WO2016149695A1 - HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF (CD4bs ANTIBODIES) - Google Patents

HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF (CD4bs ANTIBODIES) Download PDF

Info

Publication number
WO2016149695A1
WO2016149695A1 PCT/US2016/023355 US2016023355W WO2016149695A1 WO 2016149695 A1 WO2016149695 A1 WO 2016149695A1 US 2016023355 W US2016023355 W US 2016023355W WO 2016149695 A1 WO2016149695 A1 WO 2016149695A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
antibodies
hiv
fragment
lineage
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/023355
Other languages
French (fr)
Inventor
Barton F. Haynes
Hua-Xin Liao
Mattia Bonsignori
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Duke University
Original Assignee
Duke University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Duke University filed Critical Duke University
Priority to US15/559,171 priority Critical patent/US10450368B2/en
Priority to PCT/US2016/041809 priority patent/WO2017011414A1/en
Publication of WO2016149695A1 publication Critical patent/WO2016149695A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/112Retroviridae (F), e.g. leukemia viruses
    • C07K16/114Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
    • C07K16/1145Env proteins, e.g. gp41, gp110/120, gp160, V3, principal neutralising domain [PND] or CD4-binding site
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/112Retroviridae (F), e.g. leukemia viruses
    • C07K16/114Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF CD4bs antibodies
  • This invention was made with government support under Center for HIV/ AIDS Vaccine Immunology-Immunogen Design grant UM1-AI100645 from the NIH, NIAID, Division of AIDS. The government has certain rights in the invention.
  • the invention relates to the identification of monoclonal HIV-1 neutralizing antibodies, such as, but not limited to, antibodies that bind to the CD4 binding site (CD4bs) of HIV-1 gpl20, their recombinant expression and purification and uses.
  • monoclonal HIV-1 neutralizing antibodies such as, but not limited to, antibodies that bind to the CD4 binding site (CD4bs) of HIV-1 gpl20, their recombinant expression and purification and uses.
  • HIV Neutralizing Antibodies Clinical Correlates and Implications for Vaccines
  • the Journal of Infectious Diseases (2010) Volume 201, Issue 7, Pp. 981-983 Over the time of an infection, some individuals develop neutralizing antibodies, and with some of these neutralizing antibodies having activity against diverse primary HIV-1 isolates.
  • mAbs broad neutralizing monoclonal antibodies
  • a number of broad neutralizing monoclonal antibodies (mAbs) have been identified from HIV-1 infected individuals and these define specific regions on the virus envelope, e.g. CD4 binding site, V3 loop, membrane proximal region (MPER) of gp41, that are vulnerable to neutralizing Abs.
  • the invention provides an antibody or fragment thereof with the binding specificity of CD4 binding site antibody DH491 or CH493, or CH558, or CH557.
  • the invention provides a recombinant antibody or fragment thereof comprising: a variable heavy chain (VH) amino acid sequence, or fragment thereof, selected from the group of VH amino acid sequences of an antibody CH490, CH491, CH492, CH493, CH555, CH556 and CH557 and a variable light chain (VL) amino acid sequence or fragment thereof, selected from the group of VL amino acid sequences of an antibody CH490, CH491, CH492, CH493, CH555, CH556 and CH557, wherein the recombinant antibody or fragment thereof binds to the CD4 binding site of the HIV-1 envelope.
  • the antibodies bind to the CD4 binding site on the HIV-1 envelope and are neutralizing.
  • the antibody or fragment thereof is fully human and recombinantly produced.
  • some of the VH and VL chains are identified from human subject who have been naturally infected with HIV-1.
  • the antibody is not naturally occurring.
  • the antibody comprises naturally occurring pair of VH and VL chains.
  • the antibody comprises naturally occurring pair of VH and VL chains wherein the Fc portion of the antibody is not the natural isotype or portion of the naturally occurring pair of VH and VL chains.
  • the antibody is
  • the antibody is computationally designed, for example based on some naturally identified VH and VL sequences.
  • the antibody is computationally designed, e.g. UCA, Intermediates in the antibody lineages.
  • the antibody comprises a non-naturally occurring pairing of VH and VL chains, wherein the VH or VL individually could be identified from a subject.
  • the antibody comprises VH chain or HCDRs of a VH chain of one clonal member, and VL or LCDRs of another clonal member, i.e., a non-naturally occurring antibody comprising sequences derived from natural pairs.
  • the antibody comprises naturally occurring VH and VL chains modified by substituting one or more amino acids.
  • the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody CH557, or any of the other lineage members.
  • the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the VL chain of antibody CH557, or any of the other lineage members.
  • the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542, or any of the other lineage members.
  • the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542, or any of the other lineage members.
  • the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493 and further comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493.
  • the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody CH557.
  • the antibody or fragment thereof comprises a VH which comprises the HCDR3 of CH557 and further comprises a VL which comprises the LCDR3 of CH557.
  • the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH542. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody DH542.
  • the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody CH557 and further comprises the complementary VL which comprises the LCDR1, LCDR2, LCDR3 of antibody CH557.
  • the antibody or fragment thereof comprises VH and VL of antibody CH557. [0019] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH542 and further comprises the complementary
  • VL which comprises the LCDR1, LCDR2, LCDR3 of antibody DH542.
  • the antibody or fragment thereof comprises VH and VL of antibody DH542.
  • the antibody is DH542. In certain embodiments, the antibody is
  • the invention provides a recombinant antibody or fragment thereof with the binding specificity of CD4 binding site antibody DH491 or CH493, or CH558, or CH557 comprising an engineered constant domain.
  • the recombinant antibody or fragment thereof is capable of neutralizing an HIV-1 Env pseudovirus with an IC50 of less than 50 ⁇ g/mL in an in vitro assay.
  • the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention or fragments thereof or any combination thereof.
  • the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention, or a combination thereof.
  • the composition comprises an antibody or a fragment thereof which is recombinantly produced in CHO cells.
  • the invention provides a pharmaceutical composition comprising a vector comprising a nucleic acid encoding anyone of inventive antibodies or fragments.
  • the nucleic acids are optimized for expression in human host cells.
  • the nucleic acids are optimized for recombinant expression in a suitable host cell.
  • the vector is suitable for gene delivery and expression. Non-limiting examples of such vectors include adenoviral vectors (Ads), adeno associated virus based vectors (AAVs), or a combination thereof.
  • Ads adenoviral vectors
  • AAVs adeno associated virus based vectors
  • the invention provides isolated cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof.
  • the invention provides compositions of cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof.
  • compositions further comprise an additional antibody or fragment thereof.
  • compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH540.
  • the compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH512.
  • the compositions further comprise an antibody or a fragment thereof comprising VH and VL chain of antibody DH429 or DH270IA1.
  • the antibody or antigen binding fragment can include an Fc domain that has been modified compared to a native Fc domain.
  • the Fc domain can be modified by amino acid substitution to increase binding to the neonatal Fc receptor and therefore the half-life of the antibody when administered to a subject.
  • the invention provides antibodies or fragments comprising a CDR(s) of the VH and/or VL chains, or VH and/or VL chains of the inventive antibodies, as the HIV-1 binding arm(s) of a bispecific molecules, e.g. but not limited to DARTS, diabodies, toxin labeled HIV-1 binding molecules.
  • a bispecific molecules e.g. but not limited to DARTS, diabodies, toxin labeled HIV-1 binding molecules.
  • the invention provides methods to treat or prevent HIV-1 infection in a subject comprising administering to the subject a pharmaceutical composition comprising any one of the inventive antibodies or fragments thereof in a therapeutically effective amount.
  • the methods of the invention contemplate combination therapeutic methods, including but not limited to administering combinations of various antibodies or fragments thereof.
  • the pharmaceutical compositions are administered in a therapeutically effective dose and regimen.
  • FIG. 1 shows DH542 sequences (CDRs are bolded and underlined) (SEQ ID NOs: 1-4).
  • FIG. 2 shows the amino acids sequences of VH and VL chains of antibodies of the DH270 lineage, and nucleic acid sequences encoding these amino acids. CDRs are highlighted in each antibody.
  • DH270IA1 as listed in Figure 3 is the same antibody referred to as II in the sequence of Figure 2.
  • the figure shows SEQ ID NOs: 5-16 (Heavy chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 17-28 (Heavy chain amino acid sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 29-40 (Light chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 41-52 (Light chain amino acid sequences in order of appearance from UCA-DH270H).
  • FIG. 3 shows Neutralizing Breadth and Potency of various HIV-1 BnAbs that are candidates for being combined with the inventive antibodies or other antibodies for a potent mixture of bnAbs.
  • DH270IA1 is II in the DH270 lineage.
  • FIG. 4 shows Neutralizing Breadth and Potency of some candidate bnAbs for single or combination use.
  • FIG. 5 shows comparison of some of the bnAbs of the invention with other bnAbs in the same class. % breadth refers to number of tested HIV-1 strains.
  • FIG. 6 shows nucleic acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 53-72).
  • FIG. 7 shows amino acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 73-93).
  • FIGS. 8 A and 8B show Alignment of VH (8 A) and VL (8B) Sequences of BnAb DH511 Clonal Lineage.
  • Bolded is the sequence of CDRl
  • underlined is the sequence of CDR2
  • italicized is the sequence of CDR3 of the DH511 VH chain and DH511 VL chain.
  • the CDRs of the VH and VL sequences of the other antibodies DH512, DH513, DH514, DH515, and DH516 can be readily determined based on the sequence alignment.
  • FIG. 8A shows SEQ ID NOs: 94-99 (in order of appearance from DH511-DH516).
  • FIG. 8B shows SEQ ID NOs: 100-105 (in order of appearance from DH511 -DH516).
  • FIGS. 9A and 9B show Alignment of VH ( Figure 9A) and VL ( Figure 9B) sequences of MPER BnAbs.
  • Bolded is the sequence of CDRl
  • italicized is the sequence of CDR2
  • underlined is the sequence of CDR3 of VH or VL of the listed MPER antibodies.
  • FIG. 9A shows SEQ ID NOs: 106-114 (in order of appearance from DH511-2F5).
  • FIG. 9B shows SEQ ID NOs: 115-123 (in order of appearance from DH51 1-2F5).
  • FIG. 10 shows neutralization by antibodies CH555, CH556, CH557, CH558, CH560, CH561, CH562, DH210 and DH211 identified from subject CH505 measured in TZM-bl cells.
  • Pseudoviruses were produced by transfection in 293T cells. Values are the antibody concentration ⁇ g/ml) at which relative luminescence units (RLUs) were reduced 50% compared to virus control wells (no test sample). Values in bold are considered positive for neutralizing antibody activity.
  • FIG. 11 shows CH557 gene information.
  • FIG. 12 shows sequences of CH557 (SEQ ID NOs: 124-127). CDRs are bolded and underlined.
  • FIG. 13 shows a sequence alignment of the CD540-VRC40 antibodies, listing the heavy and light chain variable region sequences, kabat and IMGT CDR and framework regions, and kabat numbering.
  • FIG. 14 shows gene information for antibodies in the CH235 lineage.
  • FIGS. 15A and 15B show amino acid alignment of CH235 lineage antibody heavy chain
  • FIG. 15A shows SEQ ID NOs: 128-139 (in order of appearance from UCA-CH557).
  • FIG. 15B shows SEQ ID NOs: 140-149 (in order of appearance from UCA-
  • FIG. 16 shows alignment of CH557 heavy chain amino acid sequence compared to CH235 lineage antibodies with increasing levels of somatic mutations and neutralization breadth. Contact sites with gpl20 identified from CH235/gpl20 co-crystal structure are indicated with asterisks. Amino acid mutations within the contact sites are bolded and underlined. Figure 16 shows SEQ ID NOs: 150-154 (in order of appearance from UCA-CH557).
  • FIG. 17 shows alignment of CH557 light chain amino acid sequence compared to CH235 lineage antibodies with increasing levels of somatic mutations and neutralization breadth.
  • Figure 17 shows SEQ ID NOs: 155-158 (in order of appearance from UCA-CH557).
  • FIG. 20 shows phylogenetic tree of the heavy chains of antibodies CH490, CH491, CH492 and CH493 (see table in Figure 19). See also Example 6: CH240, CH239, CH235, CH236, CH241 VH chains were identified from cultured memory B cells. The rest of the VH chains were retrieved with deep sequencing.
  • FIG. 21 shows ELISA binding of CH490, CH491, CH492 and CH493 antibodies to various antigens as listed in the figure.
  • FIG. 22 shows a summary of neutralization data of CH490, CH491, CH492 and CH493 antibodies for various HIV-1 strains in TZMbl assay. Intermediate antibodies are described in Gao, Bonsignori, Liao et al. Cell 158, 481-491, July 31, 2014.
  • FIG. 23 shows a summary of neutralization data for antibodies CH235, CH490, CH491, and
  • the viruses are CH505 TF (autologous virus) in which either point or multiple single mutations were introduced in the loop D region.
  • the loop D mutations are described in Gao et al Cell 158, 481-491, July 31, 2014 (incorporated by reference). These mutations reflect mutations in the loop D region that naturally occurred in the autologous virus of this subject over time. They were artificially introduced into the CH505 TF to study their effect in absence of other mutations in other parts of the autologous virus that also occurred during virus evolution. These mutations were induced by CH235 lineage antibodies identified early during the course of infection. These data show that the more mutated antibody CH493 which came from a later time point and that is broadly neutralizing also acquired the ability of recognizing virus escape mutants that escaped earlier antibodies from the same lineage, before they acquired substantial breadth.
  • FIG. 24 shows a summary of neutralization (TZMbl assay) data of CH505 D loop mutants by various antibodies. The summary shows that CH493 neutralizes all Loop D CH505 mutants.
  • FIG. 25 shows results of HEp-2 cell IF staining for CH557.
  • FIGS. 26A and 26B shows summary of data from CH557 microarray polyreactivity.
  • FIG. 27A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC50 in ⁇ g/ml.
  • FIG. 27B shows the mean IC50 and percent of isolates neutralized at different IC50 values.
  • FIG. 28A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC80 in ⁇ g/ml.
  • FIG. 28B shows the mean IC80 and percent of isolates neutralized at different
  • FIGS. 29A-29B show CH235 Lineage, with Time of Appearance and Neutralization by Select Members.
  • A Phylogram of CH235 lineage. Phylogenetic tree is colored by first time (wk post-infection) from which sequences were obtained. Key members of the CH235 lineage are labeled. CH235.6, CH235.7, CH235.8 and CH235.9 V H were complemented with full heavy chain gene regions and paired with the V L from the closest natural antibody.
  • B Neutralization dendrograms display single mAb neutralization of a genetically diverse panel of 199 HIV-1 isolates. Coloration is by IC 5 o- See also Figures 36A-B, 40C, and 41.
  • FIGS. 30A-30E show structures of CH235 -Lineage Members in Complex with HIV-1 Env.
  • FIGS. 31A-C show sequence Evolution of CH235 Lineage: SHM, Timing, and Conformity of CH235 -Lineage Development from UCA to Antibody with 90% Breadth.
  • A Heavy chain SHM over time for the CH235 lineage (left panel). SHM levels of other V H l-46-derived CD4bs mAbs and selected VHl-2-derived VRCOl-class mAbs are shown (middle and right panels, respectively); the time since infection is unknown for these mAbs.
  • B Maturation conformity vs overall heavy chain SHM.
  • Positional conformity (top row) is defined as the number of aa positions differing from the germline sequence in both the conforming and reference sequences, divided by the total number of aa changes in the conforming antibody.
  • Identity conformity (bottom row) is defined as the number of such positions which are additionally mutated to the same residue, divided by the total number of mutations in the conforming antibody.
  • Conformity to 1B2530 (left) and to 8ANC131 (right) is shown for both position and identity.
  • C V H -gene mutability accounts for the majority of positional conformity of CH235 lineage. The mutability of the VH-gene for VH1-46 (top) and VH I - 2 (bottom) is shown. Sequence logos are shown at each position; the height of each logo
  • FIGS. 32A-32D show binding Kinetics of CH103 and CH235 Lineage Antibodies. Binding association (k a ) and dissociation (k d ) rates of the CHI 03 (A-B, squares) and CH235 (C-D, circles) lineage mAbs to CH505.TF gpl20 Env were measured with SPR and used to calculate the dissociation rate constants (K d ). K d S are shown in A and C, k a (solid lines, plotted on the left y-axis) and k d (dashed lines, plotted on the right y-axis) are shown in B and D. See also Figures 44A-B.
  • FIGS. 33A-33C show CH235 Lineage Antibodies Neutralization of Autologous Virus
  • FIGS. 34A-34B show binding of CH235 and CHI 03 Lineage mAbs to Autologous CH505.
  • A and CH235 UCA Binding to Heterologous fflV-1 Env Glycoproteins
  • B Heatmap analysis of UCA, intermediate (IA) and mature CH235 and CHI 03 lineage mAbs binding to 113 CH505 autologous Env isolated from time of infection (TF) to 160 wks post-infection and to the CH505.TF mutants (Gao et al., Cell 2014). Mabs were tested in ELISA at concentrations ranging from 100 ⁇ to 0.6 ng/ml . Binding is expressed as a LogAUC.
  • B Affinity of CH235 UCA, CH235 wild-type and select SHM variants to a panel of 15 heterologous gpl20 Envs. See also Figures 40A-40B and 43.
  • FIGS. 35A-35D show CH235 Antibody Lineage Auto- and Polyreactivity.
  • A CH235 lineage antibody binding to ANA measured in ELISA. LogAUC was calculated from duplicate samples. Results representative of duplicate experiments.
  • B Binding to cardiolipin was determined using Quanta Lite ACA IgG III ELISA Assay.
  • D Measurement of polyreactivity against 9,400 human antigens using Proto Array 5 microchip: CH235 lineage mAbs binding (x-axis) was compared to non-polyreactive control mAb 15 IK (y-axis). Polyreactivity is defined as 1 log stronger binding than 151k mAb to more than 90% of the test proteins. High affinity binding was measured as a >2 log increase in binding (dotted line) (Liu et al., 2015).
  • FIGS. 36A-36B show CH235 Lineage: Sequences and Neutralization Fingerprint
  • IGHV1-46*01 is used as reference for IGHVl -46 derived antibodies and IGHVl -2*02 is used as reference for the three VRCOl -class antibodies.
  • B The neutralization fingerprints for three antibodies from the CH235 lineage were compared to the fingerprints for other VH1-46 class antibodies and non-VHl-46 class CD4- binding-site antibodies; coloring same as in Figure 31A-C. Antibodies targeting other sites of vulnerability on HIV-1 Env are shown as control (black). [0072] FIGS.
  • FIG. 37A-37G show CH235 Lineage Versus Other CD4-Binding Site Antibodies and Negative-stain EM Reconstructions of gpl40 SOSIP Trimers with CH235-lineage Fabs, Related to Figure 30A-E.
  • A CD4-mimicry by CH235. Recognition of gpl20 by the N-terminal domain of the CD4 receptor (far left) is compared to VH genes from CH235 and prototypic antibodies VRCOl (from VH1-2) and 8ANC131 (from VH1-46).
  • B conserveed molecular interactions between antibody CH235, receptor CD4 and antibody VRCOl . Top row shows intermolecular antiparallel strand interactions and bottom row Asp368 electrostatic interaction.
  • C Binding orientation of VH- gene derived antibodies relative to CD4.
  • D Negative-stain EM 3D models with BG505
  • FIGS. 38A-38E show Sequence Similarity Between VH1-2 and VH1-46 Broadly
  • FIGS. 39A-39B show Generation of CH235.9 Mutants to Evaluate the Effect of Mutations in the V-heavy Chain on the Ability of CH235.9 to Neutralize loop D Mutant CH505 Autologous
  • CH505 escape mutants (B) Alignment of CH235.7 and CH235.9 through CH235.13 VH amino acid sequences to CH236 VH (SEQ ID NOs: 171-177 (in order of appearance from CH236- CH235.7)). CH235.9 aa mutations expressed as recombinant IgG and tested for neutralization of CH505 TF loop D mutants are shown in red. Asterisks indicate points of contact with gpl20 derived from the CH235 crystal structure in complex with gpl20 Env.
