dendrimers, and immunoliposomes (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). Toxins (e.g., radionucleotides or other radioactive species) can be conjugated to the antibody or antibody fragment using methods well known in the art (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). The invention also includes variants of the antibodies (and fragments) disclosed herein, including variants that retain the ability to bind to recombinant Env protein, the ability to bind to the surface of virus-infected cells and/or ADCC- mediating properties of the antibodies specifically disclosed, and methods of using same to, for example, reduce HIV-1 infection risk. Combinations of the antibodies, or fragments thereof, disclosed herein can also be used in the methods of the invention.
[0096] Antibodies of the invention and fragments thereof can be produced recombinantly using nucleic acids comprising nucleotide sequences encoding VH and VL sequences selected from those shown in the figures and examples.
[0097] In certain embodiments the invention provides intact/whole antibodies. In certain embodiments the invention provides antigen binding fragments thereof. Typically, fragments compete with the intact antibody from which they were derived for specific binding to the target including separate heavy chains, light chains Fab, Fab', F(ab').sub.2, F(ab)c, diabodies, Dabs, nanobodies, and Fv. Fragments can be produced by recombinant DNA techniques, or by enzymatic or chemical separation of intact immunoglobulins.
[0098] In certain embodiments the invention provides a bispecific antibody. A bispecific or bifunctional/dual targeting antibody is an artificial hybrid antibody having two different heavy /light chain pairs and two different binding sites (see, e.g., Romain Rouet & Daniel Christ "Bispecific antibodies with native chain structure" Nature Biotechnology 32, 136-137 (2014); Garber
"Bispecific antibodies rise again" Nature Reviews Drug Discovery 13, 799-801 (2014), Figure la; Byrne et al. "A tale of two specificities: bispecific antibodies for therapeutic and diagnostic applications" Trends in Biotechnology, Volume 31, Issue 11, November 2013, Pages 621-632 Songsivilai and Lachmann, Clin. Exp. Immunol., 79:315-321 (1990); Kostelny et al., J. Immunol. 148: 1547-53 (1992) (and references therein)). In certain embodiments the bispecific antibody is a whole antibody of any isotype. In other embodiments it is a bispecific fragment, for example but not limited to F(ab)2 fragment. In some embodiments, the bispecific antibodies do not include Fc portion, which makes these diabodies relatively small in size and easy to penetrate tissues.
[0099] In certain embodiments, the bispecific antibodies could include Fc region. Fc bearing diabodies, for example but not limited to Fc bearing DARTs are heavier, and could bind neonatal Fc receptor, increasing their circulating half-life. See Garber "Bispecific antibodies rise again" Nature Reviews Drug Discovery 13, 799-801 (2014), Figure la; See US Pub 20130295121, incorporated by reference in their entirety. In certain embodiments, the invention encompasses diabody molecules comprising an Fc domain or portion thereof (e.g. a CH2 domain, or CH3 domain). The Fc domain or portion thereof may be derived from any immunoglobulin isotype or allotype including, but not limited to, IgA, IgD, IgG, IgE and IgM. In some embodiments, the Fc domain (or portion thereof) is derived from IgG. In some embodiments, the IgG isotype is IgGl, IgG2, IgG3 or IgG4 or an allotype thereof. In some embodiments, the diabody molecule comprises an Fc domain, which Fc domain comprises a CH2 domain and CH3 domain independently selected from any immunoglobulin isotype (i.e. an Fc domain comprising the CH2 domain derived from IgG and the CH3 domain derived from IgE, or the CH2 domain derived from IgGl and the CH3 domain derived from IgG2, etc.). In some embodiments, the Fc domain may be engineered into a polypeptide chain comprising the diabody molecule of the invention in any position relative to other domains or portions of the polypeptide chain (e.g., the Fc domain, or portion thereof, may be
c-terminal to both the VL and VH domains of the polypeptide of the chain; may be n-terminal to both the VL and VH domains; or may be N-terminal to one domain and c-terminal to another (i.e., between two domains of the polypeptide chain)).
[0100] The present invention also encompasses molecules comprising a hinge domain. The hinge domain be derived from any immunoglobulin isotype or allotype including IgA, IgD, IgG, IgE and IgM. In preferred embodiments, the hinge domain is derived from IgG, wherein the IgG isotype is IgGl, IgG2, IgG3 or IgG4, or an allotype thereof. The hinge domain may be engineered into a polypeptide chain comprising the diabody molecule together with an Fc domain such that the diabody molecule comprises a hinge-Fc domain. In certain embodiments, the hinge and Fc domain are independently selected from any immunoglobulin isotype known in the art or exemplified herein. In other embodiments the hinge and Fc domain are separated by at least one other domain of the polypeptide chain, e.g., the VL domain. The hinge domain, or optionally the hinge-Fc domain, may be engineered in to a polypeptide of the invention in any position relative to other domains or portions of the polypeptide chain. In certain embodiments, a polypeptide chain of the invention comprises a hinge domain, which hinge domain is at the C-terminus of the polypeptide chain, wherein the polypeptide chain does not comprise an Fc domain. In yet other embodiments, a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the C-terminus of the polypeptide chain. In further embodiments, a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the N-terminus of the polypeptide chain.
[0101] In some embodiments, the invention encompasses multimers of polypeptide chains, each of which polypeptide chains comprise a VH and VL domain, comprising CDRs as described herein. In certain embodiments, the VL and VH domains comprising each polypeptide chain have the same specificity, and the multimer molecule is bivalent and monospecific. In other embodiments, the VL and VH domains comprising each polypeptide chain have differing specificity and the multimer is bivalent and bispecific. In some embodiments, the polypeptide chains in multimers further comprise an Fc domain. Dimerization of the Fc domains leads to formation of a diabody molecule that exhibits immunoglobulin-like functionality, i.e., Fc mediated function (e.g., Fc-Fc.gamma.R interaction, complement binding, etc.).
[0102] In yet other embodiments, diabody molecules of the invention encompass tetramers of polypeptide chains, each of which polypeptide chain comprises a VH and VL domain. In certain embodiments, two polypeptide chains of the tetramer further comprise an Fc domain. The tetramer is therefore comprised of two 'heavier polypeptide chains, each comprising a VL, VH and Fc domain, and two lighter polypeptide chains, comprising a VL and VH domain. Interaction of a
heavier and lighter chain into a bivalent monomer coupled with dimerization of the monomers via the Fc domains of the heavier chains will lead to formation of a tetravalent immunoglobulin-like molecule. In certain aspects the monomers are the same, and the tetravalent diabody molecule is monospecific or bispecific. In other aspects the monomers are different, and the tetra valent molecule is bispecific or tetraspecific.
[0103] Formation of a tetraspecific diabody molecule as described supra requires the interaction of four differing polypeptide chains. Such interactions are difficult to achieve with efficiency within a single cell recombinant production system, due to the many variants of potential chain mispairings. One solution to increase the probability of mispairings, is to engineer "knobs-into-holes" type mutations into the desired polypeptide chain pairs. Such mutations favor heterodimerization over homodimerization. For example, with respect to Fc-Fc-interactions, an amino acid substitution (preferably a substitution with an amino acid comprising a bulky side group forming a 'knob' , e.g., tryptophan) can be introduced into the CH2 or CH3 domain such that steric interference will prevent interaction with a similarly mutated domain and will obligate the mutated domain to pair with a domain into which a complementary, or accommodating mutation has been engineered, i.e., 'the hole' (e.g., a substitution with glycine). Such sets of mutations can be engineered into any pair of polypeptides comprising the diabody molecule, and further, engineered into any portion of the polypeptides chains of the pair. Methods of protein engineering to favor heterodimerization over homodimerization are well known in the art, in particular with respect to the engineering of immunoglobulin-like molecules, and are encompassed herein (see e.g., Ridgway et al. (1996) " Knobs-Into-Holes' Engineering Of Antibody CH3 Domains For Heavy Chain
Heterodimerization," Protein Engr. 9:617-621, Atwell et al. (1997) "Stable Heterodimers From Remodeling The Domain Interface Of A Homodimer Using A Phage Display Library," J. Mol. Biol. 270: 26-35, and Xie et al. (2005) "A New Format Of Bispecific Antibody: Highly Efficient Heterodimerization, Expression And Tumor Cell Lysis," J. Immunol. Methods 296:95-101; each of which is hereby incorporated herein by reference in its entirety).
[0104] The invention also encompasses diabody molecules comprising variant Fc or variant hinge- Fc domains (or portion thereof), which variant Fc domain comprises at least one amino acid modification (e.g. substitution, insertion deletion) relative to a comparable wild-type Fc domain or hinge-Fc domain (or portion thereof). Molecules comprising variant Fc domains or hinge-Fc domains (or portion thereof) (e.g., antibodies) normally have altered phenotypes relative to molecules comprising wild-type Fc domains or hinge-Fc domains or portions thereof. The variant phenotype may be expressed as altered serum half-life, altered stability, altered susceptibility to cellular enzymes or altered effector function as assayed in an NK dependent or macrophage
dependent assay. Fc domain variants identified as altering effector function are known in the art. For example International Application WO04/063351, U.S. Patent Application Publications 2005/0037000 and 2005/0064514.
[0105] The bispecific diabodies of the invention can simultaneously bind two separate and distinct epitopes. In certain embodiments the epitopes are from the same antigen. In other embodiments, the epitopes are from different antigens. In preferred embodiments, at least one epitope binding site is specific for a determinant expressed on an immune effector cell (e.g. CD3, CD16, CD32, CD64, etc.) which are expressed on T lymphocytes, natural killer (NK) cells or other mononuclear cells. In one embodiment, the diabody molecule binds to the effector cell determinant and also activates the effector cell. In this regard, diabody molecules of the invention may exhibit Ig-like functionality independent of whether they further comprise an Fc domain (e.g., as assayed in any effector function assay known in the art or exemplified herein (e.g., ADCC assay).