  • FIGS. 40A-40B show CH505 gpl20 Env Quasi-species Selected as Optimized Immunogens to Induce Both CH235 and CH103-like bnAbs, Related to Figure 34A-B.
  • A Heatmap of the binding data of selected CH235 and CHI 03 lineage members to the CH505 Env glycoproteins selected to be used as immunogens. Individual Env clone names and weeks of isolation are shown on the left.
  • B Affinity of gHgL of 1B2530, 8ANC131, VRCOl, VRC-PG04 and VRC-CH31 to a panel of 15 heterologous gpl20 envelope glycoproteins.
  • FIG. 40C shows a Table with characteristics of the V(D)J rearrangements of key CH235 lineage antibodies. Related to Figure 29.
  • FIG. 41 shows a Table with a summary of the Breadth and Potency of Antibody
  • FIG. 42 shows a Table with crystallographic Data Collection and Refinement Statistics. Related to Figures 30A-30E.
  • FIGS. 43A-43C show Sequence Similarity Between VHl-2 and VHl-46 Broadly
  • FIGS. 44A-44B show CH235 Lineage and CH106 Monoclonal Antibodies Cross-Blocking. Related to Figure 32.
  • (A) CH235 lineage antibodies blocking of sCD4 and CHI 06 binding to CH505 TF gpl20 and B.63521 gpl20 Envs. Results expressed as IC50 ug/ml. nb no blocking.
  • FIG. 45 shows CH235 lineage autologous neutralization.
  • FIG. 46 shows CH235 lineage antibodies and CH235.9 mutants neutralization of CH505 TF loop D mutant viruses.
  • Figure 33 A-C shows CH235 lineage antibodies and CH235.9 mutants neutralization of CH505 TF loop D mutant viruses.
  • FIG. 47 shows binding of antibodies in the CH235 and CH103 lineages to CH505 autologous Env glycoproteins, Related to Figure 34A-B.
  • Figures 48A-48D show non-limiting examples of mutations in the VH chain of DH511 and DH512, and non-limiting examples of sequences including mutations in DH512 VH chain.
  • Figure 48 A shows positions in the VHCDR3 chain of DH511 which could be mutated. Amino acid positions refer to Kabat numbering. Most mutations are to changes to W, but F, L or possibly other substitutions can also be tried.
  • Figure 48B shows positions in the VHCDR3 chain of DH512 which could be mutated. Amino acid positions refer to Kabat numbering for the DH512VH chain:
  • VHCDR3 could include VH LlOOdF together with TlOOaW; VH LlOOdW together with TlOOaW.
  • Figure 48C shows positions outside of VHCDR3 which could be mutated. Most mutations are to changes to W, F, L or possibly other substitutions can also be tried.
  • Figure 48D shows amino acid sequences (SEQ ID NOs: 195-212) of some of the DH512 mutants from Figure 48B.
  • antibodies that bind with high affinity to Env may be useful in eliminating the latent pool of HIV-1 -infected CD4 T cells and curing HIV-1 infection, when either used to sensitize HIV-1 expressing target cells with bispecific bnAbs for NK or CD8 T cell killing or when bnAbs are conjugated with toxins or radionucleotides.
  • the invention provides fully human antibodies and fragments that specifically bind to and potently neutralize various isolates of HIV-1.
  • the antibodies bind to HIV-1 env V3 glycan.
  • the antibodies of the invention bind to HIV-1 gpl20 Env CD4 binding site.
  • the invention provides pharmaceutical compositions including these human antibodies and a pharmaceutically acceptable carrier.
  • the invention provides antibodies for passive immunization against HIV/ AIDS.
  • Nucleic acids encoding these antibodies, expression cassettes and vectors including these nucleic acids, and isolated cells that express the nucleic acids which encode the antibodies of the invention are also provided.
  • the invention provides antibodies which are clonal variants .
  • clonal variants are sequences that differ by one or more nucleotides or amino acids, and have a V region with shared mutations compared to the germline, identical VHDJH or VJH gene usage, identical or similar HCDR3 length, and the same VL and JL usage.
  • the germline sequence (unmutated common ancestor "UCA") is intended to be the sequence coding for the antibody/immunoglobulin (or of any fragment thereof) deprived of mutations, for example somatic mutations.
  • Antibodies in a clone that are designated as UCA and/or I are typically not identified from a biological sample, but are derived computationally based on VH and/or VL sequences identified from subjects infected with HIV-1.
  • compositions including the human antibodies of the invention can be used for any purpose including but not limited to research, diagnostic and therapeutic purposes.
  • the human monoclonal antibodies disclosed herein can be used to detect HIV-1 in a biological sample or interfere with the HIV-1 activity, for example to diagnose or treat a subject having an HIV-1 infection and/or AIDS.
  • the antibodies can be used to determine HIV-1 titer in a subject.
  • the antibodies disclosed herein also can be used to study the biology of the human immunodeficiency virus.
  • the antibodies of the invention can be used for therapeutic purposes for treatment or prevention of HIV-1 infection, alone or in combination with other therapeutic modalities, including ART and/or combination with other HIV-1 targeting antibodies, neutralizing antibodies and/or ADCC inducing antibodies.
  • the antibodies of the invention are expected not to exhibit self- reactivity— they do not bind or bind very weakly to self-antigens, such as human protein.
  • the antibodies of clone DH51 1 are not self-reactive although their UCA and some IAs are polyreactive.
  • DH542 is not.
  • DH270IA1 does not show self-reactivity, while DH491 and DH493 antibodies are polyreactive to varying degrees.
  • Broadly neutralizing antibody CH557 displays exceptional neutralization breadth and high potency ( Figure 10) and it is not autoreactive nor polyreactive as determined by lack of binding to known human antigens associated with autoimmune disorders), negativity in Hep-2 cells IF staining ( Figure 25) and lack of binding to an array of 9,400 human antigens (Figure 26A and B), including UBE3A and STUB-1 proteins, known to be bound by previously described broadly neutralizing antibodies targeting the CD4bs of gpl20 Env (Liu et al J Virol 2014, Bonsignori et al JCI 2014).
  • the neutralization breadth of the inventive antibodies is demonstrated by the diversity of viruses which are neutralized in the TZMbl Env pseudovirus inhibition assay.
  • the neutralization breadth and/or binding of the antibodies of the invention can be maintained in the presence of tolerate changes to the epitope. Comparing the sequences of the neutralized viruses, versus viruses that are not neutralized, a skilled artisan can readily determine the % virus changes, including changes in the epitope, which can be tolerated while neutralization and/or binding is maintained.
  • sequence identity compare sequence length and determine the % sequence identity and/or changes, including % sequence identity and/or changes in the VH and VL sequences, including % sequence identity and/or changes in the CDRs, as well as the specific positions and types of substitutions which can be tolerated while neutralization potency and breadth is maintained.
  • sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are.
  • homology is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are.
  • homology is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are.
  • homologs or variants of a polypeptide will possess a relatively high degree of sequence identity when aligned using standard methods.
  • NCBI Bethesda, Md.
  • sequence analysis programs blastp, blastn, blastx, tblastn and tblastx A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
  • Homologs and variants of a VL or a VH of an antibody that specifically binds a polypeptide are typically characterized by possession of at least about 75%, for example at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity.
  • homologs and variants When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95%) depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
  • the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the VH and VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency.
  • the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the CDR1, 2, and/or 3 of VH and CDR1, 2, and/or 3 VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency.
  • the invention provides antibodies which can tolerate a larger percent variation in the sequences outside of the VH and/VL sequences of the antibodies.
  • the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, 70%, 69%, 68%, 67%, 66%, 65% identical, wherein the identity is outside of the VH or VL regions, or the CDRs of the VH or VL chains of the antibodies described herein.
  • Antibodies of the invention are expected to have the same binding specificity, for example as intact immunoglobulins and antigen binding variants or fragments e.g. as a number of well characterized fragments produced by digestion with various peptidases.
  • Fabs, Fvs, scFvs are fragments which are expected to have the same binding specificities as intact antibodies. Binding specificity can be determined by any suitable assay in the art, for example but not limited competition binding assays, epitope mapping, etc.
  • a scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains.
  • Provided are also genetically engineered forms such as chimeric antibodies and heteroconjugate antibodies such as bispecific antibodies. See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, 111.); Kuby, Immunology, 3.sup.rd Ed., W.H. Freeman & Co., New York, 1997.
  • the invention provides antibody fragments, which have the binding specificity and/or properties of the inventive antibodies.
  • Non-limiting examples include: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab', the fragment of an antibody molecule obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule; (3) (Fab 1 ).
  • the fragment of the antibody obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; (4) F(ab').sub.2, a dimer of two Fab' fragments held together by two disulfide bonds; (5) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and (6) single chain antibody (“SCA”), a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule.
  • the antibody fragments can be produces recombinantly.
  • VH refers to the variable region of an immunoglobulin heavy chain, including but not limited to that of an antibody fragment, such as Fv, scFv, dsFv or Fab.
  • VL refers to the variable region of an immunoglobulin light chain, including but not limited to that of an Fv, scFv, dsFv or Fab.
  • nucleic acids encoding any of the antibodies, or fragment thereof can be expressed in a recombinantly engineered cell such as bacteria, plant, yeast, insect and mammalian cells.
  • the nucleic acid sequences include any sequence necessary for expression, including but not limited to a promoter, a leader sequence.
  • These antibodies can be expressed as individual VH and/or VL chain, or can be expressed as a fusion protein.
  • the antibodies can be expressed by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447).
  • scFv single chain antibody
  • the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gl Y 4 -Ser) 3 , such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VH and VL domains joined by the flexible linker (see, e.g., Bird et al., Science 242:423-426, 1988; Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988; McCafferty et al., Nature 348:552-554, 1990).
  • a cleavage site can be included in a linker, such as a furin cleavage site.
  • a single chain antibody may be monovalent, if only a single VH and VL are used, bivalent, if two VH and VL are used, or polyvalent, if more than two VH and VL are used.
  • Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope.
  • Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope, and/or to another molecule.
  • the antibodies described herein, or fragments thereof, may be recombinantly produced in prokaryotic or eukaryotic expression systems. These systems are well described in the art.
  • protein therapeutics are produced from mammalian cells.
  • the most widely used host mammalian cells are Chinese hamster ovary (CHO) cells and mouse myeloma cells, including NS0 and Sp2/0 cells.
  • CHO-K1 and CHO pro-3 Two derivatives of the CHO cell line, CHO-K1 and CHO pro-3, gave rise to the two most commonly used cell lines in large scale production, DUKX-X11 and DG44.
  • mammalian cell lines for recombinant antibody expression include, but are not limited to, COS, HeLa, HEK293T, U20S, A549, HT1080, CAD, P19, NIH 3T3, L929, N2a, HEK 293, MCF-7, Y79, SO-Rb50, HepG2, J558L, and BHK. If the aim is large- scale production, the most currently used cells for this application are CHO cells. Guidelines to cell engineering for mAbs production were also reported.
  • the invention provides an antibody, or antibody fragment, that is recombinantly produced from a mammalian cell-line, including a CHO cell-line.
  • the invention provides a composition comprising an antibody, or antibody fragment, wherein the antibody or antibody fragment was recombinantly produced in a mammalian cell-line, and wherein the antibody or antibody fragment is present in the composition at a concentration of at least 1, 10, 100, 1000 micrograms/mL, or at a concentration of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or 100 milligrams/mL.
  • the antibody composition comprises less than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 50, or 100 nanograms of host cell protein (i.e., proteins from the cell-line used to recombinantly produce the antibody)).
  • the antibody composition comprises less than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 ng of protein A per milligram of antibody or antibody fragment (i.e., protein A is a standard approach for purifying antibodies from recombinant cell culture, but steps should be done to limit the amount of protein A in the composition, as it may be immunogenic).
  • protein A is a standard approach for purifying antibodies from recombinant cell culture, but steps should be done to limit the amount of protein A in the composition, as it may be immunogenic.
  • U.S. Patent No. 7,458,704 Reduced protein A leaching during protein A affinity chromatography; which is hereby incorporated-by-reference.
  • the invention provides monoclonal antibodies.
  • the monoclonal antibodies are produced by a clone of B -lymphocytes.
  • the monoclonal antibody is a recombinant and is produced by a host cell into which the light and heavy chain genes of a single antibody have been transfected. Any suitable cell could be used for transfection and expression of the antibodies of the invention. Suitable cell lines include without limitation 293T cells or CHO cells.
  • Monoclonal antibodies are produced by any suitable method known to those of skill in the art.
  • monoclonal antibodies are produced by immortalizing B-cell expressing an antibody. Methods for immortalizing B-cells are known in the art, for example but not limited to using EBV transformation, treatment with various stimulants, and/or apoptotic inhibitors (Bonsignori et al. J. Virol. 85: 9998-10009, 2011).
  • monoclonal antibodies are produced by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells to make hybridomas.
  • monoclonal antibodies are identified from a subject, for example but not limited as described in Example 1 (Liao HX et al. J Virol Methods. 2009 Jun; 158(l-2): 171-9). The amino acid and nucleic acid sequences of such identified monoclonal antibodies can be determined.
  • the antibodies of the invention can be of any isotype.
  • the antibodies of the invention can be used as IgGl, IgG2, IgG3, IgG4, whole IgGl or IgG3s, whole monomelic IgAs, dimeric IgAs, secretory IgAs, IgMs as monomelic, pentameric or other polymer forms of IgM.
  • the class of an antibody comprising the VH and VL chains described herein can be specifically switched to a different class of antibody by methods known in the art.
  • the nucleic acid encoding the VH and VL can encode an Fc domain (immunoadhesin).
  • the Fc domain can be an IgA, IgM or IgG Fc domain.
  • the Fc domain can be an optimized Fc domain, as described in U.S. Published Patent Application No. 20100093979, incorporated herein by reference.
  • the immunoadhesin is an IgGl Fc.
  • the immunoadhesin is an IgG3 Fc.
  • the antibodies comprise amino acid alterations, or combinations thereof, for example in the Fc region outside of epitope binding, which alterations can improve their properties.
  • Fc modifications are known in the art. Amino acid numbering is according to the EU Index in Kabat.
  • the invention contemplates antibodies comprising mutations that affect neonatal Fc receptor (FcRn) binding, antibody half-life, and localization and persistence of antibodies at mucosal sites. See e.g. Ko SY et al., Nature 514: 642-
  • the antibodies comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via NK cells
  • AAA mutations containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4 th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid).
  • Other antibody mutations have been reported to improve antibody half-life or function or both and can be incorporated in sequences of the antibodies. These include the DLE set of mutations (Romain G, et al.
  • modifications such as but not limited to antibody fucosylation, may affect interaction with Fc receptors (See e.g. Moldt, et al. JVI 86(11): 66189-6196, 2012).
  • the antibodies can comprise modifications, for example but not limited to glycosylation, which reduce or eliminate polyreactivity of an antibody. See e.g. Chuang, et al. Protein Science 24: 1019-1030, 2015.
  • the antibodies can comprise modifications in the Fc domain such that the Fc domain exhibits, as compared to an unmodified Fc domain enhanced antibody dependent cell mediated cytotoxicity (ADCC); increased binding to Fc.gamma.RIIA or to Fc.gamma.RIIIA; decreased binding to Fc.gamma.RIIB; or increased binding to Fc.gamma.RIIB.
  • ADCC antibody dependent cell mediated cytotoxicity
  • antibodies of the invention including but not limited to antibodies comprising a CDR(s) of VH and/or VL chains, or antibody fragments of the inventive antibodies can be used as the HIV-1 binding arm(s) of a bispecific molecule, e.g. DARTS, diabodies, toxin labeled HIV-1 binding molecules.
  • a bispecific molecule e.g. DARTS, diabodies, toxin labeled HIV-1 binding molecules.
  • either the intact antibody or a fragment thereof can be used.
  • Either single chain Fv, bispecific antibody for T cell engagement, or chimeric antigen receptors can be used (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). That is, in non-limiting embodiments, intact antibody, a Fab fragment, a diabody, or a bispecific whole antibody can be used to inhibit HIV-1 infection in a subject (e.g., a human).
  • a bispecific F(ab) 2 can also be used with one arm a targeting molecule like CD3 to deliver it to T cells and the other arm the arm of the native antibody (Chow et al, Adv. Exp. Biol.
  • Toxins that can be bound to the antibodies or antibody fragments described herein include unbound antibody, radioisotopes, biological toxins, boronated dendrimers, and immunoliposomes (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)).
  • Toxins e.g., radionucleotides or other radioactive species
  • can be conjugated to the antibody or antibody fragment using methods well known in the art can be used.
  • the invention also includes variants of the antibodies (and fragments) disclosed herein, including variants that retain the ability to bind to recombinant Env protein, the ability to bind to the surface of virus-infected cells and/or ADCC- mediating properties of the antibodies specifically disclosed, and methods of using same to, for example, reduce HIV-1 infection risk.
  • Combinations of the antibodies, or fragments thereof, disclosed herein can also be used in the methods of the invention.
  • Antibodies of the invention and fragments thereof can be produced recombinantly using nucleic acids comprising nucleotide sequences encoding VH and VL sequences selected from those shown in the figures and examples.
  • the invention provides intact/whole antibodies.
  • the invention provides antigen binding fragments thereof. Typically, fragments compete with the intact antibody from which they were derived for specific binding to the target including separate heavy chains, light chains Fab, Fab', F(ab').sub.2, F(ab)c, diabodies, Dabs, nanobodies, and Fv. Fragments can be produced by recombinant DNA techniques, or by enzymatic or chemical separation of intact immunoglobulins.
  • the invention provides a bispecific antibody.
  • a bispecific or bifunctional/dual targeting antibody is an artificial hybrid antibody having two different heavy /light chain pairs and two different binding sites (see, e.g., Romain Rouet & Daniel Christ "Bispecific antibodies with native chain structure” Nature Biotechnology 32, 136-137 (2014); Garber
  • the bispecific antibody is a whole antibody of any isotype. In other embodiments it is a bispecific fragment, for example but not limited to F(ab) 2 fragment. In some embodiments, the bispecific antibodies do not include Fc portion, which makes these diabodies relatively small in size and easy to penetrate tissues.
  • the bispecific antibodies could include Fc region.
  • Fc bearing diabodies for example but not limited to Fc bearing DARTs are heavier, and could bind neonatal
  • the invention encompasses diabody molecules comprising an Fc domain or portion thereof (e.g. a CH2 domain, or CH3 domain).
  • the Fc domain or portion thereof may be derived from any immunoglobulin isotype or allotype including, but not limited to, IgA, IgD, IgG, IgE and IgM.
  • the Fc domain (or portion thereof) is derived from IgG.
  • the IgG isotype is IgGl,
  • the diabody molecule comprises an Fc domain, which Fc domain comprises a CH2 domain and CH3 domain independently selected from any immunoglobulin isotype (i.e. an Fc domain comprising the CH2 domain derived from IgG and the CH3 domain derived from IgE, or the CH2 domain derived from IgGl and the CH3 domain derived from IgG2, etc.).
  • the Fc domain may be engineered into a polypeptide chain comprising the diabody molecule of the invention in any position relative to other domains or portions of the polypeptide chain (e.g., the Fc domain, or portion thereof, may be c-terminal to both the VL and VH domains of the polypeptide of the chain; may be n-terminal to both the VL and VH domains; or may be N-terminal to one domain and c-terminal to another (i.e., between two domains of the polypeptide chain)).
  • the Fc domain, or portion thereof may be c-terminal to both the VL and VH domains of the polypeptide of the chain; may be n-terminal to both the VL and VH domains; or may be N-terminal to one domain and c-terminal to another (i.e., between two domains of the polypeptide chain)).
  • the present invention also encompasses molecules comprising a hinge domain.
  • the hinge domain be derived from any immunoglobulin isotype or allotype including IgA, IgD, IgG, IgE and IgM.
  • the hinge domain is derived from IgG, wherein the IgG isotype is IgGl, IgG2, IgG3 or IgG4, or an allotype thereof.
  • the hinge domain may be engineered into a polypeptide chain comprising the diabody molecule together with an Fc domain such that the diabody molecule comprises a hinge-Fc domain.
  • the hinge and Fc domain are independently selected from any immunoglobulin isotype known in the art or exemplified herein.
  • a polypeptide chain of the invention comprises a hinge domain, which hinge domain is at the C-terminus of the polypeptide chain, wherein the polypeptide chain does not comprise an Fc domain.
  • a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the C-terminus of the polypeptide chain.
  • a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the N-terminus of the polypeptide chain.
  • the invention encompasses multimers of polypeptide chains, each of which polypeptide chains comprise a VH and VL domain, comprising CDRs as described herein.
  • the VL and VH domains comprising each polypeptide chain have the same specificity, and the multimer molecule is bivalent and monospecific.
  • the VL and VH domains comprising each polypeptide chain have differing specificity and the multimer is bivalent and bispecific.
  • the polypeptide chains in multimers further comprise an Fc domain.
  • diabody molecules of the invention encompass tetramers of polypeptide chains, each of which polypeptide chain comprises a VH and VL domain.
  • polypeptide chain comprises a VH and VL domain.
  • two polypeptide chains of the tetramer further comprise an Fc domain.
  • the tetramer is therefore comprised of two ' heavier polypeptide chains, each comprising a VL, VH and Fc domain, and two lighter polypeptide chains, comprising a VL and VH domain.
  • tetravalent immunoglobulin-like molecule Interaction of a heavier and lighter chain into a bivalent monomer coupled with dimerization of the monomers via the Fc domains of the heavier chains will lead to formation of a tetravalent immunoglobulin-like molecule (exemplified in Example 6.2 and Example 6.3).
  • the monomers are the same, and the tetravalent diabody molecule is monospecific or bispecific. In other aspects the monomers are different, and the tetra valent molecule is bispecific or tetraspecific.
  • Formation of a tetraspecific diabody molecule as described supra requires the interaction of four differing polypeptide chains. Such interactions are difficult to achieve with efficiency within a single cell recombinant production system, due to the many variants of potential chain mispairings.
  • One solution to increase the probability of mispairings is to engineer "knobs-into-holes" type mutations into the desired polypeptide chain pairs. Such mutations favor heterodimerization over homodimerization.
  • an amino acid substitution (preferably a substitution with an amino acid comprising a bulky side group forming a ' knob ' , e.g., tryptophan) can be introduced into the CH2 or CH3 domain such that steric interference will prevent interaction with a similarly mutated domain and will obligate the mutated domain to pair with a domain into which a complementary, or accommodating mutation has been engineered, i.e., ' the hole ' (e.g., a substitution with glycine).
  • Such sets of mutations can be engineered into any pair of polypeptides comprising the diabody molecule, and further, engineered into any portion of the polypeptides chains of the pair.
  • the invention also encompasses diabody molecules comprising variant Fc or variant hinge-
  • Fc domains which variant Fc domain comprises at least one amino acid modification (e.g. substitution, insertion deletion) relative to a comparable wild-type Fc domain or hinge-Fc domain (or portion thereof).
  • Molecules comprising variant Fc domains or hinge-Fc domains (or portion thereof) normally have altered phenotypes relative to molecules comprising wild-type Fc domains or hinge-Fc domains or portions thereof.
  • the variant phenotype may be expressed as altered serum half-life, altered stability, altered susceptibility to cellular enzymes or altered effector function as assayed in an NK dependent or macrophage dependent assay.
  • Fc domain variants identified as altering effector function are known in the art. For example International Application WO04/063351, U.S. Patent Application Publications 2005/0037000 and 2005/0064514.
  • the bispecific diabodies of the invention can simultaneously bind two separate and distinct epitopes.
  • the epitopes are from the same antigen.
  • the epitopes are from different antigens.
  • at least one epitope binding site is specific for a determinant expressed on an immune effector cell (e.g. CD3, CD16, CD32, CD64, etc.) which are expressed on T lymphocytes, natural killer (NK) cells or other mononuclear cells.
  • an immune effector cell e.g. CD3, CD16, CD32, CD64, etc.
  • NK natural killer
  • diabody molecules of the invention may exhibit Ig-like functionality independent of whether they further comprise an Fc domain (e.g., as assayed in any effector function assay known in the art or exemplified herein (e.g., ADCC assay).
  • Fc domain e.g., as assayed in any effector function assay known in the art or exemplified herein (e.g., ADCC assay).
  • Non-limiting examples of bispecific antibodies can also be (1) a dual-variable-domain antibody (DVD-Ig), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage (Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-Ig.
  • DVD-Ig dual-variable-domain antibody
  • TM. Molecule, In: Antibody Engineering, Springer Berlin Heidelberg (2010)); (2) a Tandab, which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (3) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (4) a so called “dock and lock” molecule, based on the "dimerization and docking domain" in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to a different Fab fragment; (5) a so-called Scorpion molecule, comprising, e.g., two scFvs fused to both termini of a human Fc-region.
  • Examples of platforms useful for preparing bispecific antibodies include but are not limited to BiTE (Micromet), DART (MacroGenics) (e,g, US Patents 8,795,667; No. 2014-0099318; 2013-0295121; 2010- 0174053 and 2009-0060910; European Patent Publication No. EP 2714079; EP 2601216; EP 2376109; EP 2158221 and PCT Publications No.
  • BiTE Meromet
  • DART MicroGenics
  • the bispecific antibody comprises an HIV envelope binding fragment, for example but not limited to an HIV envelope binding fragment from any of the antibodies described herein.
  • the bispecific antibody further comprises a second antigen-interaction-site/fragment.
  • the bispecific antibody further comprises at least one effector domain.
  • the bispecific antibodies engage cells for Antibody-Dependent Cell- mediated Cytotoxicity (ADCC).
  • ADCC Antibody-Dependent Cell- mediated Cytotoxicity
  • the bispecific antibodies engage natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages.
  • the bispecific antibodies are T-cell engagers.
  • the bispecific antibody comprises an HIV envelope binding fragment and CD3 binding fragment.
  • CD3 antibodies are known in the art. See for example US Patent 8,784,821.
  • the bispecific antibody comprises an HIV envelope binding fragment and CD 16 binding fragment.
  • the invention provides antibodies with dual targeting specificity.
  • the invention provides bi-specific molecules that are capable of localizing an immune effector cell to an HIV-1 envelope expressing cell, so as facilitate the killing of the HIV-1 envelope expressing cell.
  • bispecific antibodies bind with one "arm” to a surface antigen on target cells, and with the second "arm” to an activating, invariant component of the T cell receptor (TCR) complex. The simultaneous binding of such an antibody to both of its targets will force a temporary interaction between target cell and T cell, causing activation of any cytotoxic T cell and subsequent lysis of the target cell.
  • the immune response is re-directed to the target cells and is independent of peptide antigen presentation by the target cell or the specificity of the T cell as would be relevant for normal MHC -restricted activation of CTLs.
  • CTLs are only activated when a target cell is presenting the bispecific antibody to them, i.e. the immunological synapse is mimicked.
  • bispecific antibodies that do not require lymphocyte preconditioning or co-stimulation in order to elicit efficient lysis of target cells.
  • BiTE bispecific T cell engager
  • BiTEs are tandem scFv molecules wherein two scFv molecules are fused by a flexible linker.
  • Further bispecific formats being evaluated for T cell engagement include diabodies (Holliger et al., Prot Eng 9, 299-305 (1996)) and derivatives thereof, such as tandem diabodies (Kipriyanov et al., J Mol Biol 293, 41-66 (1999)).
  • DART dual affinity retargeting molecules are based on the diabody format that separates cognate variable domains of heavy and light chains of the two antigen binding specificities on two separate polypeptide chains but feature a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011)).
  • the invention also contemplates Fc-bearing DARTs.
  • triomabs which are whole hybrid mouse/rat IgG molecules and also currently being evaluated in clinical trials, represent a larger sized format (reviewed in Seimetz et al., Cancer Treat Rev 36, 458-467 (2010)).
  • the invention also contemplates bispecific molecules with enhanced pharmacokinetic properties.
  • such molecules are expected to have increased serum half-life.
  • these are Fc-bearing DARTs (see supra).
  • such bispecific molecules comprise one portion which targets HIV- 1 envelope and a second portion which binds a second target.
  • the first portion comprises VH and VL sequences, or CDRs from the antibodies described herein.
  • the second target could be, for example but not limited to an effector cell.
  • the second portion is a T-cell engager.
  • the second portion comprises a sequence/paratope which targets CD3, CD16, or another suitable target.
  • the second portion is an antigen-binding region derived from a CD3 antibody, optionally a known CD3 antibody.
  • the anti-CD antibody induce T cell- mediated killing.
  • the bispecific antibodies are whole antibodies. In other embodiments, the dual targeting antibodies consist essentially of Fab fragments. In other embodiments, the dual targeting antibodies comprise a heavy chain constant region (CHI . In certain embodiments, the bispecific antibody does not comprise Fc region. In certain embodiments, the bispecific antibodies have improved effector function. In certain embodiments, the bispecific antibodies have improved cell killing activity.
  • CHI heavy chain constant region
  • the invention provides human, humanized and/or chimeric antibodies.
  • the invention provides a pharmaceutical composition comprising an antibody of the invention wherein the composition is used for therapeutic purposes such as but not limited to prophylaxis, treatments, prevention, and/or cure.
  • the invention provides a pharmaceutical composition comprising an antibody of the invention in combination with any other suitable antibody.
  • the pharmaceutical compositions comprise nucleic acids which encode the antibodies of the invention. In certain embodiments, these nucleic acids can be expressed by any suitable vector for expression of antibodies. Non- limiting examples include attenuated viral hosts or vectors or bacterial vectors, recombinant vaccinia virus, adenovirus, adeno-associated virus (AAV), herpes virus, retrovirus,
  • cytomegalovirus or other viral vectors can be used to express the antibody.
  • compositions include excipient suitable for a biologic molecule such as the antibodies of the invention.
  • the antibodies could be produced in specific cell lines and conditions so as to control glycosylation of the antibody.
  • the antibody framework for example, could comprise specific modification so as to increase stability of the antibody.
  • the invention provides that the antibodies, and fragments thereof, described herein can be formulated as a composition (e.g., a pharmaceutical composition).
  • a composition e.g., a pharmaceutical composition.
  • Suitable compositions can comprise an inventive antibody (or antibody fragment) dissolved or dispersed in a pharmaceutically acceptable carrier (e.g., an aqueous medium).
  • the compositions can be sterile and can be in an injectable form (e.g. but not limited to a form suitable for intravenous injection, intramascular injection).
  • the antibodies (and fragments thereof) can also be formulated as a composition appropriate for topical administration to the skin or mucosa.
  • Such compositions can take the form of liquids, ointments, creams, gels and pastes.
  • the antibodies (and fragments thereof) can also be formulated as a composition appropriate for intranasal administration.
  • the antibodies (and fragments thereof) can be formulated so as to be administered as a post-coital douche or with a condom. Standard formulation techniques can be used in preparing suitable compositions.
  • the antibody (and fragments thereof), described herein have utility, for example, in settings including but not limited to the following:
  • the antibodies described herein (or fragments thereof) in the setting of anticipated known exposure to HIV-1 infection, the antibodies described herein (or fragments thereof) and be administered prophylactically (e.g., IV, topically or intranasally) as a microbiocide,
  • the antibodies described herein (or fragments thereof) can be administered as post-exposure prophylaxis, e.g., IV or topically, and iii) in the setting of Acute HIV infection (AHI), the antibodies described herein (or fragments thereof) can be administered as a treatment for AHI to control the initial viral load or for the elimination of virus-infected CD4 T cells.
  • AHI Acute HIV infection
  • the antibodies (or antibody fragments) described herein can be administered prior to contact of the subject or the subject's immune system/cells with HIV-1 or within about 48 hours of such contact. Administration within this time frame can maximize inhibition of infection of vulnerable cells of the subject with HIV-1.
  • various forms of the antibodies described herein can be administered to chronically or acutely infected HIV patients and used to kill remaining virus infected cells by virtue of these antibodies binding to the surface of virus infected cells and being able to deliver a toxin to these reservoir cells.
  • Suitable dose ranges can depend on the antibody (or fragment) and on the nature of the formulation and route of administration. Optimum doses can be determined by one skilled in the art without undue experimentation. For example but not limited, doses of antibodies in the range of 0.1-50 mg/kg, 1-50 mg/kg, 1-10 mg/kg, 1, 1.25, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg/kg of unlabeled or labeled antibody (with toxins or radioactive moieties) can be used.
  • the antibodies of the invention can be administered at a suitable fixed dose, regardless of body size or weight. See Bai et al. Clinical Pharmacokinetics February 2012, Volume 51, Issue 2, pp 119-135.
  • the invention provides use of the antibodies of the invention, including bispecific antibodies, in methods of treating and preventing HIV-1 infection in an individual, comprising administering to the individual a therapeutically effective amount of a composition comprising the antibodies of the invention in a pharmaceutically acceptable form.
  • the methods include a composition which includes more than one HIV-1 targeting antibody.
  • the HIV-1 targeting antibodies in such combination bind different epitopes on the HIV-1 envelope.
  • such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased killing of HIV-1 infected cells.
  • such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased breadth in recognition of different HIV-1 subtypes.
  • the composition comprising the antibodies of the invention alone or in any combination can be administered via EVI, subcutaneous, or IV delivery, or could be deposited at mucosal sites, such as the oral cavity to prevent maternal to child transmission, the rectal space or the vagina as a microbicide.
  • the antibodies can be administered locally in the rectum, vagina, or in the oral cavity, and can be formulated as a microbiocide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525.; Multipurpose prevention technologies for reproductive and sexual health. Stone A. Reprod Health Matters. 2014 Nov;22(44):213-7.
  • antibodies can be formulated such that the therapeutic antibody or combination thereof is impregnated on a vaginal ring (Chen Y et al. Drug Des. Devel. Ther 8: 1801-15, 2014;Malcolm RK et al BJOG 121 Suppl 5: 62-9, 2014). Antibodies can be administered alone or with anti-retroviral drugs for a combination microbicide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525).
  • the antibodies can be administered in complex with a form of HIV Env, optimally gpl20, but also an Env trimer, to enhance Env immunogenicity.
  • the antibodies can be delivered by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447).
  • the antibodies can be administered in viral vector, for example but not limited to adenoassociated viral vector, for expression in muscle and plasma.
  • antibodies with different binding specificities are combined for use in pharmaceutical compositions and therapeutic methods.
  • CD4 binding site antibodies are combined with V3 antibodies, MPER antibodies and so forth.
  • Figures 2, 3, and 4 show a selection of potent HIV-1 neutralizing antibodies which can be used in pharmaceutical compositions, and therapeutic methods.
  • Non-limiting examples of selections of combinations of certain antibodies include: DH542, DH542 L4, DH542 QSA, DH429 and DH512 (or any of the DH512 variants); DH512 and CH31 (See US Publication20140205607); DH512 (or any of the DH512 variants ) and DH540 (See Example 9, and this antibody will be described elsewhere); DH542, DH542 L4, DH542 QSA, DH429, DH512 and DH540; DH542, DH542 L4,
  • a combination therapy envisions a composition which combines various antibodies.
  • a combination therapy is provided wherein antibodies are administered as individual compositions, for example at different times, by different means, or at administered at different locations.
  • a combination therapy is provides wherein a therapeutic antibody or antibodies is combined with other therapeutic means, for example anti-retroviral drug cocktails, or drugs which activate latently infected HIV-1 cells.
  • the disclosed antibodies or antigen binding fragments thereof are used to determine whether HIV-1 envelope(s) is a suitable antigen for inclusion in a vaccine composition.
  • the antibodies can be used to determine whether an antigen in a vaccine composition including gpl20 assumes a conformation including an epitope bound by the inventive antibodies or fragments thereof.
  • This can be readily determined by a method which includes contacting a sample containing the vaccine, such as a gpl20 antigen, with a disclosed antibody or antigen binding fragment under conditions sufficient for formation of an immune complex, and detecting the immune complex, to detect an HIV-1 antigen including an epitope of an inventive antibody in the sample.
  • the detection of the immune complex in the sample indicates that vaccine component, such as a HIV-1 Env antigen assumes a conformation capable of binding the antibody or antigen binding fragment.
  • Example 1 Isolating antibodies from natural HIV-1 infected individuals
  • PCR on these cells is carried out according to the protocol in Liao HX et al. J. Virol.
  • VH and VL genes are selected and made in linear cassettes (essentially as described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009, see for example Figure 1, Section 3.3) to produce recombinant monoclonal antibodies by transient transfection, e.g. in 293T cells.
  • Recombinant antibodies are grown and supernatants and/or purified antibodies are functionally characterized.
  • Pairs of VH and VL genes as selected above can also be used to produce plasmids for stable expression of recombinant antibodies.
  • the plasmids or linear constructs for recombinant antibody expression also comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via K cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4 th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid).
  • the antibodies of the invention were selected based on a combination of criteria including sequence analyses, and functional analyses including but not limited as neutralization breadth, and potency.
  • the antibodies of the invention comprise naturally rearranged VH and VL fragment pairs, wherein the rest of the Ig gene is not naturally occurring with the identified rearranged VH and VL fragments. In certain embodiments, the antibodies of the invention are recombinantly produced.
  • Example 2 TZM-bl cells pseudo-viruses neutralization assay
  • TZMbl neutralization assay is a standard way to evaluate antibody breadth and potency. See Montefiori, D. Methods Mol Biol. 2009;485:395-405; HIV-1 Env-pseudoviruses infection of TZM-bl cells. Exemplary pseudovirus neutralization assays and panels of HIV-1 pseudovirus are described for example, in Li et al., J Virol 79, 10108-10125, 2005, Seaman et al, J. Virol., 84: 1439-1452, 2010; Sarzotti-Kelsoe et al., J. Immunol. Methods, 409: 131-46, 2014; and
  • WO2011/038290 each of which is incorporated by reference herein.
  • Various HIV-1 isolates, both Tier 1 and Tier 2 viruses can be included in this assay.
  • the TZMbl assay was conducted to determine neutralization potency and breadth of the various antibodies of the invention on different HIV-1 pseudoviruses.
  • Figure 27A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC50 in ⁇ g/ml.
  • Figure 27B shows the mean IC50 and percent of isolates neutralized at different IC50 values.
  • Figure 28A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC80 in ⁇ g/ml.
  • Figure 28B shows the mean IC80 and percent of isolates neutralized at different
  • Binding and/or neutralization assays using various envelop antigens can be used to determine the envelop epitope recognized by these antibodies.
  • Kd measurements of antibody binding to HIV-1 envelope will be determined by Surface Plasmon Resonance measurements, for example using Biacore, or any other suitable technology which permits detection of interaction between two molecules in a quantitative way.
  • AtheNA Multi- Lyte ANA Plus Test System is one such assay. This is luminex-based assay, which is also used to screen patient sera. In our experiments the criteria for positivity is as follows: an antibody is positive for autoreactivity if reactive at 25 ⁇ g/ml.
  • Table 4 Summary of immunoflourescent (IF) staining of Hep2 cells data for antibodies DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
  • IF immunoflourescent
  • Table 5 Summary of Athena data for DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
  • CH557 is a potent and extremely broad CD4 mimic CD4bs bnAb
  • UCA CH235 antibody lineage
  • IA4, IA3, IA2, IA1, CH235, CH236, CH239, CH240 and CH241 reactivity against autoantigens developed among early CH235 lineage members with maturation.
  • Table 6 Summary of Athena assay results for CH557. Results are expressed as relative luminescence units. Readings ⁇ 100 are considered negative, results between 100 and 120 are considered “indeterminate” and results >120 are considered positive. CH557 is negative for all the antigens tested at all antibody concentrations ranging from 6.25 ug/ml to 50 ug/ml.