[0106] Non-limiting examples of bispecific antibodies can also be (1) a dual-variable-domain antibody (DVD-Ig), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage (Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-Ig. TM.) Molecule, In: Antibody Engineering, Springer Berlin Heidelberg (2010)); (2) a Tandab, which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (3) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (4) a so called "dock and lock" molecule, based on the "dimerization and docking domain" in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to a different Fab fragment; (5) a so-called Scorpion molecule, comprising, e.g., two scFvs fused to both termini of a human Fc-region. Examples of platforms useful for preparing bispecific antibodies include but are not limited to BiTE (Micromet), DART (MacroGenics) (e,g, US Patents 8,795,667; No. 2014-0099318; 2013-0295121; 2010- 0174053 and 2009-0060910; European Patent Publication No. EP 2714079; EP 2601216; EP 2376109; EP 2158221 and PCT Publications No. WO 2015/026894; WO 2015/026892; WO 2015/021089; WO 2014/159940; WO 2012/162068; WO 2012/018687; WO 2010/080538), the content of each of these publications in herein incorporated by reference in its entirety), Fcab and Mab2 (F-star), Fc-engineered IgGl (Xencor) or DuoBody (based on Fab arm exchange, Genmab).
[0107] In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment, for example but not limited to an HIV envelope binding fragment from any of the antibodies described herein. In other embodiments, the bispecific antibody further comprises a
second antigen-interaction-site/fragment. In other embodiments, the bispecific antibody further comprises at least one effector domain.
[0108] In certain embodiments the bispecific antibodies engage cells for Antibody -Dependent Cell- mediated Cytotoxicity (ADCC). In certain embodiments the bispecific antibodies engage natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. In certain embodiments the bispecific antibodies are T-cell engagers. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD3 binding fragment. Various CD3 antibodies are known in the art. See for example US Patent 8,784,821. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD 16 binding fragment.
[0109] In certain embodiments the invention provides antibodies with dual targeting specificity. In certain aspects the invention provides bi-specific molecules that are capable of localizing an immune effector cell to an HIV-1 envelope expressing cell, so as facilitate the killing of the HIV-1 envelope expressing cell. In this regard, bispecific antibodies bind with one "arm" to a surface antigen on target cells, and with the second "arm" to an activating, invariant component of the T cell receptor (TCR) complex. The simultaneous binding of such an antibody to both of its targets will force a temporary interaction between target cell and T cell, causing activation of any cytotoxic T cell and subsequent lysis of the target cell. Hence, the immune response is re-directed to the target cells and is independent of peptide antigen presentation by the target cell or the specificity of the T cell as would be relevant for normal MHC -restricted activation of CTLs. In this context it is crucial that CTLs are only activated when a target cell is presenting the bispecific antibody to them, i.e. the immunological synapse is mimicked. Particularly desirable are bispecific antibodies that do not require lymphocyte preconditioning or co-stimulation in order to elicit efficient lysis of target cells.
[0110] Several bispecific antibody formats have been developed and their suitability for T cell mediated immunotherapy investigated. Out of these, the so-called BiTE (bispecific T cell engager) molecules have been very well characterized and already shown some promise in the clinic
(reviewed in Nagorsen and Bauerle, Exp Cell Res 317, 1255-1260 (2011)). BiTEs are tandem scFv molecules wherein two scFv molecules are fused by a flexible linker. Further bispecific formats being evaluated for T cell engagement include diabodies (Holliger et al., Prot Eng 9, 299-305 (1996)) and derivatives thereof, such as tandem diabodies (Kipriyanov et al., J Mol Biol 293, 41-66 (1999)). DART (dual affinity retargeting) molecules are based on the diabody format that separates cognate variable domains of heavy and light chains of the two antigen binding specificities on two separate polypeptide chains but feature a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011)). The invention also contemplates Fc-bearing DARTs.
The so-called triomabs, which are whole hybrid mouse/rat IgG molecules and also currently being evaluated in clinical trials, represent a larger sized format (reviewed in Seimetz et al., Cancer Treat Rev 36, 458-467 (2010)).
[0111] The invention also contemplates bispecific molecules with enhanced pharmacokinetic properties. In some embodiments, such molecules are expected to have increased serum half-life. In some embodiments, these are Fc-bearing DARTs (see supra).
[0112] In certain embodiments, such bispecific molecules comprise one portion which targets HIV- 1 envelope and a second portion which binds a second target. In certain embodiments, the first portion comprises VH and VL sequences, or CDRs from the antibodies described herein. In certain embodiments, the second target could be, for example but not limited to an effector cell. In certain embodiments the second portion is a T-cell engager. In certain embodiments, the second portion comprises a sequence/paratope which targets CD3, CD16, or another suitable target. In certain embodiments, the second portion is an antigen-binding region derived from a CD3 antibody, optionally a known CD3 antibody. In certain embodiments, the anti-CD antibody induce T cell- mediated killing. In certain embodiments, the bispecific antibodies are whole antibodies. In other embodiments, the dual targeting antibodies consist essentially of Fab fragments. In other embodiments, the dual targeting antibodies comprise a heavy chain constant region (CHI). In certain embodiments, the bispecific antibody does not comprise Fc region. In certain embodiments, the bispecific antibodies have improved effector function. In certain embodiments, the bispecific antibodies have improved cell killing activity. Various methods and platforms for design of bispecific antibodies are known in the art. See for example US Pub. 20140206846, US Pub.
20140170149, US Pub. 20090060910, US Pub 20130295121, US Pub. 20140099318, US Pub. 20140088295 which contents are herein incorporated by reference in their entirety.
[0113] In certain embodiments the invention provides human, humanized and/or chimeric antibodies.
[0114] Pharmaceutical compositions
[0115] In certain aspects the invention provides a pharmaceutical composition comprising an antibody of the invention wherein the composition is used for therapeutic purposes such as but not limited to prophylaxis, treatments, prevention, and/or cure. In certain aspects the invention provides a pharmaceutical composition comprising an antibody of the invention in combination with any other suitable antibody. In certain embodiments, the pharmaceutical compositions comprise nucleic acids which encode the antibodies of the invention. In certain embodiments, these nucleic acids can be expressed by any suitable vector for expression of antibodies. Non- limiting examples include attenuated viral hosts or vectors or bacterial vectors, recombinant
vaccinia virus, adenovirus, adeno-associated virus (AAV), herpes virus, retrovirus, cytomegalovirus or other viral vectors can be used to express the antibody.
[0116] Various methods to make pharmaceutical compositions are known in the art and are contemplated by the invention. In some embodiments, the compositions include excipient suitable for a biologic molecule such as the antibodies of the invention. In some embodiments, the antibodies could be produced in specific cell lines and conditions so as to control glycosylation of the antibody. In some embodiments, the antibody framework for example, could comprise specific modification so as to increase stability of the antibody.
[0117] In certain aspects, the invention provides that the antibodies, and fragments thereof, described herein can be formulated as a composition (e.g., a pharmaceutical composition). Suitable compositions can comprise an inventive antibody (or antibody fragment) dissolved or dispersed in a pharmaceutically acceptable carrier (e.g., an aqueous medium). The compositions can be sterile and can be in an injectable form (e.g. but not limited to a form suitable for intravenous injection, intramascular injection). The antibodies (and fragments thereof) can also be formulated as a composition appropriate for topical administration to the skin or mucosa. Such compositions can take the form of liquids, ointments, creams, gels and pastes. The antibodies (and fragments thereof) can also be formulated as a composition appropriate for intranasal administration. The antibodies (and fragments thereof) can be formulated so as to be administered as a post-coital douche or with a condom. Standard formulation techniques can be used in preparing suitable compositions.
[0118] The antibody (and fragments thereof), described herein have utility, for example, in settings including but not limited to the following: i) in the setting of anticipated known exposure to HIV-1 infection, the antibodies described herein (or fragments thereof) and be administered prophylactically (e.g., IV, topically or intranasally) as a microbiocide, ii) in the setting of known or suspected exposure, such as occurs in the setting of rape victims, or commercial sex workers, or in any homosexual or heterosexual transmission without condom protection, the antibodies described herein (or fragments thereof) can be administered as post-exposure prophylaxis, e.g., IV or topically, and iii) in the setting of Acute HIV infection (AHI), the antibodies described herein (or fragments thereof) can be administered as a treatment for AHI to control the initial viral load or for the elimination of virus-infected CD4 T cells.
[0119] In accordance with the invention, the antibodies (or antibody fragments) described herein can be administered prior to contact of the subject or the subject's immune system/cells with HIV-1 or within about 48 hours of such contact. Administration within this time frame can maximize inhibition of infection of vulnerable cells of the subject with HIV-1.
[0120] In addition, various forms of the antibodies described herein can be administered to chronically or acutely infected HIV patients and used to kill remaining virus infected cells by virtue of these antibodies binding to the surface of virus infected cells and being able to deliver a toxin to these reservoir cells.
[0121] Suitable dose ranges can depend on the antibody (or fragment) and on the nature of the formulation and route of administration. Optimum doses can be determined by one skilled in the art without undue experimentation. For example but not limited, doses of antibodies in the range of 0.1-50 mg/kg, 1-50 mg/kg, 1-10 mg/kg, 1, 1.25, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg/kg of unlabeled or labeled antibody (with toxins or radioactive moieties) can be used. If antibody fragments, with or without toxins are used or antibodies are used that can be targeted to specific CD4 infected T cells, then less antibody can be used (e.g., from 5 mg/kg to 0.01 mg/kg). In other embodiments, the antibodies of the invention can be administered at a suitable fixed dose, regardless of body size or weight. See Bai et al. Clinical Pharmacokinetics February 2012, Volume 51, Issue 2, pp 119-135.
[0122] In certain aspects the invention provides use of the antibodies of the invention, including bispecific antibodies, in methods of treating and preventing HIV-1 infection in an individual, comprising administering to the individual a therapeutically effective amount of a composition comprising the antibodies of the invention in a pharmaceutically acceptable form. In certain embodiment, the methods include a composition which includes more than one HIV-1 targeting antibody. In certain embodiments, the HIV-1 targeting antibodies in such combination bind different epitopes on the HIV-1 envelope. In certain embodiments, such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased killing of HIV-1 infected cells. In other embodiments, such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased breadth in recognition of different HIV-1 subtypes.
[0123] In certain embodiments, the composition comprising the antibodies of the invention alone or in any combination can be administered via EVI, subcutaneous, or IV delivery, or could be deposited at mucosal sites, such as the oral cavity to prevent maternal to child transmission, the rectal space or the vagina as a microbicide. In certain embodiments, the antibodies can be administered locally in the rectum, vagina, or in the oral cavity, and can be formulated as a microbiocide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525.; Multipurpose
prevention technologies for reproductive and sexual health. Stone A. Reprod Health Matters. 2014 Nov;22(44):213-7. doi: 10.1016/S0968-8080(14)44801-8). In other embodiments, antibodies can be formulated such that the therapeutic antibody or combination thereof is impregnated on a vaginal ring (Chen Y et al. Drug Des. Devel. Ther 8: 1801-15, 2014;Malcolm RK et al BJOG 121 Suppl 5: 62-9, 2014). Antibodies can be administered alone or with anti -retroviral drugs for a combination microbicide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525).
[0124] Alternatively they can be administered in complex with a form of HIV Env, optimally gpl20, but also an Env trimer, to enhance Env immunogenicity. In certain embodiments, the antibodies can be delivered by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447). In certain embodiments, the antibodies can be administered in viral vector, for example but not limited to adenoassociated viral vector, for expression in muscle and plasma.
[0125] In certain embodiments, antibodies with different binding specificities are combined for use in pharmaceutical compositions and therapeutic methods. For example: CD4 binding site antibodies are combined with V3 antibodies, MPER antibodies and so forth. Figures 8, 9 and 10 show a selection of potent HIV-1 neutralizing antibodies which can be used in pharmaceutical compositions, and therapeutic methods. Non-limiting examples of selections of combinations of certain antibodies include: DH542, DH542 L4, DH542 QSA, DH429 and DH512 (or any of the DH512 variants); DH512 and CH31 (See US Publication 20140205607); DH512 (or any of the other DH512 variants) and DH540 (See Example 8, and this antibody will be described elsewhere); DH542, DH542 L4, DH542 QSA, DH429, DH512 and DH540; DH542, DH542 L4,
DH542 QSA, DH429 and CH557; CH557 and DH512 (or any of the DH512 variants). These combinations are expected to give a greater overall potency and breadth. A polyclonal mixture of Abs is expected reduce or eliminate viral escape. It is readily understood by skilled artisans that in some embodiments a combination therapy envisions a composition which combines various antibodies. In other embodiments a combination therapy is provided wherein antibodies are administered as individual compositions, for example at different times, by different means, or at administered at different locations. In other embodiments, a combination therapy is provides wherein a therapeutic antibody or antibodies is combined with other therapeutic means, for example anti -retroviral drug cocktails, or drugs which activate latently infected HIV-1 cells.
[0126] In some embodiments, the disclosed antibodies or antigen binding fragments thereof are used to determine whether HIV-1 envelope(s) is a suitable antigen for inclusion in a vaccine composition. For example the antibodies can be used to determine whether an antigen in a vaccine composition including gpl20 assumes a conformation including an epitope bound by the inventive
antibodies or fragments thereof. This can be readily determined by a method which includes contacting a sample containing the vaccine, such as a gpl20 antigen, with a disclosed antibody or antigen binding fragment under conditions sufficient for formation of an immune complex, and detecting the immune complex, to detect an HIV-1 antigen including an epitope of an inventive antibody in the sample. In one example, the detection of the immune complex in the sample indicates that vaccine component, such as a HIV-1 Env antigen assumes a conformation capable of binding the antibody or antigen binding fragment.
[0127] Antibody nomenclature and names: UCA4 = DH270.UCA; IA4 = DH270.IA4; IA3 = DH270.IA3; IA2 = DH270.IA2; IA1 = DH270.IA1; DH270 = DH270.1; DH473 = DH270.2;
DH391 = DH270.3; DH429 = DH270.4; DH471 = DH270.5; DH542 = DH270.6; DH542-L4 (comprising VH from DH542 and VL from DH429), DH542 QSA.
[0128] The following examples are provided to illustrate particular features of certain
embodiments, but the scope of the claims should not be limited to those features exemplified.
Examples
Example 1: Isolating antibodies from natural HIV-1 infected individuals
[0129] Methods to identify and isolate antigen specific reactive antibodies were carried out essentially as described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009, incorporated by reference in its entirety. Specific hooks are designed to identify memory B cells which express antibodies that bind to specific HIV-1 envelope targets/antigens. Using such hooks, with fluorophore labeled streptavidin in two colors, cells are sorted by flow cytometry, into single wells, and the diagonally (that reacted with both colors hooks) reactive memory B cells are picked. B cells enriched from PBMC are sorted, and plated at limiting dilution (as single cell per well).
Optionally, these cultures are grown and supernatants are functionally characterized.
[0130] PCR on these cells is carried out according to the protocol in Liao HX et al. J. Virol.
Methods 158: 171-9, 2009. PCR amplifications are carried out to amplify rearranged VH and VL fragment pairs from the diagonally sorted memory B cells (Liao et al JVM 158: 171-9, 2009). Overlapping PCR is used to construct full length Ig heavy and Ig light linear genes comprising the rearranged VH and VL fragment pairs. RT-PCR and PCR reactions is carried out essentially as described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009, see for example Figure 1, Section 3.3. Sequence analysis of the VH and VL genes was carried out to determine the VH and VL gene usage, CDR lengths, the % mutation of HCDR3 and LCDR3. Based on this sequence analysis, one to two pairs of linear VH and VL genes are selected and made in linear cassettes (essentially as
described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009, see for example Figure 1, Section 3.3) to produce recombinant monoclonal antibodies by transient transfection, e.g. in 293T cells.
[0131] Recombinant antibodies are grown and supernatants and/or purified antibodies are functionally characterized.
[0132] Pairs of VH and VL genes as selected above can also be used to produce plasmids for stable expression of recombinant antibodies.
[0133] In certain embodiments, the plasmids or linear constructs for recombinant antibody expression also comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via K cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid).
[0134] The antibodies of the invention were selected based on a combination of criteria including sequence analyses, and functional analyses including but not limited as neutralization breadth, and potency.
[0135] In certain embodiments, the antibodies of the invention comprise naturally rearranged VH and VL gene pairs isolated as nucleic acids, wherein the rest of the Ig gene is not naturally occurring with the isolated rearranged VH and VL fragments. In certain embodiments, the antibodies of the invention are recombinantly produced.
Example 2: Antibodies from DH270 lineage
[0136] Antibodies II (DH270IA1), 12, 14, 13 and UCA in Figure 8 are not isolated from human subjects but are derived computationally based on VH and VL sequences of other clonal antibodies identified from memory B cells: DH471, DH429, DH473, DH391 and DH270. The VH and VL sequences of DH471, DH429, DH473, DH391 and DH270 are derived from a human subject infected with HIV- 1.
[0137] The VH and VL sequences of DH471, DH429 and DH473are derived essentially as described in Example 1, using Consensus C gpl20 Env and Consensus C gpl20 N332A Env glycopeptides and by sorting cells that bound to Consensus C gpl20 Env but not to Consensus C gpl20 N332A Env. DH270 and DH391 were recombinantly produced from VH and VL chains isolated from clonal memory B cell cultures that bound to Consensus C gpl20 Env but not to Consensus C gpl20 N332A Env using the method previously described (Bonsignori et al J Virol 2011, Gao Bonsignori Liao et al Cell 2014).
[0138] Neutralization data for antibodies II (DH270IA1) and DH429 is summarized in Figure 9, and Figure 10.
[0139] DH542 antibody isolation
[0140] Biotinylated Man9GlcNac2 V3 peptides were tetramerized via streptavidin and conjugated with either AF647 or BV421 (Invitrogen) dyes. Peptide tetramer quality following conjugation was assessed by flow cytometry to a panel of well-characterized HIV-1 V3 glycan antibodies (PGT128, and 2G12) and linear V3 antibodies (F39F). The sequence of Man9V3 glycopeptide is
EINCTRPNNNTRPGEIIGDIRQAHCNISRA. This is a synthetic glycopeptide which has N-linked glycans (Man9GlcNac2) placed at the Asparagine residues in bold/underlined. The cysteine residues at the N and C terminal form a disulfide linkage under oxidative conditions creating a very stable cyclical conformation that expresses the epitope bound by V3 glycan bnAbs such as PGT128, 125, and 2G12, and now DH542 and other DH270 lineage members.
[0141] Roughly 10 million peripheral blood mononuclear cells (PBMCs) from the HIV-1 -infected donor 703-01-084-8 (CH848) collected 234 weeks post infection were stained with AquaVital dye, anti-human IgM (FITC), anti -human IgD (PE), anti -human CD 10 (ECD), anti-human CD3 (PE- Cy5), anti-human CD235a (PE-Cy5), anti-human CD27 (PE-Cy7), anti -human CD38 (APC- AF700), anti-human CD19 (APC-Cy7), anti-human CD16 (BV570), anti-human CD14 (BV605), and Man9GlcNac2 V3 tetramer in both AF647 and BV421. PBMCs that were AquaVital dye", CD14", CD16", CD3", CD235a", IgD", CD19+, CD38+, and Man9GlcNac2 V3+ were single-cell sorted using a BD FACS Aria II into 96-well plates containing 20 μΐ of reverse transcriptase buffer (RT). cDNA synthesis was performed as previously described (1). Immunoglobulin (Ig) heavy (VH) chains were PCR amplified using a nested approach. VH genes were amplified in the first round of amplification with primers grouped in Table la-le as previously described (2). Nested amplification of VH genes was performed as in (Liao et al., 2009) with primers grouped in Table 2a. Kappa and lambda were amplified as in (Liao et al., 2009), with primers grouped in Table 2b- 2c. PCR products were analyzed on 2% SYBR Safe E-Gels (Invitrogen). PCR-amplified VH and VL genes were purified and sequenced. Sequences were analyzed and VDJ arrangements were inferred using computational methods as previously described (3, 4).