  • Table 7 Summary of Athena assay results for various other antibodies of the CH235 lineage. Results are expressed as relative luminescence units. Readings ⁇ 100 are considered negative, results between 100 and 120 are considered “indeterminate” and results >120 are considered positive. CH236, CH239, CH235 IA1 and IA2 are positive for multiple antigens.
  • Table 8 Summary of ELISA cardiolipin assay results for CH557 and various other antibodies. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm (OD450). OD450 ⁇ 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. CH557 did not bind to cardiolipin.
  • Table 9 Summary of binding of listed antibodies to cardiolipin in ELISA. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm (OD450). OD450 ⁇ 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. The majority of CH235 lineage antibodies, with the exception of CH235 IA3, IA4, CH235 and CH240 (the former has borderline binding), bound to cardiolipin.
  • DH493 also referred as CH493
  • DH491 also referred as CH491
  • Monoclonal antibody CH493 was designed as follows: the heavy chain VDJ rearrangement was derived from genomic DNA deep sequencing performed on memory B cells isolated from PBMCs of the 703-01-050-5 subject (CHAVIOOl protocol) obtained 152 weeks post-infection. Other V-heavy chain VDJ rearrangement sequences were retrieved with this technology from multiple time points. Figure 20 shows the heavy chain phylogenetic tree including all the sequences retrieved with deep sequencing (in black: all except for CH240, CH239, CH235, CH236, CH241). V-light chains were not identified.
  • Figure 20 shows the heavy chain phylogenetic tree including all the sequences retrieved from RNA of cultured memory B cells isolated from PBMCs obtained 41 weeks post-infection (in red: CH240, CH239, CH235, CH236, CH241). V-light chains of these antibodies from cultures were also identified.
  • V-heavy VDJ rearrangements identified from deep sequencing and they are called CH490, CH491, CH492 and CH493. These V-heavy sequences were chosen because they are the most mutated.
  • the V-heavy chains were paired with the V-light chains of the antibodies identified from memory B cell cultures that are closest in the phylogenetic tree shown above. Therefore, CH491 and CH493 heavy chains were paired with CH236 light chain, while CH490 and CH492 heavy chains were paired with the CH241 light chain,
  • CH235 antibodies from week 41 are characterized by their inability to bind and neutralize CH505.TF envelope mutants with specific point mutations in the D loop (Gao, Bonsignori, Liao et al. Cell 158, 481-491, July 31, 2014, see also U.S. Provisional Application No. 62/027,427 filed July 22, 2014, and U.S. Provisional Application No. 61/972,531 filed March 31, 2014).
  • FIG. 21 shows that CH493 restores almost completely the ability to bind the mutants not recognized by the early members of the lineage, indicating that this antibody is not constrained by the amino acid makeup of the D loop as tightly as the naturally occurring CH235 early lineage antibodies. CH493 still retained differential binding to the CH505.TF gpl20 delta 3711 mutant. Binding dependence to 1371 is a hallmark of neutralizing CD4bs antibodies.
  • CH493 neutralized 20 of 24 tier-2 HIV-1 viruses (83%) in a multiclade virus panel optimized to represent diversity among globally circulating viruses.
  • Naturally occurring antibodies in the same lineage neutralized only 25% of the viruses in the same panel and other engineered antibodies neutralized max 46% (Figure 22).
  • CH235, CH236, CH239, CH240 and CH241 are all Abs with natural pairs VH and VL from week 41 of infection of CH505 individual.
  • CH241 is the most mutated at ⁇ 11 %.
  • CH490, CH491, CH492 and CH493 are antibodies which comprise VH chains identified by deep sequencing and are near 20% mutated. These VH chains were paired with VL chains from the closest natural pair antibodies. So in the natural tree, CH241 is the most mutated from week 41 and it hit 38% of isolates.
  • CH490 and CH492 VH from 454 were paired with CH241 VL.
  • CH491 and CH493 VH from 454 were paired with CH236 VL. Pairing was done with the observed VL that was closer to the 454 sequence in the phylogenetic tree.
  • VH chains source CH490 is from week 66; CH491 and CH492 are from week 100; CH493 is from week 152. The heavy chains were selected because were the most mutated ones.
  • Example 7 Antibodies from CH235 lineage
  • CH505 transmitted/founder (CH505.TF) gpl20 Env-specific memory B cells were isolated from 20 million PBMCs using fluorescent-activated single cell sorting (FACS) collected from chronically HIV-1 infected African CHAVI subject 703-01-050-5 264 and 323 weeks postinfection (10 million PBMCs/timepoint). Viable memory B cells were defined as Aqua Vital Dye neg, CD16neg, CD14neg, CD3neg, CD19pos, IgDneg cells.
  • FACS fluorescent-activated single cell sorting
  • Sorted cells were cultured overnight in RPMI + 10%FCS supplemented with 2.5 ug/mL ODN2006, 2.5 ug/mL CHK2-inhibitor, 50ng/mL rHu IL-21 and 1 : 1 EBV-containing supernatants in a 96-well plates well containing 5000 CD40L-expressing MS40L feeder cells. Cells were then plated at limiting dilution in 96-well plates containing feeder cells, 2.5 ug/mL ODN2006, 2.5 ug/mL CHK2-inhibitor and 50ng/mL rHu IL-21, and cultured for 14 days, with medium refresh at days 3, 7 and 10.
  • CH557 was identified from memory B cells collected 323 weeks post-infection. CH557 is a member of the previously described CH235 clonal lineage (Gao, Bonsignori, Liao et al. Cell 2014. Jul 31; 158(3):481-91). From the same experiment we also identified monoclonal antibodies CH555, CH556 and CH558 - all members of the CH235 clonal lineage. All monoclonal antibodies but CH555, which was identified from memory B cells collected 236 weeks post-infection, are from week 323 post-infection.
  • Example 8 Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody
  • CD4bs CD4-binding site
  • V H -gene restricted classes arise from two highly similar V H -genes: V H l-2 and V H l-46 (Scheid et al., 2011; Wu et al., 2011). V H l-2*02 and V H 1-46*01 share 93.4% (269/288) nucleotide sequence identity. Both classes give rise to antibodies that recognize the CD4bs via VH structural mimicry of the immunoglobulin-like N-terminal domain of CD4 (Zhou et al., 2010; Zhou et al., 2015).
  • V H l-2 gene-derived antibodies analysis of their ontogeny suggests two roadblocks based on: (i) a requirement for high levels of SHM (Klein et al., 2013; Scheid et al., 2009; Scheid et al., 2011; Wu et al., 2010), and (ii) weak binding of the inferred unmutated common ancestor (UCA) to gpl20 (Jardine et al., 2013; McGuire et al., 2013; Scheid et al., 2011; Wu et al., 2011; Zhou et al., 2010; Zhou et al., 2015), although a definitive analysis from time-of-infection had not yet provided detail.
  • V H l-46-derived antibodies far less is known.
  • V H 1-46- and V H l-2-derived CD4-mimic antibodies the unique genetic mutability inherent in each of these two V H -germline genes helps to direct maturation, potentially providing an explanation for the prevalence of effective CD4bs antibodies derived from these two germline genes.
  • CH235 lineage antibodies represented 0.018% of the total memory B cell repertoire and 0.5% of the CH505 TF gpl20-specific memory B cell population.
  • the CH235 lineage could be separated into three clades (clade I, II and III).
  • Clade I showed a number of early lineage members, but no additional clade I sequences were observed after wk 30;
  • clade II showed further development and included members CH241 (wk 41) and CH235.6 (wk 66), but no additional sequences were observed after wk 66;
  • clade III developed through wk 323 and included antibodies CH235 (wk 41), CH235.9 (wk 152), and CH235.12 (wk 323) (Figure 29A).
  • V H 1-2 is genetically the most closely related germline gene to V H 1-46
  • we also examined the mutability of the V H 1-2 gene ( Figure 31C, bottom). Consistent with V H 1-46 antibodies, the mutated positions among V H 1-2 derived bnAbs also showed high frequency of mutation among non-HIV-1 targeting V H l-2 antibodies, suggesting that gene mutability contributes to V H 1-2 derived HIV-1 antibody evolution.
  • the average mutability of the V H 1-2 gene at positions where the CH235 antibody showed SHM was generally high: 9 of 15 positions mutated in CH235 antibody were also mutated in more than 15% of V H l-2-derived NGS reads.
  • V H l-2-derived bnAbs In 10 of these 15 positions, the mature V H l-2-derived bnAbs (VRCOl, VRC-CH31 and VRC-PG04) also showed changes.
  • V H 1-69, V H 3-23, V H 3-30, and V H 4-59 Zahou et al., 2015
  • Figure 38D we observed gene mutability patterns different from that of V H 1-46 while, in contrast, the mutability patterns of V H 1-2 and V H 1-46 were more similar (Figure 43C).
  • V H l-2 and V H l-46 germline genes-derived bnAbs somatic mutations that lead to neutralization breadth appeared to be primarily determined by the intrinsic mutability of V H 1-46 and V H 1-2 germline genes.
  • the differences in the intrinsic mutabilities of these V H genes may contribute to the high occurrence of CD4bs bnAbs that originate from either V H 1-2 or V H 1-46 (Zhou et al., 2015).
  • Affinity maturation in germinal centers is subjected to kinetic selection and involves improvement in dissociation rate constant (K d ) that is often driven by an improvement in the kinetic association rate (k a ), which is a key variable in conferring a binding advantage for the cognate epitope to an antibody over other competing antibodies (Foote and Milstein, 1991; Kepler et al., 2014).
  • the k a and dissociation kinetic rate (k d ) of the CH505 TF gpl20 Env binding by CH235 and CHI 03 was measured with SPR to identify differences that might explain the relative inability of the CH235 lineage to block the binding of the CHI 03 lineage bnAbs to autologous CH505 TF Env and found that the two lineages followed two distinct trajectories and modalities to increase their overall affinity.
  • Late CH235 lineage broadly neutralizing antibodies neutralize autologous loop D escape viruses selected by early CH235 lineage members.
  • CH235.9, CH235.12 and CH235.13 neutralized CH505 TF gpl20 M8, M20 and M21 (not neutralized by early lineage member CH236), which differed from CH505 TF gpl20 M6 and M10 (neutralized by CH236) by a single mutation at position 280 (N280S for M8 and M20, and N280T for M21) ( Figure 33B).
  • CH235.9 bnAb residue N30 contacts R429 in the ⁇ 20- ⁇ 21 loop of the C4 region of gpl20 Env, which is on the opposite face of the CD4bs from loop D ( Figure 33C).
  • CH505 TF has a glutamic acid in position 429 that is in close enough proximity to N30 to form a hydrogen bond.
  • CH235 lineage antibodies were tested for binding to 113 recombinant CH505 gpl20 Env isolated from time of transmission to wk 160 post-transmission, including CH505 TF loop D mutant Envs ( Figure 34A and Figure 47).
  • CH235.9 and CH235.12 bound to 4/22 and 8/22 Envs isolated from wk 136 and 160 post-transmission, respectively, including Envs from viruses that were also neutralized.
  • Env binding to the initial members of the CHI 03 lineage has previously been reported (Hraber et al., 2015), and described herein is the same Env binding analysis of the CH103 lineage with 10 additional matured bnAb members of the CH103 lineage ( Figure 34A and Figure 47).
  • CH235.12 is a potent and extremely broad CD4-mimic CD4bs bnAb
  • Most CH235 lineage antibodies displayed reactivity against DNA and sporadic reactivity with Scl70 (CH235.7) ( Figure 35A).
  • In Hep-2 IF staining CH236, CH235.7 and CH235.9 were all cytoplasmic positive (Figure 35C).
  • CH235.12 despite being highly mutated and broadly neutralizing, did not display autoreactivity in any of these assays ( Figure 35A-C)
  • CH235 lineage antibodies including CH235.12, did not react with UBE3A ( Figure 35D).
  • CH235.12 as an antibody that has developed neutralization breadth without being itself auto- and polyreactive, while less mutated precursor antibodies (CH235 is in the same clade of CH235.12) did develop autoreactivity. Therefore, in vivo decoupling of neutralization breadth of CD4 mimic CD4bs bnAbs from auto- and polyreactivity can occur, even for bnAb lineages that have developed autoreactivity during the course of their maturation and, therefore, inducing such bnAbs from such lineages through vaccination, though difficult, is an achievable goal.
  • V H 1-46 8ANC131-like and V H 1-2 VRCOl family CD4 supersite bnAbs demonstrates dramatic convergence of antibody structures to recognize the CD4 supersite.
  • the CH235 lineage required over 20% SHM in heavy chain variable domain to achieve 90% breadth.
  • SHM high-gene SHM
  • the CH235 lineage Ab that became broadly neutralizing acquired the ability to neutralize loop D mutants selected by early Ab lineage members (Gao et al., 2014) with a mechanism involving a compensatory mutation (T30N) in CDR HI, which allowed the formation of H-bonds with the HIV-1 gpl20 C4 region, thus correcting the original loss of binding.
  • Donor and sample information was previously reported (Liao et al., 2013) and is summarized in Supplemental Experimental Procedures. Memory B cell cultures were performed on PBMCs collected at 264 and 323 wks post-transmission. All work related to human subjects was in compliance with Institutional Review Board protocols approved by the Duke University Health System Institutional Review Board.
  • Neutralization assays Neutralization of donor CH235 mAbs were measured using single- round-of-infection HIV-1 Env pseudovimses and TZM-bl target cells as described in Supplemental Experimental Procedures.
  • Neutralization signature Antibody neutralization signatures were computed and compared as described in Supplemental Experimental Procedures.
  • Focused maturation and conformity analysis Focused maturation and conformity analysis are described in the Supplemental Experimental Procedures.
  • Direct-Binding ELISA were performed as described in
  • Loop D mutations were structurally modeled using PyMOL with sidechains placed in the most frequently observed rotamer that did not result in steric clashing with neighboring residues. Hydrogen bonds were calculated using HBPLUS software (McDonald and Thornton, 1994).
  • HIV-1 proteins HIV-1 genes of autologous CH505 Env were determined from samples collected from 4 to 323 wks post-infection by single genome amplification (Keele et al., 2008) and produced as described in (Liao et al., 2013).
  • Protein Array MAbs were screened for binding on protein microarrays (ProtoArray) (PAH0525101; Invitrogen) pre-coated with 9,400 human proteins in duplicate and screened following manufacturer's instructions and as described in (Liu et al., 2015; Yang et al., 2013).
  • HEp-2 cell staining Indirect immunofluorescence binding of mAbs or plasma to HEp-2 cells (Zeuss Scientific) was performed as previously described (Bonsignori et al., 2014; Haynes et al., 2005).
  • the time of infection was estimated by analyzing the sequence diversity in the first available sample using the Poisson Fitter tool (Giorgi et al., 2010) as described in (Liao et al., Nature 2013). Results were consistent with a single founder virus establishing the infection and with the earliest isolated virus sequences being taken 4 weeks post-transmission.
  • HIV-1 CH505.TF gpl20 envelope glycoprotein was produced and used in flow cytometry on PBMC collected from donor CH505 at week 264 and 323 post-transmission using a two-color technique as described (Gray et al., 2011).
  • CH505.TF gpl20 Env-positive memory B cells were cultured as described (Bonsignori et al., 2011) with the following modifications: non-irradiated MS40L cells were used as feeder cells at a concentration of 3,000 cells/well and were added to wells in which memory B cells were sorted in bulk; 50 ng/ml of recombinant human (rHu) IL-21 (200-21; Peprotech, Rocky Hill, NJ) were added to the complete medium; memory B cells were distributed by limiting dilution at a calculated concentration of 2 cells/well; culture medium was refreshed every 5 days.
  • rHu recombinant human
  • MAbs CH235.10 through CH235.13 were identified from cultures that displayed differential binding of CH505.TF and CH505 TF ⁇ 371 ⁇ gpl20 Env, did not bind to RSC3 (Gao et al., 2014) and neutralized 13 to 99% CH505.TF infectivity.
  • Antibody heavy chain gene rearrangements were PCR amplified from 6 independent lOOng genomic DNA aliquots to generate 6 barcoded libraries per sample. Multiplexed primers complementary to the IGHV FR1 or FR2 framework regions, and an IGHJ-primer were modified from the BIOMED-2 consortium primers (Boyd et al., 2009; van Dongen et al., 2003). 10- nucleotide 'barcode' sequences in the primer sets encoded sample identity and replicate library identity.
  • AmpliTaq Gold (Roche) enzyme was used for PCR following the manufacturer's instructions, with a thermocycler program: 94°C 5 min; 35 cycles of (94°C 30 sec, 60°C 45 sec, 72°C 90 sec); and final extension at 72°C for 10 min. Following quantitation, PCR products from each replicate library were pooled in equimolar amounts, then the pooled library was run on a 1.5% agarose gel and gel extracted (Qiagen). High-throughput sequencing was performed on the 454 (Roche) platform using Titanium chemistry.
  • Immunoglobulin genes of mAbs CH235.10 through CH235.13 were amplified from RNA from isolated cells, expression cassettes made, and mAbs expressed as described (Gao et al. 2014).
  • V H genes of mAbs CH235.6 through CH235.9 were retrieved from sequences obtained through genomic DNA 454 sequencing, which were restored to full length and complemented with the V L of the phylogenetically closest identified antibody in the CH235 lineage (i.e. CH241 for CH235.6 and CH235.8, and CH236 for CH235.7 and CH235.9).
  • CH241 for CH235.6 and CH235.8, and CH236 for CH235.7 and CH235.9 We have previously described the isolation of mAbs CH235, CH236, CH239, CH240 and CH241and the inference of unmutated common ancestor (UCA) and intermediate antibodies IA1 through IA4 (Gao et al., 2014; Kepler, 2013).
  • Heavy chain plasmids were co-transfected with appropriate light chain plasmids at an equal ratio in Expi 293 cells using either 293Fectin or ExpiFectamine 293 transfection reagents (Thermo).
  • AbBooster antibody expression enhancer media (ABI Scientific) at 10% of the final culture volume 24 h after transfection. . Cultures were then incubated at 33°C for 5 more days, and supernatants were harvested and passed over a protein A affinity column. Following PBS wash and low pH elution, the pH of eluate was neutralized with lMTris pH 8.5 and samples were dialyzed against PBS. Antibodies were then aliquoted and stored at -80°C prior to use. Alternatively, for
  • ExpiFectamine transfections we used the enhancer provided with the kit, transfected cultures were incubated at 37°C 8% C0 2 for 2-6 days, harvested, concentrated and incubated overnight with Protein A beads at 4°C on a rotating shaker before loading the bead mixture in columns for purification; following PBS/NaCl wash, eluate was neutralized with trizma hydrochloride and antibody concentration was determined by Nanodrop. Purified antibodies were tested in SDS-Page Coomassie and western blots, and stored at 4°C.
  • Direct-binding ELISAs were performed as described previously (Bonsignori et al., 2011) with the following modifications: plates were blocked for 1 h at room temperature (RT) or overnight at 4°C (both procedures were previously validated); primary purified antibodies were tested at a starting concentrations of 100 ⁇ g/ml, serially three-fold diluted and incubated for 1 h at RT; FIRP-conjugated human IgG antibody was added at optimized concentration of 1 :30,000 in assay diluent for 1 hour and developed using TMB substrate; plates were read at 450 nm in a SpectraMax 384 PLUS reader (Molecular Devices, Sunnyvale, CA); results are reported as logarithm area under the curve (LogAUC) unless otherwise noted.
  • SSB All from Immuno Vision
  • centromere B Prospec
  • All plasma antibody positive controls were purchased from Immuno Vision; lot-specific optimal ranges for standard curves were determined. All antibodies were tested using the same lots for each antigen and positive controls with the protocol described above.
  • DNA ELISA plates were coated with 2 ⁇ g/ml poly-lysine (Sigma-Aldrich) for 2 h at RT, washed 3X with PBS and blocked with PBS/2%BSA/0.05% Tween- 20 for 2h at RT.
  • DNA (LS002195, Worthington) in saline sodium citrate buffer was added for 1 h, washed and antibodies were incubated for 1 h. Secondary antibody was diluted in PBS/0.05% Tween-20. Plates were developed for 30 min. Human recombinant monoclonal antibody Ab008391 (courteously provided by David Easterhoff, Duke Human Vaccine Institute) was used as positive control. For all autoantigen ELISAs, palivizumab was used as negative control.
  • Anti-cardiolipin ELISA was performed using the QUANTA Lite AC A IgG III kit (708625; INOVA Diagnostics) following manufacturer's protocol.
  • Dendrograms were calculated using the neighbor-joining method, showing the protein sequence distance from the HIV-1 Env gpl60 sequences of 190 HIV-1 primary isolates.
  • the clades of HIV-1, including circulating recombinant forms (CRFs) are indicated.
  • the Spearman correlation coefficients for all pairs of antibody neutralization fingerprints were then computed, transforming the antibody-virus neutralization matrix into an antibody-antibody correlation matrix. This correlation matrix was then input into a hierarchical clustering procedure as a way to visualize the similarities between the neutralization fingerprints for the different antibodies. The distances in the resulting tree are thus a function of the differences between fingerprints.
  • HIV-1 gpl20 protein from clade AE 93TH057 and antibodies of CH235, CH235.9 and CH235.12 were produced and purified as described previously (Zhou et al., 2010).
  • Fab fragments of antibodies were prepared by digesting purified IgG with Lys-C at 37°C for 2-4 h. The digestion reaction was quenched by the addition of cOmplete protase inhibitors (Roche). The digested antibodies were passed over Protein A agarose to remove the Fc fragment. The Fab was further purified over a Superdex 200 gel filtration column and concentrated aliquots were stored at -80 °C.
  • the gpl20-antibody complexes were formed by mixing deglycosylated gpl20 with the antibody Fab in a 1 : 1.5 molar ratio.
  • the complexes were purified by size exclusion
  • cryoprotectant The 93TH057 core e gpl20-CH235.12 complex was crystallized with a reservoir solution of 10% PEG 8000, 20% PEG 400 and 100 mM HEPES, pH7.5 and was flash frozen in mother liquor supplemented with an additional 15 - 20% PEG 400 as a cryoprotectant.
  • the 93TH057 core e -CH235.12 structure was refined to a final Rfree value of 23% with 97.0% residues in the favored region of the Ramachandran plot, and 0.1% outliers. All figures containing representations of the protein crystal structures were made with PyMOL. Gpl20 and antibody interactions were analyzed with the PISA server.
  • each antibody was captured on an anti-human IgFc immobilized sensor surface (200-500RU) and gpl20 proteins at varying concentrations were injected to monitor association and dissociation phases. Buffer reference and non-specific binding to a control antibody (palivizumab) captured surface were used to derive specific binding signals.
  • Kinetic rate constants and dissociation constant (Kd) were derived from global curve fitting analysis using a Langmuir 1 : 1 interaction model using the BIAevaluation 4.1 software (GE Healthcare).
  • BG505 SOSIP.664 and B41 SOSIP.664 gpl40 trimers were expressed in HEK293F cells and purified by 2G12-affinity and gel filtration chromatography as described elsewhere (Pugach et al., 2015; Sanders et al., 2013). Trimers were incubated with a 10 molar excess of Fab (CH235, CH235.9, or CH235.12) overnight at room temperature and the complexes were diluted to -0.03 mg/mL prior to application onto a carbon-coated 400 Cu mesh grid that had been glow discharged at 20 mA for 30 s. The grids were stained with 2% (w/v) uranyl formate for 60 seconds.
  • Samples were imaged using a FEI Tecnai T12 electron microscope operating at 120 keV, with an electron dose of - 25 eVA 2 and a magnification of 52,000x that resulted in a pixel size of 2.05 A at the specimen plane. Images were acquired with Leginon (Suloway et al., 2005) using a Tietz TemCam- F416 CMOS camera with a nominal defocus range of 1000-1500 nm. Automated particle picking, stack creation, and initial 2D classification was performed in the Appion software suite (Lander et al., 2009).
  • the 3D classes representing the predominant stoichiometry for each complex were used as the initial models (low pass filtered to 40 A) for further refinement using Relion, with C3 symmetry imposed for complexes with CH235.9 or CH235.12.
  • the total number of particles used in refinement and final resolution of the map using a Fourier shell correlation of 0.5 are as follows: BG505 in complex with CH235 - 3,467 particles (-25 A); B41 in complex with CH235 - 4,248 particles (-24 A); BG505 in complex with CH235.9 - 2,567 particles (25 A); B41 in complex with CH235.9 - 8,061 particles (19 A); BG505 in complex with CH235.12 - 15,565 particles (17 A); B41 in complex with CH235.12 - 17,023 particles (16 A).
  • CH235.9N3OT CGTGGCGTCTGGATACAACTTCACCGACTACTATATAC;
  • CH235.9G62Q GGTCGCACAGATTACGCACAGGCGTTTGGGGA;
  • CH235.9G65Q GATTACGCAGGGGCGTTTCAGGACAGAGTGTCCA;
  • CH235.9AIO3E GTTAGAAATGTGGGAACGGAGGGCAGCTTGCTCCACTATG;
  • CH235.9G62Q/G65Q GGTCGCACAGATTACGCACAGGCGTTTCAGGACAGAGTGTCCA; CH235.9 S 54R: GGATCGACCCT AGGGGTGGTCGC AC AG;
  • CH235.9 A6 is : GTGGTCGC AC AGATT ACTC AGGGGCGTTTG.
  • BSA buried surface area
  • Human PBMCs (6x l0 7 ) were obtained from three HIV-1 and hepatitis C negative individuals (LP32647, LP08248 and LP23810).
  • a 5 'RACE approach was developed to amplify immunoglobulin genes based on previously described methods (Venturi et al., 2011). Briefly, the PBMCs were pelleted at 1200 rpm for 8 min. mRNA was then extracted and eluted in 50 ⁇ elution buffer using [iMACS mRNA isolation kit (Miltenyi Biotec) according to manufacturer's instructions.
  • the cDNA products were purified using Nucleospin II kit (Macherey-Nagel) and eluted in 50 ⁇ water. 454 pyrosequencing was performed as described previously (Wu et al., 2011). The first PCR amplification was performed with a common 5' primer II A (Clontech) and an Ig gene specific 3' primer
  • the positional conformity of a conforming antibody sequence d to a reference sequence d is defined as the number of mutated positions shared by both sequences divided by the total number of mutations in the conforming sequence.
  • MsANc ⁇ 2, 9, 10, 11, 16, 19, 20, 23, 26, 30, 31, 32, 33, 34, 37, 45, 46, 48, 50, 52, 53, 55, 57, 58, 59, 60, 62, 63, 66, 68, 69, 70, 71, 74, 77, 80, 84, 85, 88, 89 ⁇
  • M8ANC131 n M CH2 35 ⁇ 19, 23, 31, 34, 46, 50, 52, 55, 57, 59, 63, 68, 84 ⁇
  • the targeting precision of the CD4bs-directed antibodies was defined as the buried surface area inside of the CD4 binding site minus the buried surface area outside of the CD4 binding site.
  • the buried surface area of each antigen residue was determined by NACCESS.
  • the buried surface area from the following residue numbers were considered inside of the CD4 binding site: 257, 279, 280, 281, 282, 283, 365, 366, 367, 368, 370, 371, 455, 456, 457, 458, 459, 460, 469, 472, 473, 474, 475, 476, and 477 (Zhou et al., 2007).
  • the buried surface areas from the rest of the residues were considered outside of the CD4 binding site. Somatic hypermutation was defined using nucleotide sequences and P values were calculated based on linear regression.
  • EMAN2 an extensible image processing suite for electron microscopy. J. Struct. Biol. 157, 38-46.
  • Venturi V., Quigley, M.F., Greenaway, H.Y., Ng, P.C., Ende, Z.S., Mcintosh, T., Asher, T.E., Almeida, J.R., Levy, S., Price, D.A., et al. (2011).
  • Kepler, T.B. (2013) Reconstructing a B-cell clonal lineage. I. Statistical inference of unobserved ancestors. FlOOORes 2, 103.
  • DH540 sequences are described in Figure 13 and the antibody is described in detail in US Ser. No. 62/170,558, filed June 3, 2015.
  • DH542 QSA antibody has the VH of DH542 and the VL called DH542-QSA
  • DH542-L4 is an antibody that has a VH of DH542 and VL of DH429 ( Figure 2).
  • DH512 K3 is a combination of VH DH512 and VL called DH511 2AVK
  • DIQMTQSPS FLYGSVGDRVT ITCRASQNIKDYLNWYQQRPGRAPRLLIYAASNLQSGVPSRFSGSGYGTDFT LI I S SLQPEDFATY FCQE SY SSTPTH I FGLGTKLEKKX
  • the antibodies will be expressed in a CHO line, e.g. CHO-DG44 cell line for preparation of pharmaceutical compositions. These CHO-expressed antibodies will be analyzed in various suitable assays.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • AIDS & HIV (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Communicable Diseases (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The invention relates to the identification of monoclonal HIV-1 neutralizing antibodies, such as, but not limited to, antibodies that bind to the CD4 binding site (CD4bs) of HIV-1 gp120, their recombinant expression and purification and uses. In certain aspects, the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention or fragments thereof or any combination thereof. In certain aspects the invention provides methods to treat or prevent HIV-1 infection in a subject comprising administering to the subject a pharmaceutical composition comprising any one of the inventive antibodies or fragments thereof.

Description

HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF (CD4bs antibodies)
[0001] This invention claims the benefit of and priority to U.S. Serial No. 62/135,309 filed March 19, 2015, U.S. Serial No. 62/260, 100 filed November 25, 2015, U.S. Serial No. 62/191,095 filed July 10, 2015, U.S. Serial No. 62/222, 115 filed September 22, 2015, and U.S. Serial No.
62/301,993 filed March 1, 2016, the contents of each of which are hereby incorporated by reference in their entireties.
[0002] This patent disclosure contains material that is subject to copyright protection. The copyright owner has no objection to the facsimile reproduction by anyone of the patent document or the patent disclosure as it appears in the U.S. Patent and Trademark Office patent file or records, but otherwise reserves any and all copyright rights.
[0003] All patents, patent applications and publications cited herein are hereby incorporated by reference in their entirety. The disclosure of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art as known to those skilled therein as of the date of the invention described herein.
GOVERNMENT SUPPORT
[0004] This invention was made with government support under Center for HIV/ AIDS Vaccine Immunology-Immunogen Design grant UM1-AI100645 from the NIH, NIAID, Division of AIDS. The government has certain rights in the invention.
FIELD OF THE INVENTION
[0005] The invention relates to the identification of monoclonal HIV-1 neutralizing antibodies, such as, but not limited to, antibodies that bind to the CD4 binding site (CD4bs) of HIV-1 gpl20, their recombinant expression and purification and uses.
BACKGROUND
[0006] It is well documented that essentially all HIV-1 infected individuals develop antibodies capable of binding HIV-1 envelope, but that only a small subset of these antibodies are neutralizing and capable of blocking viral entry in target cells. See e.g. Doria-Rose N. "HIV Neutralizing Antibodies: Clinical Correlates and Implications for Vaccines" The Journal of Infectious Diseases (2010) Volume 201, Issue 7, Pp. 981-983. Over the time of an infection, some individuals develop neutralizing antibodies, and with some of these neutralizing antibodies having activity against diverse primary HIV-1 isolates. A number of broad neutralizing monoclonal antibodies (mAbs) have been identified from HIV-1 infected individuals and these define specific regions on the virus envelope, e.g. CD4 binding site, V3 loop, membrane proximal region (MPER) of gp41, that are vulnerable to neutralizing Abs.
[0007] Broadly neutralizing HIV-1 antibodies have been isolated only from natural HIV-1 infection. See e.g. Mascola and Haynes, Immunological Reviews (2013) Vol. 254: 225-244. Some examples of broadly neutralizing antibodies (bnAbs) targeting CD4 binding site or V3 loop are VRCOl, CH103, CH31, CH98, 8ANC131, PGT121, PGT128. Unfortunately, so far none of these antibodies have been developed for HIV prevention or treatment. Thus, the need exists for monoclonal broadly neutralizing antibodies that can be developed and used for prevention and treatment for an infectious agent, such as HIV.
SUMMARY OF THE INVENTION
[0008] In certain aspects the invention provides an antibody or fragment thereof with the binding specificity of CD4 binding site antibody DH491 or CH493, or CH558, or CH557.
[0009] In certain aspects, the invention provides a recombinant antibody or fragment thereof comprising: a variable heavy chain (VH) amino acid sequence, or fragment thereof, selected from the group of VH amino acid sequences of an antibody CH490, CH491, CH492, CH493, CH555, CH556 and CH557 and a variable light chain (VL) amino acid sequence or fragment thereof, selected from the group of VL amino acid sequences of an antibody CH490, CH491, CH492, CH493, CH555, CH556 and CH557, wherein the recombinant antibody or fragment thereof binds to the CD4 binding site of the HIV-1 envelope. In certain aspects the antibodies bind to the CD4 binding site on the HIV-1 envelope and are neutralizing.
[0010] In certain embodiments, the antibody or fragment thereof is fully human and recombinantly produced. In certain embodiments, some of the VH and VL chains are identified from human subject who have been naturally infected with HIV-1. In certain embodiments the antibody is not naturally occurring. In certain embodiments the antibody comprises naturally occurring pair of VH and VL chains. In certain embodiments the antibody comprises naturally occurring pair of VH and VL chains wherein the Fc portion of the antibody is not the natural isotype or portion of the naturally occurring pair of VH and VL chains. In certain embodiments the antibody is
computationally designed, for example based on some naturally identified VH and VL sequences. In certain embodiments the antibody is computationally designed, e.g. UCA, Intermediates in the antibody lineages. In certain embodiments the antibody comprises a non-naturally occurring pairing of VH and VL chains, wherein the VH or VL individually could be identified from a subject. In some embodiments, the antibody comprises VH chain or HCDRs of a VH chain of one clonal member, and VL or LCDRs of another clonal member, i.e., a non-naturally occurring antibody comprising sequences derived from natural pairs. In certain embodiments the antibody comprises naturally occurring VH and VL chains modified by substituting one or more amino acids.
[0011] In certain embodiments, the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody CH557, or any of the other lineage members. In certain embodiments, the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%) identical to the VL chain of antibody CH557, or any of the other lineage members.
[0012] In certain embodiments, the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH542, or any of the other lineage members. In certain embodiments, the antibody or fragment thereof comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH542, or any of the other lineage members.
[0013] In certain embodiments, the antibody or fragment thereof comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493 and further comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody DH511, DH512, DH513, DH514, DH515, DH516, DH517, DH518, DH536, DH537, CH491 or CH493.
[0014] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody CH557. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody CH557.
[0015] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR3 of CH557 and further comprises a VL which comprises the LCDR3 of CH557.
[0016] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH542. In certain embodiments, the antibody or fragment thereof comprises a VL which comprises the LCDR1, LCDR2, and LCDR3 of antibody DH542.
[0017] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody CH557 and further comprises the complementary VL which comprises the LCDR1, LCDR2, LCDR3 of antibody CH557.
[0018] In certain embodiments, the antibody or fragment thereof comprises VH and VL of antibody CH557. [0019] In certain embodiments, the antibody or fragment thereof comprises a VH which comprises the HCDR1, HCDR2, and HCDR3 of antibody DH542 and further comprises the complementary
VL which comprises the LCDR1, LCDR2, LCDR3 of antibody DH542. In certain embodiments, the antibody or fragment thereof comprises VH and VL of antibody DH542.
[0020] In certain embodiments, the antibody is DH542. In certain embodiments, the antibody is
CH557.
[0021] In certain embodiments, the invention provides a recombinant antibody or fragment thereof with the binding specificity of CD4 binding site antibody DH491 or CH493, or CH558, or CH557 comprising an engineered constant domain. In some embodiments, the recombinant antibody or fragment thereof is capable of neutralizing an HIV-1 Env pseudovirus with an IC50 of less than 50 μg/mL in an in vitro assay.
[0022] In certain aspects, the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention or fragments thereof or any combination thereof.
[0023] In certain aspects, the invention provides a pharmaceutical composition comprising anyone of the antibodies of the invention, or a combination thereof.
[0024] In certain embodiments, the composition comprises an antibody or a fragment thereof which is recombinantly produced in CHO cells.
[0025] In certain aspects, the invention provides a pharmaceutical composition comprising a vector comprising a nucleic acid encoding anyone of inventive antibodies or fragments. In certain embodiments, the nucleic acids are optimized for expression in human host cells. In other embodiments, the nucleic acids are optimized for recombinant expression in a suitable host cell. In certain embodiments, the vector is suitable for gene delivery and expression. Non-limiting examples of such vectors include adenoviral vectors (Ads), adeno associated virus based vectors (AAVs), or a combination thereof. In certain aspects, the invention provides isolated cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof. In certain aspects, the invention provides compositions of cells comprising vectors and/or nucleic acids for expression of the inventive antibodies and fragments thereof.
[0026] In certain embodiments, the compositions further comprise an additional antibody or fragment thereof. In certain embodiments, the compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH540. In certain embodiments, the compositions further comprise an antibody or a fragment thereof comprising CDRl, 2, and/or 3 of the VH and VL chains, or the VH and VL chains of antibody DH512. [0027] In certain embodiments, the compositions further comprise an antibody or a fragment thereof comprising VH and VL chain of antibody DH429 or DH270IA1.
[0028] In certain embodiments, the antibody or antigen binding fragment can include an Fc domain that has been modified compared to a native Fc domain. In non-limiting embodiments, the Fc domain can be modified by amino acid substitution to increase binding to the neonatal Fc receptor and therefore the half-life of the antibody when administered to a subject.
[0029] In certain embodiments, the invention provides antibodies or fragments comprising a CDR(s) of the VH and/or VL chains, or VH and/or VL chains of the inventive antibodies, as the HIV-1 binding arm(s) of a bispecific molecules, e.g. but not limited to DARTS, diabodies, toxin labeled HIV-1 binding molecules.
[0030] In certain aspects the invention provides methods to treat or prevent HIV-1 infection in a subject comprising administering to the subject a pharmaceutical composition comprising any one of the inventive antibodies or fragments thereof in a therapeutically effective amount. The methods of the invention contemplate combination therapeutic methods, including but not limited to administering combinations of various antibodies or fragments thereof.
[0031] In certain embodiments of the methods, the pharmaceutical compositions are administered in a therapeutically effective dose and regimen.
BRIEF DESCRIPTION OF THE DRAWINGS
[0032] To conform to the requirements for PCT patent applications, many of the figures presented herein are black and white representations of images originally created in color.
[0033] FIG. 1 shows DH542 sequences (CDRs are bolded and underlined) (SEQ ID NOs: 1-4).
[0034] FIG. 2 shows the amino acids sequences of VH and VL chains of antibodies of the DH270 lineage, and nucleic acid sequences encoding these amino acids. CDRs are highlighted in each antibody. DH270IA1 as listed in Figure 3 is the same antibody referred to as II in the sequence of Figure 2. The figure shows SEQ ID NOs: 5-16 (Heavy chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 17-28 (Heavy chain amino acid sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 29-40 (Light chain nucleotide sequences in order of appearance from UCA-DH270H), SEQ ID NOs: 41-52 (Light chain amino acid sequences in order of appearance from UCA-DH270H).
[0035] FIG. 3 shows Neutralizing Breadth and Potency of various HIV-1 BnAbs that are candidates for being combined with the inventive antibodies or other antibodies for a potent mixture of bnAbs. DH270IA1 is II in the DH270 lineage. [0036] FIG. 4 shows Neutralizing Breadth and Potency of some candidate bnAbs for single or combination use.