[0142] Table la (SEQ ID NOs: 201-211, in order of appearance)
VH1 Leader C ATGGACTGGACCTGGAGAAT
VH1 Leader D GGTTCCTCTTTGTGGTGGC
VH1 Leader E ATGGACTGGACCTGGAGGGT
VH1 Leader F ATGGACTGGATTTGGAGGAT
VH1 Leader G AGGTTCCTCTTTGTGGTGGCAG
VH2 Leader A ATGGACATACTTTGTTCCACGCTC
VH2 Leader B ATGGACACACTTTGCTCCACGCT
VH2 Leader C ATGGACACACTTTGCTACACACTC
Reverse Primer
3 ' Cj CHI GGAAGGTGTGCACGCCGCTGGTC
SEQ ID NOs: 212-222, in order of appearance:
Forward Primer Sequence
VH1 Leader A ATGGACTGGACCTGGAGGAT
VH1 Leader B ATGGACTGGACCTGGAGCAT
VH1 Leader C ATGGACTGGACCTGGAGAAT
VH1 Leader D GGTTCCTCTTTGTGGTGGC
VH1 Leader E ATGGACTGGACCTGGAGGGT
VH1 Leader F ATGGACTGGATTTGGAGGAT
VH1 Leader G AGGTTCCTCTTTGTGGTGGCAG
VH2 Leader A ATGGACATACTTTGTTCCACGCTC
VH2 Leader B ATGGACACACTTTGCTCCACGCT
VH2 Leader C ATGGACACACTTTGCTACACACTC
Reverse Primer
3' Cy CHl GGAAGGTGTGCACGCCGCTGGTC [0143] Table lb (SEQ ID NOs: 223-230, in order of appearance) Forward Primer Sequence
VH3 Leader ATAAAAGGTGTCCAGTGT
VLB Leader B TAAGAGGTGTCCAGTGT
VLB Leader C TAGAAGGTGTCCAGTGT
VLB Leader E TACAAGGTGTCCAGTGT
VLB Leader F TTAAAGGTGTCCAGTGT
VH4 Leader D ATGAAACATCTGTGGTTCTT
VH5 Leader ATTCTCCAAGGAGTCTGT
Reverse Primer
3' Cy CHl GGAAGGTGTGCACGCCGCTGGTC [0144] Table lc (SEQ ID NOs: 231-238, in order of appearance) Forward Primer Sequence
VLB Leader DGCTATTTTTAAAGGTGTCCAGTGT VH4 Leader AATGAAACACCTGTGGTTCTTCC VH4 Leader B ATGAAACACCTGTGGTTCTT
VH4 Leader C ATGAAGCACCTGTGGTTCTT
VH5 Leader B CCTCCACAGTGAGAGTCTG
VH6 Leader AATGTCTGTCTCCTTCCTCATC
VH7 Leader AGGCAGCAGCAACAGGTGCCCA Reverse Primer
3' Cy CHl GGAAGGTGTGCACGCCGCTGGTC
[0145] Table Id (SEQ ID NOs: 239-243, in order of appearance) Forward Primer Sequence
VKl,2 Ext GCTCAGCTCCTGGGGCT
VK3 Ext GGAARCCCCAGCDCAGC
VK4/5 Ext CTSTTSCTYTGGATCTCTG
VK6/7 Ext CTSCTGCTCTGGGYTGC
Reverse Primer
CK Ext GAGGCAGTTCCAGATTTCAA
[0146] Table le (SEQ ID NOs: 244-254, in order of appearance) Forward Primer Sequence
VL1 Ext CCTGGGCCCAGTCTGTG
VL2 Ext CTCCTCASYCTCCTCACT
VL3 Ext GGCCTCCTATGWGCTGAC
VL31 Ext GTTCTGTGGTTTCTTCTGAGCTG
VL4ab Ext ACAGGGTCTCTCTCCCAG
VL4c Ext ACAGGTCTCTGTGCTCTGC
VL5,9 Ext CCCTCTCSCAGSCTGTG
VL6 Ext TCTTGGGCCAATTTTATGC
VL7,8 Ext ATTCYCAGRCTGTGGTGAC
VLIO CAGTGGTCCAGGCAGGG
Reverse Primer
CL ExtAGGCCACTGTCACAGCT
[0147] Table 2a (SEQ ID NOs: 255-261, in order of appearance)
Forward Primer Sequence
VH1 Int CTGGGTTCCAGGTTCCACTGGTGACCAGGTGCAGCTGGTRCAGTCTGGG VH2 Int
CTGGGTTCCAGGTTCCACTGGTGACCAGRGCACCTTGARGGAGTCTGGTCC VH3 Int CTGGGTTCCAGGTTCCACTGGTGACGAGGTKCAGCTGGTGGAGTCTGGG VH4 Int CTGGGTTCCAGGTTCCACTGGTGACCAGGTGCAGCTGCAGGAGTCGG VH5 Int
CTGGGTTCCAGGTTCCACTGGTGACGARGTGCAGCTGGTGCAGTCTGGAG VH6 Int
CTGGGTTCCAGGTTCCACTGGTGACCAGGTACAGCTGCAGCAGTCAGGTCC
Reverse Primer
IgG Int GGGCCGCTGTGCCCCCAGAGGTGCTCTYGGA
[0148] Table 2b (SEQ ID NOs: 262-269, in order of appearance)
Forward PrimerSequence
VK1 Int CTGGGTTCCAGGTTCCACTGGTGACGACATCCAGWTGACCCAGTCTC VK2 Int
CTGGGTTCCAGGTTCCACTGGTGACGATATTGTGATGACCCAGWCTCCAC VK3 Int CTGGGTTCCAGGTTCCACTGGTGACGAAATTGTGTTGACRCAGTCTCCA VK4 Int CTGGGTTCCAGGTTCCACTGGTGACGACATCGTGATGACCCAGTCTC VK5 Int CTGGGTTCCAGGTTCCACTGGTGACGAAACGACACTCACGCAGTCTC VK6 Int CTGGGTTCCAGGTTCCACTGGTGACGAAATTGTGCTGACWCAGTCTCCA VK7 Int CTGGGTTCCAGGTTCCACTGGTGACGACATTGTGCTGACCCAGTCT
Reverse Primer
CK Int GGGAAGATGAAGACAGATGGT
[0149] Table 2c (SEQ ID NOs: 270-280, in order of appearance)
Forward Primer Sequence
VL1 Int CTGGGTTCCAGGTTCCACTGGTGACCAGTCTGTGYTGACKCAGCC
VL2 Int CTGGGTTCCAGGTTCCACTGGTGACCAGTCTGCCCTGACTCAGCC
VL3 Int CTGGGTTCCAGGTTCCACTGGTGACTCYTATGAGCTGACWCAGCCAC VL31 Int CTGGGTTCCAGGTTCCACTGGTGACTCTTCTGAGCTGACTCAGGACCC VL4ab Int CTGGGTTCCAGGTTCCACTGGTGACCAGCYTGTGCTGACTCAATC
VL4c Int CTGGGTTCCAGGTTCCACTGGTGACCTGCCTGTGCTGACTCAGC
VL5,9 Int CTGGGTTCCAGGTTCCACTGGTGACCAGSCTGTGCTGACTCAGCC
VL6 Int CTGGGTTCCAGGTTCCACTGGTGACAATTTTATGCTGACTCAGCCCCACT VL7,8 Int CTGGGTTCCAGGTTCCACTGGTGACCAGRCTGTGGTGACYCAGGAG VL 10 Int CTGGGTTCC AGGTTCC ACTGGTGACC AGGC AGGGCWGACTC AG
Reverse Primer
CL Int GGGYGGGA AC AGAGTGAC C
[0150] Antibody Expression
[0151] Transient and recombinant monoclonal antibody production was performed as previously described (5, 6).
[0152] DH270 N332 dependent V3 glycan bnAb lineage.
[0153] We describe here the co-evolution of a founder virus and a memory B cell lineage of gpl20 V3-glycan directed bnAbs (DH270). We sequenced -1400 HIV quasispecies, isolated natural heavy- and light-chain pairs of 6 lineage DH270 antibodies, and analyzed this lineage by next generation sequencing (NGS) and structural studies. We found two additional TF-induced cooperating B-cell lineages that selected virus escape mutants that stimulated the DH270 lineage to potent neutralization breadth. Within the DH270 lineage we found a single early antibody CDR H2 mutation that was necessary for bnAb B cell lineage initiation. The combination for multiple cooperating lineages plus a rare antibody mutation thus explains the long period of antigenic stimulation required for bnAb induction.
[0154] We studied an African individual (CH848) followed from time of infection to development of plasma neutralization breadth. Abrogation of the N332 glycan near the Env V3 loop by introducing a N332A mutation into consensus C, TRO.11, Q23.17 and DU156 HIV-1
pseudoviruses reduced CH848 plasma neutralization of these viruses, and demonstrated the presence of plasma N332-sensitive bnAbs (reference Georgiev paper). To isolate them, we probed
memory B cells from weeks 205, 232 and 234 post-transmission using clonal memory B cell cultures and antigen-specific memory B cell sorting and isolated 6 naturally paired VH + VL N332- sensitive antibodies, designated DH270.1-6. Neutralization studies demonstrated that DH270 though containing only 5.5% VH mutations, mediated potent heterologous neutralization breadth (65.2% breadth and median IC50=0.17 ug/ml) (Figure 28A-C).
[0155] We interrogated the depth of the DH270 clonal lineage by sequencing the DH270 variable heavy (VH) gene using next generation sequencing (NGS) of memory B cell cDNA isolated at 11, 19, 64, 111, 160, 186 and 240 weeks post-transmission. A total of 767 unique DH270 lineage VH sequences from duplicated NGS experiments were found, with the earliest VH detected 186 weeks post-transmission (Figure 28 A). The DH270 lineage used VHl-2*02 paired with V 2-23 and had a 20 amino acid-long CDR H3. Clonal lineage intermediate and ancestor antibodies were computed from the naturally-paired sequences (Kepler refs) (Figure 29). VH mutation frequencies of the isolated antibodies ranged from 5.6% (DH270.1) to 12.9% (DH270.6) (Figure 29). Neutralization of wild-type and N332 mutated HIV-1 strains AC13.8, PV04, TRO. l 1, ACIO.0.29 and RHP A confirmed DH270 lineage N332 sensitivity of neutralization (Figure 30). In competition binding assays, DH270.1 blocked binding of both V3-glycan bnAbs PGT125 and PGT128 to JRFL gpl20 with IC50 = 0.4 ug/ml and DH270.1 binding to gpl20 Env was dependent on N332 glycans.
[0156] Ontogeny of DH270 neutralizing B cell lineage
[0157] DH270 lineage antibodies displayed bnAb activity in a panel of 24 heterologous HIV-1 isolates, with DH270.6 the most broad (17 of 24) and potent (IC50 = 0.21 ug/ml) (Figure 28B). The DH270 unmutated common ancestor antibody (DH270.UCA) did not neutralize heterologous HIV-1, but intermediate antibody 4 (DH270.IA4), which differed from UCA by 4 amino acids in the VH gene segment and one amino acid in VL neutralized 4/24 strains (16.7%) (Figure 28B). Notably, DH270.IA4 acquired neutralizing activity while retaining the unmutated CDR H3 of the UCA.
[0158] As VH mutations accumulated in the DH270 B cell lineage, neutralization broadend only modestly while potency increased by 2 orders of magnitude. Thus, DH270-lineage heterologous neutralization evolved in two phases: first, early mutations conferred neutralization breadth , and second, further mutations enhanced neutralization potency.
[0159] DH270.1, DH270.5 and DH270.6 neutralization breadth was further evaluated in a large multi-clade panel of 201 HIV-1 heterologous strains (Figure 28C). DH270.1 neutralized 88/201 (43.8%) HIV-1 isolates (median IC50 = 0.39 ug/ml), DH270.5 neutralized 99/201 (49.3%) HIV-1 isolates (median IC50 = 0.14 ug/ml), while DH270.6 was the most broad and potent antibody and neutralized 111/199 viruses (56%) (median IC50 = 0.07 ug/ml).
[0160] Antibody DH270.6 displayed strong clade preference for clade B (78%, n = 41, p = 0.0043) and sensitivity for clade C viruses (68%, n = 55, p = 0.029). It also neutralized 46% of clade A viruses and did not neutralize CRF01 AE viruses. Presence for a glycosylation site in position N332 explained 75% of resistance of heterologous viruses to DH270.6. None of the viruses that shifted N332 glycan to N334 were neutralized by DH270.6 and, within each clade, N332 glycan tracked well with virus sensitivity to DH270.6 (p=0.03, Kendall's rank correlation). When compared to PGT128 and 10-1074, the neutralization profile of DH270.6 most closely paralleled that of 10-1074 (Figure 31).
[0161] References for Example 2:
1. Wardemann H, Yurasov S, Schaefer A, Young JW, Meffre E, Nussenzweig MC.
Predominant autoantibody production by early human B cell precursors. Science (New York, NY). 2003;301(5638): 1374-7. Epub 2003/08/16. doi: 10.1126/science.1086907. PubMed PMID:
12920303.
2. Scheid JF, Mouquet H, Ueberheide B, Diskin R, Klein F, Oliveira TY, Pietzsch J, Fenyo D, Abadir A, Velinzon K, Hurley A, Myung S, Boulad F, Poignard P, Burton DR, Pereyra F, Ho DD, Walker BD, Seaman MS, Bjorkman PJ, Chait BT, Nussenzweig MC. Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding. Science (New York, NY). 2011;333(6049): 1633-7. Epub 2011/07/19. doi: 10.1126/science.1207227. PubMed PMID: 21764753; PubMed Central PMCID: PMCPmc3351836.
3. Kepler TB. Reconstructing a B-cell clonal lineage. I. Statistical inference of unobserved ancestors. FlOOOResearch. 2013;2: 103. Epub 2014/02/21. doi: 10.12688/fl000research.2-103.vl . PubMed PMID: 24555054; PubMed Central PMCID: PMCPmc3901458.
4. Kepler TB, Munshaw S, Wiehe K, Zhang R, Yu JS, Woods CW, Denny TN, Tomaras GD, Alam SM, Moody MA, Kelsoe G, Liao HX, Haynes BF. Reconstructing a B-Cell Clonal Lineage. II. Mutation, Selection, and Affinity Maturation. Frontiers in immunology. 2014;5: 170. Epub 2014/05/06. doi: 10.3389/fimmu.2014.00170. PubMed PMID: 24795717; PubMed Central
PMCID: PMCPmc4001017.
5. Liao HX, Chen X, Munshaw S, Zhang R, Marshall DJ, Vandergrift N, Whitesides JF, Lu X, Yu JS, Hwang KK, Gao F, Markowitz M, Heath SL, Bar KJ, Goepfert PA, Montefiori DC, Shaw GC, Alam SM, Margolis DM, Denny TN, Boyd SD, Marshal E, Egholm M, Simen BB, Hanczaruk B, Fire AZ, Voss G, Kelsoe G, Tomaras GD, Moody MA, Kepler TB, Haynes BF. Initial antibodies binding to FJJV-l gp41 in acutely infected subjects are polyreactive and highly mutated. The Journal of experimental medicine. 2011;208(11):2237-49. Epub 2011/10/12. doi:
10.1084/jem.20110363. PubMed PMID: 21987658; PubMed Central PMCID: PMCPmc3201211.
6. Liao HX, Levesque MC, Nagel A, Dixon A, Zhang R, Walter E, Parks R, Whitesides J, Marshall DJ, Hwang KK, Yang Y, Chen X, Gao F, Munshaw S, Kepler TB, Denny T, Moody MA, Haynes BF. High-throughput isolation of immunoglobulin genes from single human B cells and expression as monoclonal antibodies. Journal of virological methods. 2009; 158(l-2): 171-9. Epub 2009/05/12. doi: 10.1016/j .jviromet.2009.02.014. PubMed PMID: 19428587; PubMed Central PMCID: PMCPmc2805188.
[0162] DH542 is a V3 glycan bnAb from individual CH848 identified at 234 weeks post infection. This antibody was produced recombinantly from VH and VL sequences amplified by PCR from single cells sorted from PBMCs using Man9V3 glycopeptide tetramer (Figure 1). DH542 is a member of the DH270 V3 glycan BnAb lineage (Figure 8).
[0163] Figure 2A shows the gene information of DH542 and Figure 2B shows DH542 sequences.
[0164] Neutralization studies demonstrated that DH270 though containing only 5.5% VH mutations, mediated potent heterologous neutralization breadth (65.2% breadth and median IC50=0.17 ug/ml).
Example 3: TZM-bl cells pseudo-viruses neutralization assay
[0165] TZMbl neutralization assay is a standard way to evaluate antibody breadth and potency. See Montefiori, D. Methods Mol Biol. 2009;485:395-405; HIV-1 Env-pseudoviruses infection of TZM-bl cells. Exemplary pseudovirus neutralization assays and panels of HIV-1 pseudovirus are described for example, in Li et al., J Virol 79, 10108-10125, 2005, Seaman et al, J. Virol., 84: 1439-1452, 2010; Sarzotti-Kelsoe et al., J. Immunol. Methods, 409: 131-46, 2014; and
WO2011/038290, each of which is incorporated by reference herein. Various HIV-1 isolates, both Tier 1 and Tier 2 viruses can be included in this assay.
[0166] The TZMbl assay was conducted to determine neutralization potency and breadth of the various antibodies of the invention on different HIV-1 pseudoviruses.
Example 4: Binding assays and Kd determination
[0167] Kd measurements of antibody binding to HIV-1 envelope, e.g. gpl20 or any other suitable peptide, will be determined by Surface Plasmon Resonance measurements, for example using Biacore, or any other suitable technology which permits detection of interaction between two molecules in a quantitative way.
Example 5: Assay for self-reactivity
[0168] Table 3 below summarizes some of the known types of disease associated antibodies.
[0169] Various assays for self-reactivity of human antibodies are known in the art. AtheNA Multi- Lyte ANA Plus Test System is one such assay. This is luminex-based assay, which is also used to screen patient sera. In our experiments the criteria for positivity is as follows: an antibody is positive for autoreactivity if reactive at 25 μg/ml.
[0170] Table 4. Summary of immunoflourescent (IF) staining of Hep2 cells data for antibodies DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
CH491_4A/293i [25ug/mL} 1+ nuclear diffuse, cytoplasmic
CH493_4A/293i [50ug/mL} 2+ cytoplasmic
CH493_4A/293i [25ug/mL} 1+ cytoplasmic
[0171] Figures 6 and 7 show a summary of binding to autoantigen in the AtheNA assay and HEp-2 cell IF staining for DH542.
[0172] Table 5. Summary of Athena data for DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
Antibody
Lot ID SSA SSB Sm RNP Scl 70 Jo 1 dsDNA Cent B Histone
DH270 I
294HC Al/293i 50 5 6 5 2 4 5 32 10 9
25 3 6 5 2 1 3 18 5 4
12.5 3 6 5 3 2 6 11 3 4
6.25 5 1 3 2 2 5 6 2 2
CH491 4
21RKK A 50 68 144 6 43 16 169 47 54 59
25 44 95 4 30 9 118 39 45 44
12.5 28 60 3 24 7 79 29 34 34
6.25 21 42 4 18 4 56 11 26 26
CH493 4
23RKK A 50 155 70 37 69 36 198 0 94 166
25 100 38 53 55 34 167 0 129 202
12.5 54 22 42 49 26 102 0 165 200
6.25 22 15 46 32 17 54 0 177 174
[0173] Development of auto and polyreactivity during antibody maturation toward neutralization breadth is a critical aspect that may limit the ability of generating bnAbs during natural infection
and upon vaccination. We have previously reported that, in subject CH505, the CD4bs CHI 03 bnAb lineage is polyreactive and, similarly to CD4 mimic VRCOl -class bnAbs, bound to human ubiquitin ligase E3A (UBE3A) with avidity correlated with neutralization (Liao et al Nature 2013; Liu et al J Virol 2015). Since CH557 is a potent and extremely broad CD4 mimic CD4bs bnAb, we compared the auto- and polyreactivity profiles of CH557 with those of early precursors of the CH235 antibody lineage (UCA, IA4, IA3, IA2, IA1, CH235, CH236, CH239, CH240 and CH241). In line with previous observations, reactivity against autoantigens developed among early CH235 lineage members with maturation. However, bnAb CH557 itself became exquisitely HIV-1 specific: it does not react with cardiolipin or other antigens associated with autoimmune disorders, it is negative in Hep-2 IF staining, or any of 9,400 human antigens, including UBE3 A. Albeit reactivity against other human antigens cannot be formally ruled out, these data demonstrate that bnAb CH557 lost the auto and polyreactivity developed by its precursors, and demonstrates that decoupling neutralization breadth of CD4 mimic CDbs bnAbs from auto- and polyreactivity is an achievable goal.
[0174] Table 6. Summary of Athena assay results for CH557. Results are expressed as relative luminescence units. Readings <100 are considered negative, results between 100 and 120 are considered "indeterminate" and results >120 are considered positive. CH557 is negative for all the antigens tested at all antibody concentrations ranging from 6.25 ug/ml to 50 ug/ml.