[0037] FIG. 5 shows comparison of some of the bnAbs of the invention with other bnAbs in the same class. % breadth refers to number of tested HIV-1 strains.
[0038] FIG. 6 shows nucleic acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 53-72).
[0039] FIG. 7 shows amino acid sequences of antibodies DH511-518, DH537 and 538 (SEQ ID NOs: 73-93).
[0040] FIGS. 8 A and 8B show Alignment of VH (8 A) and VL (8B) Sequences of BnAb DH511 Clonal Lineage. Bolded is the sequence of CDRl, underlined is the sequence of CDR2 and italicized is the sequence of CDR3 of the DH511 VH chain and DH511 VL chain. The CDRs of the VH and VL sequences of the other antibodies DH512, DH513, DH514, DH515, and DH516 can be readily determined based on the sequence alignment. FIG. 8A shows SEQ ID NOs: 94-99 (in order of appearance from DH511-DH516). FIG. 8B shows SEQ ID NOs: 100-105 (in order of appearance from DH511 -DH516).
[0041] FIGS. 9A and 9B show Alignment of VH (Figure 9A) and VL (Figure 9B) sequences of MPER BnAbs. Bolded is the sequence of CDRl, italicized is the sequence of CDR2 and underlined is the sequence of CDR3 of VH or VL of the listed MPER antibodies. FIG. 9A shows SEQ ID NOs: 106-114 (in order of appearance from DH511-2F5). FIG. 9B shows SEQ ID NOs: 115-123 (in order of appearance from DH51 1-2F5).
[0042] FIG. 10 shows neutralization by antibodies CH555, CH556, CH557, CH558, CH560, CH561, CH562, DH210 and DH211 identified from subject CH505 measured in TZM-bl cells. Pseudoviruses were produced by transfection in 293T cells. Values are the antibody concentration ^g/ml) at which relative luminescence units (RLUs) were reduced 50% compared to virus control wells (no test sample). Values in bold are considered positive for neutralizing antibody activity. CH557 IC50 neutralization summary: mean IC50 = 3.66 μg/ml; geometric mean IC50 = 0.66 μg/ml; median = 0.62 μg/ml.
[0043] FIG. 11 shows CH557 gene information.
[0044] FIG. 12 shows sequences of CH557 (SEQ ID NOs: 124-127). CDRs are bolded and underlined.
[0045] FIG. 13 shows a sequence alignment of the CD540-VRC40 antibodies, listing the heavy and light chain variable region sequences, kabat and IMGT CDR and framework regions, and kabat numbering. The heavy and light chain variable region sequences of the CH540-VRC40.01,
CH540-VRC40.02, CH540-VRC40.03, CH540-VRC40.04 are shown. [0046] FIG. 14 shows gene information for antibodies in the CH235 lineage.
[0047] FIGS. 15A and 15B show amino acid alignment of CH235 lineage antibody heavy chain
(Figure 15 A) and light chain (Figure 15B). Antibodies are listed in ascending order of somatic mutations and compared to the inferred unmutated common ancestor previously published (Gao,
Bonsignori, Liao et al. Cell 2014). FIG. 15A shows SEQ ID NOs: 128-139 (in order of appearance from UCA-CH557). FIG. 15B shows SEQ ID NOs: 140-149 (in order of appearance from UCA-
CH556).
[0048] FIG. 16 shows alignment of CH557 heavy chain amino acid sequence compared to CH235 lineage antibodies with increasing levels of somatic mutations and neutralization breadth. Contact sites with gpl20 identified from CH235/gpl20 co-crystal structure are indicated with asterisks. Amino acid mutations within the contact sites are bolded and underlined. Figure 16 shows SEQ ID NOs: 150-154 (in order of appearance from UCA-CH557).
[0049] FIG. 17 shows alignment of CH557 light chain amino acid sequence compared to CH235 lineage antibodies with increasing levels of somatic mutations and neutralization breadth. Figure 17 shows SEQ ID NOs: 155-158 (in order of appearance from UCA-CH557).
[0050]
[0051] FIG. 18 shows amino acid sequences of VH and VL chains of antibodies CH490, CH491, CH492 and CH493 (CH235_129w66 = CH490; CH235_68wl00 = CH491; CH235 115wl00 = CH492; CH235_75wl52 = CH493) (SEQ ID NOs: 159-164).
[0052] FIG. 19 shows nucleic acid sequences of VH and VL chains of antibodies CH490, CH491, CH492 and CH493 (CH235_129w66 = CH490; CH235_68wl00 = CH491; CH235 115wl00 = CH492; CH235_75wl52 = CH493) (SEQ ID NOs: 165-170).
[0053] FIG. 20 shows phylogenetic tree of the heavy chains of antibodies CH490, CH491, CH492 and CH493 (see table in Figure 19). See also Example 6: CH240, CH239, CH235, CH236, CH241 VH chains were identified from cultured memory B cells. The rest of the VH chains were retrieved with deep sequencing.
[0054] FIG. 21 shows ELISA binding of CH490, CH491, CH492 and CH493 antibodies to various antigens as listed in the figure.
[0055] FIG. 22 shows a summary of neutralization data of CH490, CH491, CH492 and CH493 antibodies for various HIV-1 strains in TZMbl assay. Intermediate antibodies are described in Gao, Bonsignori, Liao et al. Cell 158, 481-491, July 31, 2014.
[0056] FIG. 23 shows a summary of neutralization data for antibodies CH235, CH490, CH491, and
CH493. The viruses are CH505 TF (autologous virus) in which either point or multiple single mutations were introduced in the loop D region. The loop D mutations are described in Gao et al Cell 158, 481-491, July 31, 2014 (incorporated by reference). These mutations reflect mutations in the loop D region that naturally occurred in the autologous virus of this subject over time. They were artificially introduced into the CH505 TF to study their effect in absence of other mutations in other parts of the autologous virus that also occurred during virus evolution. These mutations were induced by CH235 lineage antibodies identified early during the course of infection. These data show that the more mutated antibody CH493 which came from a later time point and that is broadly neutralizing also acquired the ability of recognizing virus escape mutants that escaped earlier antibodies from the same lineage, before they acquired substantial breadth.
[0057] FIG. 24 shows a summary of neutralization (TZMbl assay) data of CH505 D loop mutants by various antibodies. The summary shows that CH493 neutralizes all Loop D CH505 mutants.
[0058] FIG. 25 shows results of HEp-2 cell IF staining for CH557.
[0059] FIGS. 26A and 26B shows summary of data from CH557 microarray polyreactivity.
[0060] FIG. 27A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC50 in μg/ml.
[0061] FIG. 27B shows the mean IC50 and percent of isolates neutralized at different IC50 values.
[0062] FIG. 28A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC80 in μg/ml.
[0063] FIG. 28B shows the mean IC80 and percent of isolates neutralized at different
IC80<50ug/ml values.
[0064] FIGS. 29A-29B show CH235 Lineage, with Time of Appearance and Neutralization by Select Members. (A) Phylogram of CH235 lineage. Phylogenetic tree is colored by first time (wk post-infection) from which sequences were obtained. Key members of the CH235 lineage are labeled. CH235.6, CH235.7, CH235.8 and CH235.9 VH were complemented with full heavy chain gene regions and paired with the VL from the closest natural antibody. (B) Neutralization dendrograms display single mAb neutralization of a genetically diverse panel of 199 HIV-1 isolates. Coloration is by IC5o- See also Figures 36A-B, 40C, and 41.
[0065] FIGS. 30A-30E show structures of CH235 -Lineage Members in Complex with HIV-1 Env.
(A) Co-crystal structures of the antigen-binding fragments (Fabs) of CH235-lineage members with core gpl20. Structures are shown in ribbon diagram, with gpl20 in gray and residues altered by
SHM in stick representation colored by time-of-appearance. (B) Negative stain EM of Fabs of
CH235-lineage members and trimeric HIV-1 Env from BG505 (top row) and B41 (bottom row).
Structures in surface representation, with Env portions colored gray and Fabs by time-of- appearance. (C) Epitope displayed on the gpl20 surface and colored by antibody time-of- appearance, with the vulnerable portion of the CD4bs highlighted in yellow and select regions labeled. (D) Targeting precision of CD4bs-directed antibodies vs neutralization breadth. (E) VH- gene SHM of CD4bs-directed antibodies vs neutralization breadth. See also Figures 37A-G, and 42.
[0066] FIGS. 31A-C show sequence Evolution of CH235 Lineage: SHM, Timing, and Conformity of CH235 -Lineage Development from UCA to Antibody with 90% Breadth. (A) Heavy chain SHM over time for the CH235 lineage (left panel). SHM levels of other VHl-46-derived CD4bs mAbs and selected VHl-2-derived VRCOl-class mAbs are shown (middle and right panels, respectively); the time since infection is unknown for these mAbs. (B) Maturation conformity vs overall heavy chain SHM. Positional conformity (top row) is defined as the number of aa positions differing from the germline sequence in both the conforming and reference sequences, divided by the total number of aa changes in the conforming antibody. Identity conformity (bottom row) is defined as the number of such positions which are additionally mutated to the same residue, divided by the total number of mutations in the conforming antibody. Conformity to 1B2530 (left) and to 8ANC131 (right) is shown for both position and identity. (C) VH-gene mutability accounts for the majority of positional conformity of CH235 lineage. The mutability of the VH-gene for VH1-46 (top) and VH I - 2 (bottom) is shown. Sequence logos are shown at each position; the height of each logo
corresponds to the percent of mutated reads. Green bars are shown for SHM in antibody CH235, which are altered in over a quarter of VHl-46-derived antibodies. See also Figures 38A-E, and 43A- C.
[0067] FIGS. 32A-32D show binding Kinetics of CH103 and CH235 Lineage Antibodies. Binding association (ka) and dissociation (kd) rates of the CHI 03 (A-B, squares) and CH235 (C-D, circles) lineage mAbs to CH505.TF gpl20 Env were measured with SPR and used to calculate the dissociation rate constants (Kd). KdS are shown in A and C, ka (solid lines, plotted on the left y-axis) and kd (dashed lines, plotted on the right y-axis) are shown in B and D. See also Figures 44A-B.
[0068] FIGS. 33A-33C show CH235 Lineage Antibodies Neutralization of Autologous Virus and
CH505.TF Loop D Mutants. (A) Heatmap analysis of neutralization of 76 pseudoviruses (row) by
16 CH235 lineage mAbs (column). Coloration is by IC5o- This analysis extends previous observations on early CH235 lineage antibodies (Gao et al., 2014) by including late mAbs
CH235.7, CH235.8, CH235.10, CH235.11, CH235.12 and CH235.13 and by adding pseudoviruses isolated from wk 136 to 323 post-transmission. (B) CH505 TF and loop D mutants M5, M6, M10,
M19, Mi l, M7, M8, M9, M20 and M21 neutralization by CH236 mAb, late mAbs CH235.7,
CH235.9 CH235.10, CH235.11, CH235.12, CH235.13 (left panel) and CH235.9 mAb mutants
(right panel). Neutralization is expressed as IC50 g/ml. CH505 TF sequence mutations are shown on the right. (C) The CDR HI N30 (sticks, dark red) in CH235.9, which interacts with the β20- β21 loop in the bridging sheet of gpl20 (cyan), is over 19A away from the N280S mutation site in loop D (orange). See also Figures 39A-B, 45, and 46.
[0069] FIGS. 34A-34B show binding of CH235 and CHI 03 Lineage mAbs to Autologous CH505. (A) and CH235 UCA Binding to Heterologous fflV-1 Env Glycoproteins (B). (A) Heatmap analysis of UCA, intermediate (IA) and mature CH235 and CHI 03 lineage mAbs binding to 113 CH505 autologous Env isolated from time of infection (TF) to 160 wks post-infection and to the CH505.TF mutants (Gao et al., Cell 2014). Mabs were tested in ELISA at concentrations ranging from 100 μ^ηύ to 0.6 ng/ml . Binding is expressed as a LogAUC. (B) Affinity of CH235 UCA, CH235 wild-type and select SHM variants to a panel of 15 heterologous gpl20 Envs. See also Figures 40A-40B and 43.
[0070] FIGS. 35A-35D show CH235 Antibody Lineage Auto- and Polyreactivity. (A) CH235 lineage antibody binding to ANA measured in ELISA. LogAUC was calculated from duplicate samples. Results representative of duplicate experiments. (B) Binding to cardiolipin was determined using Quanta Lite ACA IgG III ELISA Assay. (C) Hep2 cell IF staining. Size bars = 50 μπι. (D) Measurement of polyreactivity against 9,400 human antigens using Proto Array 5 microchip: CH235 lineage mAbs binding (x-axis) was compared to non-polyreactive control mAb 15 IK (y-axis). Polyreactivity is defined as 1 log stronger binding than 151k mAb to more than 90% of the test proteins. High affinity binding was measured as a >2 log increase in binding (dotted line) (Liu et al., 2015).
[0071] FIGS. 36A-36B show CH235 Lineage: Sequences and Neutralization Fingerprint
Dendrogram, Related to Figure 29. (A) Alignment of NGS sequences and antibodies identified from 17 time points from 6 to 323 weeks post-transmission and comparison of mutation patterns to other IGHV1-46 (1B2530 and 8ANC131) and IGHV1-2 (VRCOl, VRC-CH31 and VRC-PG04) derived broadly neutralizing antibodies. Antibodies identified from single B cells are shown in bold. The positions mutated in CH235 were color coded based on the time points at which these mutations were firstly observed in the NGS reads. Mutated positions not seen in the NGS data are colored based on the time of isolation of CH235 (41 weeks). IGHV1-46*01 is used as reference for IGHVl -46 derived antibodies and IGHVl -2*02 is used as reference for the three VRCOl -class antibodies. (B) The neutralization fingerprints for three antibodies from the CH235 lineage were compared to the fingerprints for other VH1-46 class antibodies and non-VHl-46 class CD4- binding-site antibodies; coloring same as in Figure 31A-C. Antibodies targeting other sites of vulnerability on HIV-1 Env are shown as control (black). [0072] FIGS. 37A-37G show CH235 Lineage Versus Other CD4-Binding Site Antibodies and Negative-stain EM Reconstructions of gpl40 SOSIP Trimers with CH235-lineage Fabs, Related to Figure 30A-E. (A) CD4-mimicry by CH235. Recognition of gpl20 by the N-terminal domain of the CD4 receptor (far left) is compared to VH genes from CH235 and prototypic antibodies VRCOl (from VH1-2) and 8ANC131 (from VH1-46). (B) Conserved molecular interactions between antibody CH235, receptor CD4 and antibody VRCOl . Top row shows intermolecular antiparallel strand interactions and bottom row Asp368 electrostatic interaction. (C) Binding orientation of VH- gene derived antibodies relative to CD4. (D) Negative-stain EM 3D models with BG505
SOSIP.664. (left) Top and side views of CH235.12 in complex with BG505 SOSIP (purple) aligned to the EM volume of VRCOl in complex with BG505 (gold mesh; EMD-6252). (middle) Top and side views of the CH235.12-BG505 complex (purple mesh) aligned to the EM volume of CH103 in complex with BG505 SOSIP (gray; EMD-6250). (right) Top and side views of the CH103-BG505 complex (gray mesh) aligned to the EM reconstruction of BG505 SOSIP in complex with soluble CD4 and 17b Fab (blue; EMDB ID 5723). (E) Negative-stain EM of gpl40 SOSIP trimers with CH235-lineage Fabs. (F) Top and side views of 3D reconstructions of each complex. (G) Fourier shell correlation curves for each dataset with a resolution estimate using an FSC cutoff of 0.5.
[0073] FIGS. 38A-38E show Sequence Similarity Between VH1-2 and VH1-46 Broadly
Neutralizing Antibodies and Mutability of Germline Genes, Related to Figure 31 A-C. (A) Amino acid alignment of 8ANC131 and CH235 to the IGHV1-46 germline gene showing the definition of conformity. (B) Probability distribution of the number of sharing mutation positions for each pair of antibodies. (C) Probability distribution of the number of identical mutations for each pair of antibodies. (D) SUM frequency is shown versus VH-gene position for VHl-46, VHl-2 and three others. Sequences were aligned to VHl-46 and positions not aligned to VHl-46 (indels) were removed. (E) Dendrogram showing sequence segregation of VHl-2 and VHl-46 derived broadly neutralizing antibodies, despite similarity of VHl-2 and VHl-46 germline genes shown with underline.
[0074] FIGS. 39A-39B show Generation of CH235.9 Mutants to Evaluate the Effect of Mutations in the V-heavy Chain on the Ability of CH235.9 to Neutralize loop D Mutant CH505 Autologous
Viruses, Related to Figure 33A-C. (A) The interaction between CH235 CDR L3 (purple) and N280 in the HIV-1 gpl20 Env loop D (orange) from the crystal structure of the CH235-gpl20 complex
(left panel). Asparagine in position 280 in gpl20 forms three hydrogen bonds (yellow dotted lines) with residues in the CDR L3 (left panel). Structural modeling predicted these hydrogen bonds to be disrupted in the N280S (right panel) and N280T (not shown) mutations which occur in autologous
CH505 escape mutants. (B) Alignment of CH235.7 and CH235.9 through CH235.13 VH amino acid sequences to CH236 VH (SEQ ID NOs: 171-177 (in order of appearance from CH236- CH235.7)). CH235.9 aa mutations expressed as recombinant IgG and tested for neutralization of CH505 TF loop D mutants are shown in red. Asterisks indicate points of contact with gpl20 derived from the CH235 crystal structure in complex with gpl20 Env.
[0075] FIGS. 40A-40B show CH505 gpl20 Env Quasi-species Selected as Optimized Immunogens to Induce Both CH235 and CH103-like bnAbs, Related to Figure 34A-B. (A) Heatmap of the binding data of selected CH235 and CHI 03 lineage members to the CH505 Env glycoproteins selected to be used as immunogens. Individual Env clone names and weeks of isolation are shown on the left. (B) Affinity of gHgL of 1B2530, 8ANC131, VRCOl, VRC-PG04 and VRC-CH31 to a panel of 15 heterologous gpl20 envelope glycoproteins.
[0076] FIG. 40C shows a Table with characteristics of the V(D)J rearrangements of key CH235 lineage antibodies. Related to Figure 29.
[0077] FIG. 41 shows a Table with a summary of the Breadth and Potency of Antibody
Neutralization Against 199 HIV-1 Env-Pseudoviruses. Related to Figure 29.
[0078] FIG. 42 shows a Table with crystallographic Data Collection and Refinement Statistics. Related to Figures 30A-30E.
[0079] FIGS. 43A-43C show Sequence Similarity Between VHl-2 and VHl-46 Broadly
Neutralizing Antibodies and Mutability of Germline Genes. Related to Figures 31 A-31C. (A) The probability of a conforming VHl-46 antibody with x VH mutations, having c common mutation positions with a reference antibody were estimated based on 100,000 simulated events, with the likelihood of each residue being mutated based on uniform distribution (position) (Puni&rm), or the mutation frequency at each residue position derived from the VHl-46 antibodies (PVHI-46)- (B) The probability of a conforming VHl-46 antibody with x VH mutations, having i identical mutations with a reference antibody were estimated based on 100,000 simulated events, with the likelihood of each residue being mutated based on uniform distribution (position and mutation type) (Pumform), or the mutation frequency at each residue position derived from the VHl-46 antibodies (PVHI-46)- (C) Pearson correlation coefficients of positional somatic mutation frequency between VHl-46, VHl-2 and three others.
[0080] FIGS. 44A-44B show CH235 Lineage and CH106 Monoclonal Antibodies Cross-Blocking. Related to Figure 32. (A) CH235 lineage antibodies blocking of sCD4 and CHI 06 binding to CH505 TF gpl20 and B.63521 gpl20 Envs. Results expressed as IC50 ug/ml. nb= no blocking. (B) Monoclonal antibody CH106 blocking of CH235 lineage antibodies to CH505 TF gpl20.