Cent
Antibody ug/ml SSA SSB Sm RNP Scl 70 Jo 1 dsDNA Histone
B
4 e 10 50 49 263 5 4 1 190 2 3 16
25 33 227 2 3 1 160 2 3 10
12.5 21 199 3 3 0 131 3 1 7
6.25 17 178 3 3 1 113 0 2 6 synagis 50 5 6 11 10 3 5 25 9 11
25 3 7 3 4 2 2 11 4 5
12.5 2 5 7 3 3 6 7 2 3
6.25 2 5 2 3 2 1 0 2 3
50 6 15 8 10 6 10 29 46 16
CH557 4
A/293i
25 4 12 6 6 4 2 18 25 8
12.5 3 9 6 3 3 5 10 16 6
6.25 4 5 4 4 3 5 9 1 1 4
[0175] Table 7. Summary of Athena assay results for various other antibodies of the CH235 lineage. Results are expressed as relative luminescence units. Readings <100 are considered negative, results between 100 and 120 are considered "indeterminate" and results >120 are considered positive. CH236, CH239, CH235 IA1 and IA2 are positive for multiple antigens.
Cent
Antibody ID SSA SSB Sm RNP Scl 70 Jo l dsDNA B Histone synagis 50 13 9 6 2 1 4 3 3 0
25 1 1 4 4 0 2 4 0 2 2
4E10 IgGl 50 99 207 55 28 5 227 14 14 32
25 81 189 46 20 4 206 14 9 24
CH235 4A 50 12 7 16 1 1 8 7 25 1 1 14
25 13 5 7 5 4 4 13 6 7
12.5 13 5 8 6 2 3 0 5 5
6.25 12 6 5 3 2 2 3 3 5
CH236 4 A/29
3i 50 177 207 128 65 57 145 2 84 138
25 224 175 165 69 62 72 42 129 193
12.5 185 63 258 78 50 19 179 233 234
6.25 44 15 184 40 31 7 228 208 154
CH239 4 A/29
3i 50 289 10 250 93 kriss 15 38 173 228
25 306 8 237 96 51 1 1 61 199 253
12.5 277 6 277 85 48 8 108 216 263
6.25 178 5 285 78 49 8 181 260 266
50 16 17 33 17 6 13 75 37 42
CH240_4A/29
3i
25 16 1 1 22 1 1 6 1 1 50 24 27
12.5 14 5 13 8 4 7 37 15 18
6.25 12 5 9 6 3 5 14 8 9
CH241 50 23 10 12 8 5 8 23 21 30
25 15 6 1 1 6 4 5 18 14 20
12.5 14 8 7 5 3 6 2 8 13
6.25 15 4 4 3 1 2 6 6 9
CH235UA/29
3i 50 1 1 3 8 5 3 3 7 5 7
25 9 3 6 4 3 5 0 3 3
12.5 9 4 6 3 3 5 4 3 4
6.25 10 5 5 2 3 3 3 2 2
CH235VH U
CAtk v2 4AJ
293i 50 14 10 13 1 1 5 6 22 28 17
25 1 1 6 10 6 3 4 13 18 1 1
12.5 10 7 9 7 4 6 9 10 7
6.25 10 5 7 6 3 3 4 7 5
CH235VH 11
_v2_4A/293i 50 149 217 104 80 57 176 12 80 100
25 150 197 1 10 67 52 171 19 80 99
12.5 151 167 77 56 40 152 58 81 100
6.25 175 1 17 77 46 31 129 61 87 1 18
CH235VH 12
_v2_4A/293i 50 73 69 259 101 69 55 444 256 371
25 43 36 256 93 49 26 496 228 302
12.5 34 31 279 85 44 20 617 225 287
6.25 18 15 204 66 28 12 599 183 207
CH235VH 13
_v2_4A/293i 50 14 10 18 10 5 6 35 37 17
25 10 9 13 7 4 8 33 27 12
12.5 12 6 12 5 3 3 23 15 7
6.25 12 3 7 4 2 2 15 9 5
CH235VH 14
_v2_4A/293i 50 12 6 12 9 4 5 15 14 13
25 12 4 12 5 2 2 7 10 9
12.5 11 3 6 4 2 3 11 5 6
6.25 11 5 6 3 2 4 4 5 4
Cat-CHI 06 50 12 3 5 2 3 3 6 2 2
25 8 3 1 3 2 2 3 2 3
12.5 11 5 4 2 3 3 5 2 2
6.25 10 6 5 1 2 4 7 1 2
[0176] Table 8. Summary of ELISA cardiolipin assay results for CH557 and various other antibodies. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm (OD450). OD450 < 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. CH557 did not bind to cardiolipin.
Antibody lot ug/ml 100 50 25 12.5
4 e 10 11.94 2.0997 2.346 1.9027 1.6277 synagis 1.05 0.0424 0.0474 0.0408 0.0408
Ab901754RhK/PEI ZRJ070 3.86 0.0382 0.0859 0.0299 0.0394
Ab901754RhKMut58_9 ZRJ93 2.8 0.6665 0.428 0.2898 0.1681
AbTr900114147Rh/293i 226JAH 7.44 0.4615 0.2596 0.1778 0.1018
DH522 64RKK 6.67 0.1206 0.079 0.0613 0.0491
DH522UCA_Rh/293i 362HC 13.19 0.6156 0.415 0.2179 0.1302
DH522_v2Rh/293i 363HC 6.93 0.3497 0.1652 0.1081 0.0828
DH522I1.2Rh/293i 372HC 13.99 0.5506 0.2738 0.183 0.1073
CH557 4Α/293Ϊ 70RKK 11.94 0.0942 0.0761 0.0591 0.0475
DH542-293i 014RM 2.51 0.062 0.0503 0.0525 0.0511
[0177] Table 9. Summary of binding of listed antibodies to cardiolipin in ELIS A. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm 3333333 (.OD450). OD450 < 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. The majority of CH235 lineage antibodies, with the exception of CH235 IA3, IA4, CH235 and 1111111. CH240 (the former has borderline binding), bound to cardiolipin.
3703704. o
o
1234568. synagis 0.0391 0.0375 0.0359 0.0378
0411523.
4E10
IgGl 2.3179 2.2324 2.1165 1.941 0137174.
105SJ CH235 4
A A 0.1198 0.0555 0.0423 0.0411 0.0413 0.0377 0.0378 0 0045725.0. 387
121S CH236 4
MI A/293i 0.5104 0.1936 0.0849 0.0524 0.0423 0.0382 0.0425 0.0385
98JA CH239 4
H A/293i 0.5001 0.2554 0.1078 0.0612 0.0476 0.0424 0.0386 0.0405
96GE CH240 4
H A/293i 0.194 0.0893 0.0543 0.0434 0.0399 0.0408 0.0444 0.0421
108SJ
A CH241 0.248 0.1061 0.0617 0.0491 0.0405 0.0437 0.0409 0.0384
132S CH235U
MI A/293i 0.2337 0.1074 0.0738 0.0504 0.0436 0.0417 0.0395 0.0391
DH235V
H UCAt
137S k_v2_4A/
MI 293i 0.5112 0.253 0.1353 0.0658 0.0486 0.0428 0.0415 0.0427
DH235V
121JA H II v2
H 4A/293i 0.5321 0.2638 0.0955 0.0637 0.0473 0.0409 0.0414 0.041
DH235V
138S H 12 v2
MI 4A/293i 0.9691 0.4951 0.1929 0.0894 0.0603 0.0488 0.0582 0.0442
DH235V
119JA H_I3_v2_
H 4A/293i 0.1317 0.0743 0.0518 0.046 0.0439 0.0412 0.0429 0.0426 synagis 0.0405 0.0453 0.0414 0.0414
4E10
IgGl 2.249 2.2353 2.105 1.9205
DH235V
120JA H_I4_v2_
H 4A/293i 0.1076 0.0609 0.0475 0.0416 0.0439 0.0399 0.0366 0.0403
Cat- CH106 0.0437 0.0443 0.0413 0.04 0.043 0.0404 0.0399 0.0407
Example 6: CD4 binding site antibodies and MPER
[0178] CH557 is one example of a CD4 binding site antibody which can be used in combination with the V3 glycan antibodies of the invention. VH and VL sequences of CD4 binding site antibodies are described in Figures 21 and 23.
[0179] MPER antibodies, from the DH511 lineage and variants as described herein, can be used in combination with the V3 antibodies of the invention. MPER antibodies sequences are described for example in Figures 12A and 12B, Figure 13.
[0180] DH512 K3 is a combination of VH from DH512 and VL called DH511 2AVK
[0181] >DH511 2AVK Kappa Chain Nucleotide Sequence (SEQ ID NO: 281)
GACATCCAGATGACCCAGTCTCCGTCTTTCCTGTACGGCTCTGTAGGCGATAGAGTCAC
CATCACTTGCCGGGCAAGTCAGAATATTAAGGACTATTTAAATTGGTATCAGCAGAGA
CCAGGGAGAGCCCCTAGACTCCTGATCTATGCTGCATCCAATTTGCAAAGTGGGGTCC
CGTCAAGGTTCAGTGGCAGTGGATATGGGACAGACTTTACTCTCATCATCAGCAGTCT
GCAACCTGAGGACTTTGCGACTTATTTCTGTCAAGAGAGTTATAGTTCTACGCCCACAC
ACATTTTTGGCCTGGGGACCAAATTGGAGAAGAAAC
[0182] >DH511 2AVK Kappa Chain Amino Acid Sequence (SEQ ID NO: 282)
[0183] DIQMTQSPSFLYGSVGDRVTITCRASQNIKDYLNWYQQRPGRAPRLLIYAASNLQS
GVPSRFSGSGYGTDFTLIISSLQPEDFATYFCQESYSSTPTHIFGLGTKLEKKX
Example 7: Other assays
[0184] Epitope mapping of antibodies: Binding and/or neutralization assays using various envelope antigens can be used to determine the epitope recognized by these antibodies.
[0185] The stability and properties of the antibodies, for example as formulated in a composition for treatment will be tested.
[0186] Animal studies (PK and PD studies) could be conducted to determine the distribution and half life of the antibodies.
[0187] Various assays and experiments can be designed to analyze prevention, treatment and/or cure.
Example 8: DH540 antibody is described elsewhere.
[0188] DH540 sequences are described in Figure 22 and the antibody is described in detail in US Ser. No. 62/170,558, filed June 3, 2015.
Example 9: TZM-bl neutralization profiles of V3 antibodies
[0189] TZM-bl neutralization assay was conducted to determine neutralization potency and breadth of different viruses by DH542-L4, DH542, PGT128, PGT121, 10-1074, DH270 and DH471.
Figures 14 and 15 show the results of neutralization against a panel of HIV isolates in the TZM-bl pseudovirus neutralization assay. Figures 14 and 15 also show the mean IC50, IC80 and percent of isolates neutralized at an different IC50 or IC80 values.
Example 10: Heavy and Light chain chimeric V3 antibodies
[0190] This example describes chimeric antibodies comprising non-natural VH and VL chain pairs. Recombinantly expressed VH or VL chains from naturally occurring VH: VL pairs are combined in
non-natural pairs as described in Figure 25. Lines 2-4 in Figure 25 show antibodies having DH542 VH chain paired with VLs from other antibodies from the DH270 lineage.
[0191] In some instances VH chains (I0848_00001_L1_4A; I0848_00004_L1_4A;
I0848_00005_L1_4A; I0848_00006_L1_4A; I0848_00007_L1_4A) which were identified by Illumina sequences and not as natural VH:VL pair, were paired with VL sequences from a VELVL pair with the closest VH sequence— lines 5-9 in Figure 25. In other instances, VH chains
(I0848_00001_L1_4A; I0848_00004_L1_4A; I0848_00005_L1_4A; I0848_00006_L1_4A;
I0848_00007_L1_4A) were paired with DH542 QSA which is the corrected VL chain of DH542— lines 12-15 in Figure 25.
[0192] For Illumina sequencing RNA was isolated from patient PBMCs using an RNAeasy isolation kit (Qiagen). RNA was reverse transcribed and PCR amplified with primers targeting the IgG VHl family of Immunoglobulin genes. Illumina adapters were added by PCR using the Nextera sample prep kit (Illumina). Illumina cDNA libraries were quantified using qPCR (Kappa biosciences) and sequenced using Illumina Miseq (2x300bp; Illumina). Analysis of
Immunoglobulin sequence genetics were performed using Cloanalyst software (T. Kepler; Boston University).
[0193] Primer Sequences: AGGTGTGCACGCCGCTGGTC IgG-RT (SEQ ID NO: 283); TCGTCGGCAGCGTCAGATGTGTATAAGAGACAGCCATGGACTGGACCTGGAGG VHl -Ext_P5_lST (SEQ ID NO: 284);
GTCTCGTGGGCTCGGAGATGTGTATAAGAGACAGCGATGGGCCCTTGGTGGA HUI GG_Deep_R_P7_lST (SEQ ID NO: 285)
[0194] Neutralization by these antibodies was determined in the TZMB1 assay using a selection of viruses as shown in Figure 26. Data in Figure 26A and 26B show the neutralization profiles of these chimeric antibodies. Antibody DH542-L4-4A (also referred to as DH542-L4), comprising VH from DH542 and VL from DH429, shows improved neutralization potency compared to the DH542 antibody— Figures 26Aand 27.
[0195] Throughout examples and figures VH sequences are referenced interchangeably as I0848_00001 or I0848_00001 _L1_4A, . I0848_00004 or I0848_00004 _L1_4A I0848_00005 or I0848_00005 _L1_4A, I0848_00006 or I0848_00006 _L1_4A, I0848_00007 or I0848_00007 _L1_4A.
[0196] Additional chimeric comprising non-natural VH and VL chain pairs are contemplated. In non-limiting examples, these pairings include VH and/or VL chains from antibodies DH542, DH542QSA, DH429, DH471, DH391, and/or DH473.
Claims
1. A recombinant antibody or fragment thereof with the binding specificity of the V3 glycan
binding antibody DH542, DH542 L4 or DH5422 QSA.
2. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises:
a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542 and
a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542 or a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH429, or a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542 QSA.
3. The antibody or fragment thereof of claim 1 wherein the antibody comprises:
a VH chain of an antibody selected from the group of antibodies in the DH270 lineage (Figures 8, 20B) and
a VL chain of an antibody selected from the group of antibodies in the in the DH270 lineage (Figures 8, 16).
4. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises:
a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542 and
a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542.
5. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises:
a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542 and
a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH429.
6. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542 and VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542_QSA.
7. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof comprises:
a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542 and
the VL chain of antibody DH542, the VL chain of antibody DH542-QSA, or the VL chain of antibody DH429.
8. The antibody or fragment thereof of claim 1 comprising the VH chain of antibody DH542 and the VL chain of antibody DH542.
9. The antibody or fragment thereof of claim 1 comprising the VH chain of antibody DH542 and the VL chain of antibody DH542-QSA
10. The antibody or fragment thereof of claim 1 comprising the VH chain of antibody DH542 and the VL chain of antibody DH429.
11. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises a modified Fc portion.
12. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof is
bispecific.
13. A pharmaceutical composition comprising anyone of the antibodies or fragments thereof of any one of claims 1-12.
14. A pharmaceutical composition comprising anyone of the antibodies of claim 1-12 and another HIV-1 broad neutralizing antibody.
15. A composition comprising a vector comprising a nucleic acid encoding the antibody or
fragment thereof of any one of claims 1-12.
16. The composition of claim 15, wherein the vector is suitable for gene delivery and expression.
17. A method to treat or prevent HIV-1 infection in a subject comprising administering to the subject a composition comprising an antibody or fragment thereof of any one of claims 1-12, in a therapeutically effective amount.
18. The method of claim 17 wherein the pharmaceutical composition is administered in a
therapeutically effective dose and regimen.
19. The method of claim 17 further comprising administering an additional HIV-1 broad
neutralizing antibody.
Priority Applications (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/559,361 US10344077B2 (en) | 2015-03-19 | 2016-03-21 | HIV-1 neutralizing antibodies and uses thereof (V3 antibodies) |
| PCT/US2016/041808 WO2017011413A1 (en) | 2015-07-10 | 2016-07-11 | Bispecific molecules comprising an hiv-1 envelope targeting arm |
Applications Claiming Priority (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562135309P | 2015-03-19 | 2015-03-19 | |
| US62/135,309 | 2015-03-19 | ||
| US201562191054P | 2015-07-10 | 2015-07-10 | |
| US62/191,054 | 2015-07-10 | ||
| US201562222175P | 2015-09-22 | 2015-09-22 | |
| US62/222,175 | 2015-09-22 | ||
| US201562260100P | 2015-11-25 | 2015-11-25 | |
| US62/260,100 | 2015-11-25 | ||
| US201562261233P | 2015-11-30 | 2015-11-30 | |
| US62/261,233 | 2015-11-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016149698A2 true WO2016149698A2 (en) | 2016-09-22 |
| WO2016149698A3 WO2016149698A3 (en) | 2016-11-03 |
Family
ID=56920233
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/023380 Ceased WO2016149698A2 (en) | 2015-03-19 | 2016-03-21 | Hiv-1 neutralizing antibodies and uses thereof (v3 antibodies) |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10344077B2 (en) |
| WO (1) | WO2016149698A2 (en) |
Cited By (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10344077B2 (en) | 2015-03-19 | 2019-07-09 | Duke University | HIV-1 neutralizing antibodies and uses thereof (V3 antibodies) |
| WO2020010107A1 (en) | 2018-07-03 | 2020-01-09 | Gilead Sciences, Inc. | Antibodies that target hiv gp120 and methods of use |
| WO2020236753A1 (en) | 2019-05-21 | 2020-11-26 | Gilead Sciences, Inc. | Methods of identifying hiv patients sensitive to therapy with gp120 v3 glycan-directed antibodies |
| WO2021011544A1 (en) | 2019-07-16 | 2021-01-21 | Gilead Sciences, Inc. | Hiv vaccines and methods of making and using |
| WO2022046644A1 (en) | 2020-08-25 | 2022-03-03 | Gilead Sciences, Inc. | Multi-specific antigen binding molecules targeting hiv and methods of use |
| US11299751B2 (en) | 2016-04-29 | 2022-04-12 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| WO2022087149A2 (en) | 2020-10-22 | 2022-04-28 | Gilead Sciences, Inc. | Interleukin-2-fc fusion proteins and methods of use |
| US11326182B2 (en) | 2016-04-29 | 2022-05-10 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| WO2022103758A1 (en) | 2020-11-11 | 2022-05-19 | Gilead Sciences, Inc. | METHODS OF IDENTIFYING HIV PATIENTS SENSITIVE TO THERAPY WITH gp120 CD4 BINDING SITE-DIRECTED ANTIBODIES |
| EP3797118A4 (en) * | 2018-05-22 | 2022-06-29 | Beth Israel Deaconess Medical Center, Inc. | Antibody therapies for human immunodeficiency virus (hiv) |
| US11795226B2 (en) | 2017-12-12 | 2023-10-24 | Macrogenics, Inc. | Bispecific CD16-binding molecules and their use in the treatment of disease |
| WO2024015741A1 (en) | 2022-07-12 | 2024-01-18 | Gilead Sciences, Inc. | Hiv immunogenic polypeptides and vaccines and uses thereof |
| WO2024044477A1 (en) | 2022-08-26 | 2024-02-29 | Gilead Sciences, Inc. | Dosing and scheduling regimen for broadly neutralizing antibodies |
| US11944681B2 (en) | 2015-03-19 | 2024-04-02 | Duke University | HIV-1 neutralizing antibodies and uses thereof |