Results expressed as IC50 ug/ml. nb= no blocking.
[0081] FIG. 45 shows CH235 lineage autologous neutralization. Related to Figure 33A-C. [0082] FIG. 46 shows CH235 lineage antibodies and CH235.9 mutants neutralization of CH505 TF loop D mutant viruses. Related to Figure 33 A-C.
[0083] FIG. 47 shows binding of antibodies in the CH235 and CH103 lineages to CH505 autologous Env glycoproteins, Related to Figure 34A-B.
[0084] Figures 48A-48D show non-limiting examples of mutations in the VH chain of DH511 and DH512, and non-limiting examples of sequences including mutations in DH512 VH chain. Figure 48 A shows positions in the VHCDR3 chain of DH511 which could be mutated. Amino acid positions refer to Kabat numbering. Most mutations are to changes to W, but F, L or possibly other substitutions can also be tried. Figure 48B shows positions in the VHCDR3 chain of DH512 which could be mutated. Amino acid positions refer to Kabat numbering for the DH512VH chain:
QVQLVQSGGGLVKPGGSLTLSCSASGFFFDNSWMGWVRQAPGKGLEWVGRIRRLKDGAT GEYGAAVKDRFTISRDDSR MLYLHMRTLKTEDSGTYYCTMDEGTPVTRFLEWGYFYYY MAVWGRGTTVIVSS (SEQ ID NO: 213). Most mutations are to changes to W, but F, L or possibly other substitutions can also be tried. For both DH511 and DH512 position V100 can be changed to I. Position LlOOd can be changed to F. For both DH511 and DH512 combination mutations in the DH512 or DH511 VHCDR3 could include VH LlOOdF together with TlOOaW; VH LlOOdW together with TlOOaW. Figure 48C shows positions outside of VHCDR3 which could be mutated. Most mutations are to changes to W, F, L or possibly other substitutions can also be tried. Figure 48D shows amino acid sequences (SEQ ID NOs: 195-212) of some of the DH512 mutants from Figure 48B.
DETAILED DESCRIPTION
[0085] Broadly neutralizing and potent HIV-1 envelope glycoprotein (Env) antibodies are now being developed for both prevention of HIV-1 (Rudicell RS et al. J. Virol 88: 12669,-82, 2014) and for treatment of HIV-1 infected individuals (Barouch DH, et al. Nature 503 : 224-8, 2013; Shingai M et al. Nature 503 : 277-80, 2013). Thus, human recombinant antibodies either alone or in combinations have great prophylactic and therapeutic potential for the prevention and treatment of HIV-1 infection. Moreover, antibodies that bind with high affinity to Env may be useful in eliminating the latent pool of HIV-1 -infected CD4 T cells and curing HIV-1 infection, when either used to sensitize HIV-1 expressing target cells with bispecific bnAbs for NK or CD8 T cell killing or when bnAbs are conjugated with toxins or radionucleotides.
[0086] In certain aspects the invention provides fully human antibodies and fragments that specifically bind to and potently neutralize various isolates of HIV-1. In some embodiments, the antibodies bind to HIV-1 env V3 glycan. In some embodiments, the antibodies of the invention bind to HIV-1 gpl20 Env CD4 binding site.
[0087] In certain aspects the invention provides pharmaceutical compositions including these human antibodies and a pharmaceutically acceptable carrier. In certain aspects the invention provides antibodies for passive immunization against HIV/ AIDS. Nucleic acids encoding these antibodies, expression cassettes and vectors including these nucleic acids, and isolated cells that express the nucleic acids which encode the antibodies of the invention are also provided.
[0088] In some embodiments, the invention provides antibodies which are clonal variants . In some embodiments, clonal variants are sequences that differ by one or more nucleotides or amino acids, and have a V region with shared mutations compared to the germline, identical VHDJH or VJH gene usage, identical or similar HCDR3 length, and the same VL and JL usage. The germline sequence (unmutated common ancestor "UCA") is intended to be the sequence coding for the antibody/immunoglobulin (or of any fragment thereof) deprived of mutations, for example somatic mutations. Antibodies in a clone that are designated as UCA and/or I (for "Intermediate") are typically not identified from a biological sample, but are derived computationally based on VH and/or VL sequences identified from subjects infected with HIV-1.
[0089] Compositions including the human antibodies of the invention, including V3 glycan and CD4 binding site antibodies, can be used for any purpose including but not limited to research, diagnostic and therapeutic purposes. In non-limiting embodiments, the human monoclonal antibodies disclosed herein can be used to detect HIV-1 in a biological sample or interfere with the HIV-1 activity, for example to diagnose or treat a subject having an HIV-1 infection and/or AIDS. For example, the antibodies can be used to determine HIV-1 titer in a subject. The antibodies disclosed herein also can be used to study the biology of the human immunodeficiency virus. The antibodies of the invention can be used for therapeutic purposes for treatment or prevention of HIV-1 infection, alone or in combination with other therapeutic modalities, including ART and/or combination with other HIV-1 targeting antibodies, neutralizing antibodies and/or ADCC inducing antibodies.
[0090] In some embodiments, the antibodies of the invention are expected not to exhibit self- reactivity— they do not bind or bind very weakly to self-antigens, such as human protein. For example, the antibodies of clone DH51 1 are not self-reactive although their UCA and some IAs are polyreactive. For use as preventive or therapeutic agents, what matters is whether the mature antibody will be polyreactive or not, and for example DH542 is not. DH270IA1 does not show self-reactivity, while DH491 and DH493 antibodies are polyreactive to varying degrees. Broadly neutralizing antibody CH557 displays exceptional neutralization breadth and high potency (Figure 10) and it is not autoreactive nor polyreactive as determined by lack of binding to known human antigens associated with autoimmune disorders), negativity in Hep-2 cells IF staining (Figure 25) and lack of binding to an array of 9,400 human antigens (Figure 26A and B), including UBE3A and STUB-1 proteins, known to be bound by previously described broadly neutralizing antibodies targeting the CD4bs of gpl20 Env (Liu et al J Virol 2014, Bonsignori et al JCI 2014).
[0091] The neutralization breadth of the inventive antibodies is demonstrated by the diversity of viruses which are neutralized in the TZMbl Env pseudovirus inhibition assay. In certain embodiments, the neutralization breadth and/or binding of the antibodies of the invention can be maintained in the presence of tolerate changes to the epitope. Comparing the sequences of the neutralized viruses, versus viruses that are not neutralized, a skilled artisan can readily determine the % virus changes, including changes in the epitope, which can be tolerated while neutralization and/or binding is maintained.
[0092] Comparing the sequences of the antibodies and their neutralization properties, a skilled artisan can readily determine sequence identity, compare sequence length and determine the % sequence identity and/or changes, including % sequence identity and/or changes in the VH and VL sequences, including % sequence identity and/or changes in the CDRs, as well as the specific positions and types of substitutions which can be tolerated while neutralization potency and breadth is maintained.
[0093] Various algorithms for sequence alignment are known in the art. The similarity between amino acid sequences is expressed in terms of the similarity between the sequences, otherwise referred to as sequence identity. Sequence identity is frequently measured in terms of percentage identity (or similarity or homology); the higher the percentage, the more similar the two sequences are. Homologs or variants of a polypeptide will possess a relatively high degree of sequence identity when aligned using standard methods.
[0094] Methods of alignment of sequences for comparison are well known in the art. Various programs and alignment algorithms are described in: Smith and Waterman, Adv. Appl. Math.
2:482, 1981; Needleman and Wunsch, J. Mol. Biol. 48:443, 1970; Pearson and Lipman, Proc. Natl.
Acad. Sci. U.S.A. 85:2444, 1988; Higgins and Sharp, Gene 73 :237, 1988; Higgins and Sharp,
CABIOS 5: 151, 1989; Corpet et al., Nucleic Acids Research 16: 10881, 1988; and Pearson and
Lipman, Proc. Natl. Acad. Sci. U.S.A. 85:2444, 1988. Altschul et al., Nature Genet. 6: 119, 1994, presents a detailed consideration of sequence alignment methods and homology calculations.
[0095] The NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol.
215:403, 1990) is available from several sources, including the National Center for Biotechnology
Information (NCBI, Bethesda, Md.) and on the internet, for use in connection with the sequence analysis programs blastp, blastn, blastx, tblastn and tblastx. A description of how to determine sequence identity using this program is available on the NCBI website on the internet.
[0096] Homologs and variants of a VL or a VH of an antibody that specifically binds a polypeptide are typically characterized by possession of at least about 75%, for example at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity counted over the full length alignment with the amino acid sequence of interest. Proteins with even greater similarity to the reference sequences will show increasing percentage identities when assessed by this method, such as at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% sequence identity. When less than the entire sequence is being compared for sequence identity, homologs and variants will typically possess at least 80% sequence identity over short windows of 10-20 amino acids, and may possess sequence identities of at least 85% or at least 90% or 95%) depending on their similarity to the reference sequence. Methods for determining sequence identity over such short windows are available at the NCBI website on the internet. One of skill in the art will appreciate that these sequence identity ranges are provided for guidance only; it is entirely possible that strongly significant homologs could be obtained that fall outside of the ranges provided.
[0097] In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the VH and VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency. In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80% identical to the CDR1, 2, and/or 3 of VH and CDR1, 2, and/or 3 VL amino acid sequences of the antibodies described herein and still maintain the neutralization breadth, biding and/or potency.
[0098] In certain embodiments, the invention provides antibodies which can tolerate a larger percent variation in the sequences outside of the VH and/VL sequences of the antibodies. In certain embodiments, the invention provides antibodies which are 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, 85%, 84%, 83%, 82%, 81%, 80%, 79%, 78%, 77%, 76%, 75%, 74%, 73%, 72%, 71%, 70%, 69%, 68%, 67%, 66%, 65% identical, wherein the identity is outside of the VH or VL regions, or the CDRs of the VH or VL chains of the antibodies described herein.
[0099] Antibodies of the invention are expected to have the same binding specificity, for example as intact immunoglobulins and antigen binding variants or fragments e.g. as a number of well characterized fragments produced by digestion with various peptidases. For instance and without limitation, Fabs, Fvs, scFvs are fragments which are expected to have the same binding specificities as intact antibodies. Binding specificity can be determined by any suitable assay in the art, for example but not limited competition binding assays, epitope mapping, etc. A scFv protein is a fusion protein in which a light chain variable region of an immunoglobulin and a heavy chain variable region of an immunoglobulin are bound by a linker, while in dsFvs, the chains have been mutated to introduce a disulfide bond to stabilize the association of the chains. Provided are also genetically engineered forms such as chimeric antibodies and heteroconjugate antibodies such as bispecific antibodies. See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, 111.); Kuby, Immunology, 3.sup.rd Ed., W.H. Freeman & Co., New York, 1997.
[0100] In certain embodiments the invention provides antibody fragments, which have the binding specificity and/or properties of the inventive antibodies. Non-limiting examples include: (1) Fab, the fragment which contains a monovalent antigen-binding fragment of an antibody molecule produced by digestion of whole antibody with the enzyme papain to yield an intact light chain and a portion of one heavy chain; (2) Fab', the fragment of an antibody molecule obtained by treating whole antibody with pepsin, followed by reduction, to yield an intact light chain and a portion of the heavy chain; two Fab' fragments are obtained per antibody molecule; (3) (Fab1). sub.2, the fragment of the antibody obtained by treating whole antibody with the enzyme pepsin without subsequent reduction; (4) F(ab').sub.2, a dimer of two Fab' fragments held together by two disulfide bonds; (5) Fv, a genetically engineered fragment containing the variable region of the light chain and the variable region of the heavy chain expressed as two chains; and (6) single chain antibody ("SCA"), a genetically engineered molecule containing the variable region of the light chain, the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule. In certain embodiments, the antibody fragments can be produces recombinantly.
[0101] In certain embodiments, VH refers to the variable region of an immunoglobulin heavy chain, including but not limited to that of an antibody fragment, such as Fv, scFv, dsFv or Fab. In certain embodiments, VL refers to the variable region of an immunoglobulin light chain, including but not limited to that of an Fv, scFv, dsFv or Fab.
[0102] Any of the nucleic acids encoding any of the antibodies, or fragment thereof can be expressed in a recombinantly engineered cell such as bacteria, plant, yeast, insect and mammalian cells. The nucleic acid sequences include any sequence necessary for expression, including but not limited to a promoter, a leader sequence. These antibodies can be expressed as individual VH and/or VL chain, or can be expressed as a fusion protein. In certain embodiments, the antibodies can be expressed by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447).
[0103] To create a single chain antibody, (scFv) the VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gl Y4-Ser) 3, such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VH and VL domains joined by the flexible linker (see, e.g., Bird et al., Science 242:423-426, 1988; Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883, 1988; McCafferty et al., Nature 348:552-554, 1990). Optionally, a cleavage site can be included in a linker, such as a furin cleavage site.
[0104] In some embodiments, a single chain antibody may be monovalent, if only a single VH and VL are used, bivalent, if two VH and VL are used, or polyvalent, if more than two VH and VL are used. Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope. Bispecific or polyvalent antibodies may be generated that bind specifically to different epitopes within the envelope, and/or to another molecule.
[0105] There are numerous expression systems available for expression of proteins including E. coli, other bacterial hosts, yeast, and various higher eukaryotic cells such as the COS, CHO, HeLa and myeloma cell lines.
[0106] The antibodies described herein, or fragments thereof, may be recombinantly produced in prokaryotic or eukaryotic expression systems. These systems are well described in the art. In general, protein therapeutics are produced from mammalian cells. The most widely used host mammalian cells are Chinese hamster ovary (CHO) cells and mouse myeloma cells, including NS0 and Sp2/0 cells. Two derivatives of the CHO cell line, CHO-K1 and CHO pro-3, gave rise to the two most commonly used cell lines in large scale production, DUKX-X11 and DG44. (See, e.g., Kim, J., et al., "CHO cells in biotechnology for production of recombinant proteins: current state and further potential," Appl. Microbiol. Biotechnol., 2012, 93 :917-30, which is hereby
incorporated-by-reference.) Other mammalian cell lines for recombinant antibody expression include, but are not limited to, COS, HeLa, HEK293T, U20S, A549, HT1080, CAD, P19, NIH 3T3, L929, N2a, HEK 293, MCF-7, Y79, SO-Rb50, HepG2, J558L, and BHK. If the aim is large- scale production, the most currently used cells for this application are CHO cells. Guidelines to cell engineering for mAbs production were also reported. (Costa et al., "Guidelines to cell engineering for monoclonal antibody production," Eur JPharm Biopharm, 2010, 74: 127-38, which is hereby incorporated-by-reference.) Using heterologous promoters, enhancers and amplifiable genetic markers, the yields of antibody and antibody fragments can be increased. Thus, in certain embodiments, the invention provides an antibody, or antibody fragment, that is recombinantly produced from a mammalian cell-line, including a CHO cell-line. In certain embodiments, the invention provides a composition comprising an antibody, or antibody fragment, wherein the antibody or antibody fragment was recombinantly produced in a mammalian cell-line, and wherein the antibody or antibody fragment is present in the composition at a concentration of at least 1, 10, 100, 1000 micrograms/mL, or at a concentration of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or 100 milligrams/mL.
[0107] Furthermore, large-scale production of therapeutic-grade antibodies are much different than those for laboratory scale. There are extreme purity requirements for therapeutic-grade. Large- scale production of therapeutic-grade antibodies requires multiples steps, including product recovery for cell-culture harvest (removal of cells and cell debris), one or more chromatography steps for antibody purification, and formulation (often by tangential filtration). Because mammalian cell culture and purification steps can introduce antibody variants that are unique to the recombinant production process (i.e., antibody aggregates, N- and C- terminal variants, acidic variants, basic variants, different glycosylation profiles), there are recognized approaches in the art for analyzing and controlling these variants. (See, Fahrner, et al., Industrial purification of pharmaceutical antibodies: Development, operation, and validation of chromatography processes, Biotech. Gen. Eng. Rev., 2001, 18:301-327, which is hereby incorporated-by-reference.) In certain embodiments of the invention, the antibody composition comprises less than 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 50, or 100 nanograms of host cell protein (i.e., proteins from the cell-line used to recombinantly produce the antibody)). In other embodiments, the antibody composition comprises less than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 ng of protein A per milligram of antibody or antibody fragment (i.e., protein A is a standard approach for purifying antibodies from recombinant cell culture, but steps should be done to limit the amount of protein A in the composition, as it may be immunogenic). (See, e.g., U.S. Patent No. 7,458,704, Reduced protein A leaching during protein A affinity chromatography; which is hereby incorporated-by-reference.)
[0108] In certain embodiments, the invention provides monoclonal antibodies. In certain embodiments the monoclonal antibodies are produced by a clone of B -lymphocytes. In certain embodiments the monoclonal antibody is a recombinant and is produced by a host cell into which the light and heavy chain genes of a single antibody have been transfected. Any suitable cell could be used for transfection and expression of the antibodies of the invention. Suitable cell lines include without limitation 293T cells or CHO cells.
[0109] Monoclonal antibodies are produced by any suitable method known to those of skill in the art. In some embodiments, monoclonal antibodies are produced by immortalizing B-cell expressing an antibody. Methods for immortalizing B-cells are known in the art, for example but not limited to using EBV transformation, treatment with various stimulants, and/or apoptotic inhibitors (Bonsignori et al. J. Virol. 85: 9998-10009, 2011). In some embodiments, monoclonal antibodies are produced by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells to make hybridomas. In some embodiments monoclonal antibodies are identified from a subject, for example but not limited as described in Example 1 (Liao HX et al. J Virol Methods. 2009 Jun; 158(l-2): 171-9). The amino acid and nucleic acid sequences of such identified monoclonal antibodies can be determined.
[0110] The antibodies of the invention can be of any isotype. In certain embodiments, the antibodies of the invention can be used as IgGl, IgG2, IgG3, IgG4, whole IgGl or IgG3s, whole monomelic IgAs, dimeric IgAs, secretory IgAs, IgMs as monomelic, pentameric or other polymer forms of IgM. The class of an antibody comprising the VH and VL chains described herein can be specifically switched to a different class of antibody by methods known in the art.
[0111] In some embodiments, the nucleic acid encoding the VH and VL can encode an Fc domain (immunoadhesin). The Fc domain can be an IgA, IgM or IgG Fc domain. The Fc domain can be an optimized Fc domain, as described in U.S. Published Patent Application No. 20100093979, incorporated herein by reference. In one example, the immunoadhesin is an IgGl Fc. In one example, the immunoadhesin is an IgG3 Fc.
[0112] In certain embodiments the antibodies comprise amino acid alterations, or combinations thereof, for example in the Fc region outside of epitope binding, which alterations can improve their properties. Various Fc modifications are known in the art. Amino acid numbering is according to the EU Index in Kabat. In some embodiments, the invention contemplates antibodies comprising mutations that affect neonatal Fc receptor (FcRn) binding, antibody half-life, and localization and persistence of antibodies at mucosal sites. See e.g. Ko SY et al., Nature 514: 642-
45, 2014, at Figure la and citations therein; Kuo, T. and and Averson, V., mAbs 3(5): 422-430,
2011, at Table 1, US Pub 20110081347 (an aspartic acid at Kabat residue 288 and/or a lysine at
Kabat residue 435), US Pub 20150152183 for various Fc region mutation, incorporated by reference in their entirety. In certain embodiments, the antibodies comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via NK cells
(AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid). Other antibody mutations have been reported to improve antibody half-life or function or both and can be incorporated in sequences of the antibodies. These include the DLE set of mutations (Romain G, et al. Blood 124: 3241, 2014), the LS mutations M428L/N434S, alone or in a combination with other Fc region mutations, (Ko SY et al. Nature 514: 642-45, 2014, at Figure la and citations therein; Zlevsky et al., Nature Biotechnology, 28(2): 157-159, 2010; US Pub 20150152183); the YTE Fc mutations (Robbie G et al Antimicrobial Agents and Chemotherapy 12: 6147-53, 2013) as well as other engineered mutations to the antibody such as QL mutations, HfH mutations (Ko SY et al. Nature 514: 642-45, 2014, at Figure la and relevant citations; See also Rudicell R et al. J. Virol 88: 12669-82, 201). In some embodiments, modifications, such as but not limited to antibody fucosylation, may affect interaction with Fc receptors (See e.g. Moldt, et al. JVI 86(11): 66189-6196, 2012). In some embodiments, the antibodies can comprise modifications, for example but not limited to glycosylation, which reduce or eliminate polyreactivity of an antibody. See e.g. Chuang, et al. Protein Science 24: 1019-1030, 2015. In some embodiments the antibodies can comprise modifications in the Fc domain such that the Fc domain exhibits, as compared to an unmodified Fc domain enhanced antibody dependent cell mediated cytotoxicity (ADCC); increased binding to Fc.gamma.RIIA or to Fc.gamma.RIIIA; decreased binding to Fc.gamma.RIIB; or increased binding to Fc.gamma.RIIB. See e.g. US Pub 20140328836.