| US12459989B2 (en) | 2018-11-21 | 2025-11-04 | Beth Israel Deaconess Medical Center, Inc. | Antibody therapies for human immunodeficiency virus (HIV) |
Family Cites Families (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2006524039A (en) | 2003-01-09 | 2006-10-26 | マクロジェニクス,インコーポレーテッド | Identification and production of antibody containing mutant Fc region and use thereof |
| US7960512B2 (en) | 2003-01-09 | 2011-06-14 | Macrogenics, Inc. | Identification and engineering of antibodies with variant Fc regions and methods of using same |
| SI1629011T1 (en) | 2003-05-31 | 2010-05-31 | Micromet Ag | Human anti-human cd3 binding molecules |
| US20050249723A1 (en) | 2003-12-22 | 2005-11-10 | Xencor, Inc. | Fc polypeptides with novel Fc ligand binding sites |
| US8802820B2 (en) | 2004-11-12 | 2014-08-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| US9284375B2 (en) | 2005-04-15 | 2016-03-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| US9963510B2 (en) | 2005-04-15 | 2018-05-08 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| US7458704B2 (en) | 2005-12-14 | 2008-12-02 | Konica Minolta Opto, Inc. | Optical element and illuminating device |
| EP3424951A1 (en) | 2007-06-21 | 2019-01-09 | MacroGenics, Inc. | Covalent diabodies and uses thereof |
| US8795667B2 (en) | 2007-12-19 | 2014-08-05 | Macrogenics, Inc. | Compositions for the prevention and treatment of smallpox |
| CN107325182A (en) | 2008-04-02 | 2017-11-07 | 宏观基因有限公司 | HER2/neu specific antibodies and its application method |
| ES2675730T3 (en) | 2008-06-04 | 2018-07-12 | Macrogenics, Inc. | Antibodies with altered FcRn binding and methods of use thereof |
| EP2376109B1 (en) | 2008-12-19 | 2019-01-23 | MacroGenics, Inc. | Covalent diabodies and uses thereof |
| AU2010298025B2 (en) | 2009-09-25 | 2016-04-21 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Neutralizing antibodies to HIV-1 and their use |
| EP2601216B1 (en) | 2010-08-02 | 2018-01-03 | MacroGenics, Inc. | Covalent diabodies and uses thereof |
| CA2832389A1 (en) | 2011-04-20 | 2012-10-26 | Genmab A/S | Bispecific antibodies against her2 and cd3 |
| CA2835522C (en) | 2011-05-09 | 2019-06-11 | Duke University | Focused evolution of hiv-1 neutralizing antibodies revealed by crystal structures and deep sequencing |
| DK2714733T3 (en) | 2011-05-21 | 2019-05-06 | Macrogenics Inc | CD3 BINDING MOLECULES ABLE TO BIND TO HUMAN AND NON-HUMAN CD3 |
| CA2836873C (en) | 2011-05-21 | 2019-10-22 | Macrogenics, Inc. | Deimmunized serum-binding domains and their use for extending serum half-life |
| AU2012265156B2 (en) | 2011-05-27 | 2017-01-19 | F. Hoffmann-La Roche Ag | Dual targeting |
| WO2013013025A2 (en) | 2011-07-20 | 2013-01-24 | Medimmune Limited | Anti-cxcr4 antibodies and methods of use |
| JOP20200236A1 (en) | 2012-09-21 | 2017-06-16 | Regeneron Pharma | Anti-cd3 antibodies, bispecific antigen-binding molecules that bind cd3 and cd20, and uses thereof |
| LT2908912T (en) | 2012-10-18 | 2020-09-25 | The Rockefeller University | Broadly-neutralizing anti-hiv antibodies |
| JP6676521B2 (en) | 2013-03-14 | 2020-04-08 | マクロジェニクス,インコーポレーテッド | Bispecific molecules, pharmaceutical compositions and uses thereof |
| US10286057B2 (en) | 2013-04-15 | 2019-05-14 | Duke University | Cyclic HIV-1 Env V3 glycopeptide immunogens |
| UA116479C2 (en) | 2013-08-09 | 2018-03-26 | Макродженікс, Інк. | SPECIFIC MONOVALENT Fc-DIATELY CONNECTING BACKGROUND OF THE CD32B AND CD79b AND ITS APPLICATION |
| EP2839842A1 (en) | 2013-08-23 | 2015-02-25 | MacroGenics, Inc. | Bi-specific monovalent diabodies that are capable of binding CD123 and CD3 and uses thereof |
| EP2840091A1 (en) | 2013-08-23 | 2015-02-25 | MacroGenics, Inc. | Bi-specific diabodies that are capable of binding gpA33 and CD3 and uses thereof |
| WO2016149698A2 (en) | 2015-03-19 | 2016-09-22 | Duke University | Hiv-1 neutralizing antibodies and uses thereof (v3 antibodies) |
| WO2016196975A1 (en) | 2015-06-03 | 2016-12-08 | The United States Of America, As Represented By The Secretary Department Of Health & Human Services | Neutralizing antibodies to hiv-1 env and their use |
-
2016
- 2016-03-21 WO PCT/US2016/023380 patent/WO2016149698A2/en not_active Ceased
- 2016-03-21 US US15/559,361 patent/US10344077B2/en active Active
Cited By (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10344077B2 (en) | 2015-03-19 | 2019-07-09 | Duke University | HIV-1 neutralizing antibodies and uses thereof (V3 antibodies) |
| US11944681B2 (en) | 2015-03-19 | 2024-04-02 | Duke University | HIV-1 neutralizing antibodies and uses thereof |
| US11299751B2 (en) | 2016-04-29 | 2022-04-12 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| US11326182B2 (en) | 2016-04-29 | 2022-05-10 | Voyager Therapeutics, Inc. | Compositions for the treatment of disease |
| US11795226B2 (en) | 2017-12-12 | 2023-10-24 | Macrogenics, Inc. | Bispecific CD16-binding molecules and their use in the treatment of disease |
| EP3797118A4 (en) * | 2018-05-22 | 2022-06-29 | Beth Israel Deaconess Medical Center, Inc. | Antibody therapies for human immunodeficiency virus (hiv) |
| US11845788B2 (en) | 2018-05-22 | 2023-12-19 | Beth Israel Deaconess Medical Center, Inc. | Antibody therapies for human immunodeficiency virus (HIV) |
| EP4624491A2 (en) | 2018-07-03 | 2025-10-01 | Gilead Sciences, Inc. | Antibodies that target hiv gp120 and methods of use |
| WO2020010107A1 (en) | 2018-07-03 | 2020-01-09 | Gilead Sciences, Inc. | Antibodies that target hiv gp120 and methods of use |
| EP4257600A2 (en) | 2018-07-03 | 2023-10-11 | Gilead Sciences, Inc. | Antibodies that target hiv gp120 and methods of use |
| US12459989B2 (en) | 2018-11-21 | 2025-11-04 | Beth Israel Deaconess Medical Center, Inc. | Antibody therapies for human immunodeficiency virus (HIV) |
| WO2020236753A1 (en) | 2019-05-21 | 2020-11-26 | Gilead Sciences, Inc. | Methods of identifying hiv patients sensitive to therapy with gp120 v3 glycan-directed antibodies |
| EP4513188A2 (en) | 2019-05-21 | 2025-02-26 | Gilead Sciences, Inc. | Methods of identifying hiv patients sensitive to therapy with gp120 v3 glycan-directed antibodies |
| WO2021011544A1 (en) | 2019-07-16 | 2021-01-21 | Gilead Sciences, Inc. | Hiv vaccines and methods of making and using |
| WO2022046644A1 (en) | 2020-08-25 | 2022-03-03 | Gilead Sciences, Inc. | Multi-specific antigen binding molecules targeting hiv and methods of use |
| WO2022087149A2 (en) | 2020-10-22 | 2022-04-28 | Gilead Sciences, Inc. | Interleukin-2-fc fusion proteins and methods of use |
| EP4667499A2 (en) | 2020-10-22 | 2025-12-24 | Gilead Sciences, Inc. | Interleukin-2-fc fusion proteins and methods of use |
| WO2022103758A1 (en) | 2020-11-11 | 2022-05-19 | Gilead Sciences, Inc. | METHODS OF IDENTIFYING HIV PATIENTS SENSITIVE TO THERAPY WITH gp120 CD4 BINDING SITE-DIRECTED ANTIBODIES |
| EP4660325A2 (en) | 2020-11-11 | 2025-12-10 | Gilead Sciences, Inc. | Methods of identifying hiv patients sensitive to therapy with gp120 cd4 binding site-directed antibodies |
| WO2024015741A1 (en) | 2022-07-12 | 2024-01-18 | Gilead Sciences, Inc. | Hiv immunogenic polypeptides and vaccines and uses thereof |
| WO2024044477A1 (en) | 2022-08-26 | 2024-02-29 | Gilead Sciences, Inc. | Dosing and scheduling regimen for broadly neutralizing antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| US10344077B2 (en) | 2019-07-09 |
| US20180072797A1 (en) | 2018-03-15 |
| WO2016149698A3 (en) | 2016-11-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10344077B2 (en) | HIV-1 neutralizing antibodies and uses thereof (V3 antibodies) | |
| JP7455156B2 (en) | Antibodies targeting HIV gp120 and methods of use | |
| US11071783B2 (en) | HIV-1 neutralizing antibodies and uses thereof | |
| US10450368B2 (en) | HIV-1 neutralizing antibodies and uses thereof (CD4bs antibodies) | |
| IL258822B2 (en) | Trispecific and/or trivalent binding proteins for prevention or treatment of hiv infection | |
| WO2017011413A1 (en) | Bispecific molecules comprising an hiv-1 envelope targeting arm | |
| US20250019443A1 (en) | Antibodies that target hla-e-host peptide complexes and uses thereof | |
| TW200846363A (en) | Novel human anti-R7V antibodies and uses thereof | |
| EP3778630A1 (en) | Broadly neutralizing monoclonal antibodies against hiv-1 v1v2 env region | |
| WO2017011414A1 (en) | Bispecific molecules comprising an hiv-1 envelope targeting arm | |
| WO2020082045A1 (en) | Multispecfic anti-hiv antibodies | |
| WO2016054023A1 (en) | Hiv-1 antibodies and uses thereof (adcc and bispecific abs) | |
| WO2018053328A1 (en) | Bispecific molecules comprising an hiv-1 envelope targeting arm | |
| US11944681B2 (en) | HIV-1 neutralizing antibodies and uses thereof | |
| EP4688859A1 (en) | Antibodies that target hla-e-host peptide complexes and uses thereof | |
| CA3229447A1 (en) | Antibodies that target hla-e-host peptide complexes and uses thereof | |
| CN107383190A (en) | People source AntiHIV1 RT activity gp41 specific antibodies and its application | |
| WO2023122211A2 (en) | Coronavirus antibodies and uses thereof | |
| HK40046504A (en) | Broadly neutralizing monoclonal antibodies against hiv-1 v1v2 env region |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16765890 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16765890 Country of ref document: EP Kind code of ref document: A2 |