[0113] In certain embodiments, antibodies of the invention including but not limited to antibodies comprising a CDR(s) of VH and/or VL chains, or antibody fragments of the inventive antibodies can be used as the HIV-1 binding arm(s) of a bispecific molecule, e.g. DARTS, diabodies, toxin labeled HIV-1 binding molecules.
[0114] In accordance with the methods of the present invention, either the intact antibody or a fragment thereof can be used. Either single chain Fv, bispecific antibody for T cell engagement, or chimeric antigen receptors can be used (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). That is, in non-limiting embodiments, intact antibody, a Fab fragment, a diabody, or a bispecific whole antibody can be used to inhibit HIV-1 infection in a subject (e.g., a human). A bispecific F(ab)2 can also be used with one arm a targeting molecule like CD3 to deliver it to T cells and the other arm the arm of the native antibody (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). Toxins that can be bound to the antibodies or antibody fragments described herein include unbound antibody, radioisotopes, biological toxins, boronated dendrimers, and immunoliposomes (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). Toxins (e.g., radionucleotides or other radioactive species) can be conjugated to the antibody or antibody fragment using methods well known in the art (Chow et al, Adv. Exp. Biol. Med. 746: 121-41 (2012)). The invention also includes variants of the antibodies (and fragments) disclosed herein, including variants that retain the ability to bind to recombinant Env protein, the ability to bind to the surface of virus-infected cells and/or ADCC- mediating properties of the antibodies specifically disclosed, and methods of using same to, for example, reduce HIV-1 infection risk. Combinations of the antibodies, or fragments thereof, disclosed herein can also be used in the methods of the invention.
[0115] Antibodies of the invention and fragments thereof can be produced recombinantly using nucleic acids comprising nucleotide sequences encoding VH and VL sequences selected from those shown in the figures and examples.
[0116] In certain embodiments the invention provides intact/whole antibodies. In certain embodiments the invention provides antigen binding fragments thereof. Typically, fragments compete with the intact antibody from which they were derived for specific binding to the target including separate heavy chains, light chains Fab, Fab', F(ab').sub.2, F(ab)c, diabodies, Dabs, nanobodies, and Fv. Fragments can be produced by recombinant DNA techniques, or by enzymatic or chemical separation of intact immunoglobulins.
[0117] In certain embodiments the invention provides a bispecific antibody. A bispecific or bifunctional/dual targeting antibody is an artificial hybrid antibody having two different heavy /light chain pairs and two different binding sites (see, e.g., Romain Rouet & Daniel Christ "Bispecific antibodies with native chain structure" Nature Biotechnology 32, 136-137 (2014); Garber
"Bispecific antibodies rise again" Nature Reviews Drug Discovery 13, 799-801 (2014), Figure la;
Byrne et al. "A tale of two specificities: bispecific antibodies for therapeutic and diagnostic applications" Trends in Biotechnology, Volume 31, Issue 11, November 2013, Pages 621-632
Songsivilai and Lachmann, Clin. Exp. Immunol., 79:315-321 (1990); Kostelny et al., J. Immunol.
148: 1547-53 (1992) (and references therein)). In certain embodiments the bispecific antibody is a whole antibody of any isotype. In other embodiments it is a bispecific fragment, for example but not limited to F(ab)2 fragment. In some embodiments, the bispecific antibodies do not include Fc portion, which makes these diabodies relatively small in size and easy to penetrate tissues.
[0118] In certain embodiments, the bispecific antibodies could include Fc region. Fc bearing diabodies, for example but not limited to Fc bearing DARTs are heavier, and could bind neonatal
Fc receptor, increasing their circulating half-life. See Garber "Bispecific antibodies rise again"
Nature Reviews Drug Discovery 13, 799-801 (2014), Figure la; See US Pub 20130295121, incorporated by reference in their entirety. In certain embodiments, the invention encompasses diabody molecules comprising an Fc domain or portion thereof (e.g. a CH2 domain, or CH3 domain). The Fc domain or portion thereof may be derived from any immunoglobulin isotype or allotype including, but not limited to, IgA, IgD, IgG, IgE and IgM. In some embodiments, the Fc domain (or portion thereof) is derived from IgG. In some embodiments, the IgG isotype is IgGl,
IgG2, IgG3 or IgG4 or an allotype thereof. In some embodiments, the diabody molecule comprises an Fc domain, which Fc domain comprises a CH2 domain and CH3 domain independently selected from any immunoglobulin isotype (i.e. an Fc domain comprising the CH2 domain derived from IgG and the CH3 domain derived from IgE, or the CH2 domain derived from IgGl and the CH3 domain derived from IgG2, etc.). In some embodiments, the Fc domain may be engineered into a polypeptide chain comprising the diabody molecule of the invention in any position relative to other domains or portions of the polypeptide chain (e.g., the Fc domain, or portion thereof, may be c-terminal to both the VL and VH domains of the polypeptide of the chain; may be n-terminal to both the VL and VH domains; or may be N-terminal to one domain and c-terminal to another (i.e., between two domains of the polypeptide chain)).
[0119] The present invention also encompasses molecules comprising a hinge domain. The hinge domain be derived from any immunoglobulin isotype or allotype including IgA, IgD, IgG, IgE and IgM. In preferred embodiments, the hinge domain is derived from IgG, wherein the IgG isotype is IgGl, IgG2, IgG3 or IgG4, or an allotype thereof. The hinge domain may be engineered into a polypeptide chain comprising the diabody molecule together with an Fc domain such that the diabody molecule comprises a hinge-Fc domain. In certain embodiments, the hinge and Fc domain are independently selected from any immunoglobulin isotype known in the art or exemplified herein. In other embodiments the hinge and Fc domain are separated by at least one other domain of the polypeptide chain, e.g., the VL domain. The hinge domain, or optionally the hinge-Fc domain, may be engineered in to a polypeptide of the invention in any position relative to other domains or portions of the polypeptide chain. In certain embodiments, a polypeptide chain of the invention comprises a hinge domain, which hinge domain is at the C-terminus of the polypeptide chain, wherein the polypeptide chain does not comprise an Fc domain. In yet other embodiments, a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the C-terminus of the polypeptide chain. In further embodiments, a polypeptide chain of the invention comprises a hinge-Fc domain, which hinge-Fc domain is at the N-terminus of the polypeptide chain.
[0120] In some embodiments, the invention encompasses multimers of polypeptide chains, each of which polypeptide chains comprise a VH and VL domain, comprising CDRs as described herein. In certain embodiments, the VL and VH domains comprising each polypeptide chain have the same specificity, and the multimer molecule is bivalent and monospecific. In other embodiments, the VL and VH domains comprising each polypeptide chain have differing specificity and the multimer is bivalent and bispecific. In some embodiments, the polypeptide chains in multimers further comprise an Fc domain. Dimerization of the Fc domains leads to formation of a diabody molecule that exhibits immunoglobulin-like functionality, i.e., Fc mediated function (e.g., Fc-Fc.gamma.R interaction, complement binding, etc.). [0121] In yet other embodiments, diabody molecules of the invention encompass tetramers of polypeptide chains, each of which polypeptide chain comprises a VH and VL domain. In certain embodiments, two polypeptide chains of the tetramer further comprise an Fc domain. The tetramer is therefore comprised of two 'heavier polypeptide chains, each comprising a VL, VH and Fc domain, and two lighter polypeptide chains, comprising a VL and VH domain. Interaction of a heavier and lighter chain into a bivalent monomer coupled with dimerization of the monomers via the Fc domains of the heavier chains will lead to formation of a tetravalent immunoglobulin-like molecule (exemplified in Example 6.2 and Example 6.3). In certain aspects the monomers are the same, and the tetravalent diabody molecule is monospecific or bispecific. In other aspects the monomers are different, and the tetra valent molecule is bispecific or tetraspecific.
[0122] Formation of a tetraspecific diabody molecule as described supra requires the interaction of four differing polypeptide chains. Such interactions are difficult to achieve with efficiency within a single cell recombinant production system, due to the many variants of potential chain mispairings. One solution to increase the probability of mispairings, is to engineer "knobs-into-holes" type mutations into the desired polypeptide chain pairs. Such mutations favor heterodimerization over homodimerization. For example, with respect to Fc-Fc-interactions, an amino acid substitution (preferably a substitution with an amino acid comprising a bulky side group forming a 'knob' , e.g., tryptophan) can be introduced into the CH2 or CH3 domain such that steric interference will prevent interaction with a similarly mutated domain and will obligate the mutated domain to pair with a domain into which a complementary, or accommodating mutation has been engineered, i.e., 'the hole' (e.g., a substitution with glycine). Such sets of mutations can be engineered into any pair of polypeptides comprising the diabody molecule, and further, engineered into any portion of the polypeptides chains of the pair. Methods of protein engineering to favor heterodimerization over homodimerization are well known in the art, in particular with respect to the engineering of immunoglobulin-like molecules, and are encompassed herein (see e.g., Ridgway et al. (1996) " Knobs-Into-Holes' Engineering Of Antibody CH3 Domains For Heavy Chain
Heterodimerization," Protein Engr. 9:617-621, Atwell et al. (1997) "Stable Heterodimers From Remodeling The Domain Interface Of A Homodimer Using A Phage Display Library," J. Mol. Biol. 270: 26-35, and Xie et al. (2005) "A New Format Of Bispecific Antibody: Highly Efficient Heterodimerization, Expression And Tumor Cell Lysis," J. Immunol. Methods 296:95-101; each of which is hereby incorporated herein by reference in its entirety).
[0123] The invention also encompasses diabody molecules comprising variant Fc or variant hinge-
Fc domains (or portion thereof), which variant Fc domain comprises at least one amino acid modification (e.g. substitution, insertion deletion) relative to a comparable wild-type Fc domain or hinge-Fc domain (or portion thereof). Molecules comprising variant Fc domains or hinge-Fc domains (or portion thereof) (e.g., antibodies) normally have altered phenotypes relative to molecules comprising wild-type Fc domains or hinge-Fc domains or portions thereof. The variant phenotype may be expressed as altered serum half-life, altered stability, altered susceptibility to cellular enzymes or altered effector function as assayed in an NK dependent or macrophage dependent assay. Fc domain variants identified as altering effector function are known in the art. For example International Application WO04/063351, U.S. Patent Application Publications 2005/0037000 and 2005/0064514.
[0124] The bispecific diabodies of the invention can simultaneously bind two separate and distinct epitopes. In certain embodiments the epitopes are from the same antigen. In other embodiments, the epitopes are from different antigens. In preferred embodiments, at least one epitope binding site is specific for a determinant expressed on an immune effector cell (e.g. CD3, CD16, CD32, CD64, etc.) which are expressed on T lymphocytes, natural killer (NK) cells or other mononuclear cells. In one embodiment, the diabody molecule binds to the effector cell determinant and also activates the effector cell. In this regard, diabody molecules of the invention may exhibit Ig-like functionality independent of whether they further comprise an Fc domain (e.g., as assayed in any effector function assay known in the art or exemplified herein (e.g., ADCC assay).
[0125] Non-limiting examples of bispecific antibodies can also be (1) a dual-variable-domain antibody (DVD-Ig), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage (Wu et al., Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-Ig. TM.) Molecule, In: Antibody Engineering, Springer Berlin Heidelberg (2010)); (2) a Tandab, which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (3) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (4) a so called "dock and lock" molecule, based on the "dimerization and docking domain" in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to a different Fab fragment; (5) a so-called Scorpion molecule, comprising, e.g., two scFvs fused to both termini of a human Fc-region. Examples of platforms useful for preparing bispecific antibodies include but are not limited to BiTE (Micromet), DART (MacroGenics) (e,g, US Patents 8,795,667; No. 2014-0099318; 2013-0295121; 2010- 0174053 and 2009-0060910; European Patent Publication No. EP 2714079; EP 2601216; EP 2376109; EP 2158221 and PCT Publications No. WO 2015/026894; WO 2015/026892; WO 2015/021089; WO 2014/159940; WO 2012/162068; WO 2012/018687; WO 2010/080538), the content of each of these publications in herein incorporated by reference in its entirety), Fcab and Mab2 (F-star), Fc-engineered IgGl (Xencor) or DuoBody (based on Fab arm exchange, Genmab).
[0126] In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment, for example but not limited to an HIV envelope binding fragment from any of the antibodies described herein. In other embodiments, the bispecific antibody further comprises a second antigen-interaction-site/fragment. In other embodiments, the bispecific antibody further comprises at least one effector domain.
[0127] In certain embodiments the bispecific antibodies engage cells for Antibody-Dependent Cell- mediated Cytotoxicity (ADCC). In certain embodiments the bispecific antibodies engage natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. In certain embodiments the bispecific antibodies are T-cell engagers. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD3 binding fragment. Various CD3 antibodies are known in the art. See for example US Patent 8,784,821. In certain embodiments, the bispecific antibody comprises an HIV envelope binding fragment and CD 16 binding fragment.
[0128] In certain embodiments the invention provides antibodies with dual targeting specificity. In certain aspects the invention provides bi-specific molecules that are capable of localizing an immune effector cell to an HIV-1 envelope expressing cell, so as facilitate the killing of the HIV-1 envelope expressing cell. In this regard, bispecific antibodies bind with one "arm" to a surface antigen on target cells, and with the second "arm" to an activating, invariant component of the T cell receptor (TCR) complex. The simultaneous binding of such an antibody to both of its targets will force a temporary interaction between target cell and T cell, causing activation of any cytotoxic T cell and subsequent lysis of the target cell. Hence, the immune response is re-directed to the target cells and is independent of peptide antigen presentation by the target cell or the specificity of the T cell as would be relevant for normal MHC -restricted activation of CTLs. In this context it is crucial that CTLs are only activated when a target cell is presenting the bispecific antibody to them, i.e. the immunological synapse is mimicked. Particularly desirable are bispecific antibodies that do not require lymphocyte preconditioning or co-stimulation in order to elicit efficient lysis of target cells.
[0129] Several bispecific antibody formats have been developed and their suitability for T cell mediated immunotherapy investigated. Out of these, the so-called BiTE (bispecific T cell engager) molecules have been very well characterized and already shown some promise in the clinic
(reviewed in Nagorsen and Bauerle, Exp Cell Res 317, 1255-1260 (2011)). BiTEs are tandem scFv molecules wherein two scFv molecules are fused by a flexible linker. Further bispecific formats being evaluated for T cell engagement include diabodies (Holliger et al., Prot Eng 9, 299-305 (1996)) and derivatives thereof, such as tandem diabodies (Kipriyanov et al., J Mol Biol 293, 41-66 (1999)). DART (dual affinity retargeting) molecules are based on the diabody format that separates cognate variable domains of heavy and light chains of the two antigen binding specificities on two separate polypeptide chains but feature a C-terminal disulfide bridge for additional stabilization (Moore et al., Blood 117, 4542-51 (2011)). The invention also contemplates Fc-bearing DARTs. The so-called triomabs, which are whole hybrid mouse/rat IgG molecules and also currently being evaluated in clinical trials, represent a larger sized format (reviewed in Seimetz et al., Cancer Treat Rev 36, 458-467 (2010)).
[0130] The invention also contemplates bispecific molecules with enhanced pharmacokinetic properties. In some embodiments, such molecules are expected to have increased serum half-life. In some embodiments, these are Fc-bearing DARTs (see supra).
[0131] In certain embodiments, such bispecific molecules comprise one portion which targets HIV- 1 envelope and a second portion which binds a second target. In certain embodiments, the first portion comprises VH and VL sequences, or CDRs from the antibodies described herein. In certain embodiments, the second target could be, for example but not limited to an effector cell. In certain embodiments the second portion is a T-cell engager. In certain embodiments, the second portion comprises a sequence/paratope which targets CD3, CD16, or another suitable target. In certain embodiments, the second portion is an antigen-binding region derived from a CD3 antibody, optionally a known CD3 antibody. In certain embodiments, the anti-CD antibody induce T cell- mediated killing. In certain embodiments, the bispecific antibodies are whole antibodies. In other embodiments, the dual targeting antibodies consist essentially of Fab fragments. In other embodiments, the dual targeting antibodies comprise a heavy chain constant region (CHI . In certain embodiments, the bispecific antibody does not comprise Fc region. In certain embodiments, the bispecific antibodies have improved effector function. In certain embodiments, the bispecific antibodies have improved cell killing activity. Various methods and platforms for design of bispecific antibodies are known in the art. See for example US Pub. 20140206846, US Pub.
20140170149, US Pub. 20090060910, US Pub 20130295121, US Pub. 20140099318, US Pub. 20140088295 which contents are herein incorporated by reference in their entirety.
[0132] In certain embodiments the invention provides human, humanized and/or chimeric antibodies.
[0133] Pharmaceutical compositions
[0134] In certain aspects the invention provides a pharmaceutical composition comprising an antibody of the invention wherein the composition is used for therapeutic purposes such as but not limited to prophylaxis, treatments, prevention, and/or cure. In certain aspects the invention provides a pharmaceutical composition comprising an antibody of the invention in combination with any other suitable antibody. In certain embodiments, the pharmaceutical compositions comprise nucleic acids which encode the antibodies of the invention. In certain embodiments, these nucleic acids can be expressed by any suitable vector for expression of antibodies. Non- limiting examples include attenuated viral hosts or vectors or bacterial vectors, recombinant vaccinia virus, adenovirus, adeno-associated virus (AAV), herpes virus, retrovirus,
cytomegalovirus or other viral vectors can be used to express the antibody.
[0135] Various methods to make pharmaceutical compositions are known in the art and are contemplated by the invention. In some embodiments, the compositions include excipient suitable for a biologic molecule such as the antibodies of the invention. In some embodiments, the antibodies could be produced in specific cell lines and conditions so as to control glycosylation of the antibody. In some embodiments, the antibody framework for example, could comprise specific modification so as to increase stability of the antibody.
[0136] In certain aspects, the invention provides that the antibodies, and fragments thereof, described herein can be formulated as a composition (e.g., a pharmaceutical composition). Suitable compositions can comprise an inventive antibody (or antibody fragment) dissolved or dispersed in a pharmaceutically acceptable carrier (e.g., an aqueous medium). The compositions can be sterile and can be in an injectable form (e.g. but not limited to a form suitable for intravenous injection, intramascular injection). The antibodies (and fragments thereof) can also be formulated as a composition appropriate for topical administration to the skin or mucosa. Such compositions can take the form of liquids, ointments, creams, gels and pastes. The antibodies (and fragments thereof) can also be formulated as a composition appropriate for intranasal administration. The antibodies (and fragments thereof) can be formulated so as to be administered as a post-coital douche or with a condom. Standard formulation techniques can be used in preparing suitable compositions.
[0137] The antibody (and fragments thereof), described herein have utility, for example, in settings including but not limited to the following:
i) in the setting of anticipated known exposure to HIV-1 infection, the antibodies described herein (or fragments thereof) and be administered prophylactically (e.g., IV, topically or intranasally) as a microbiocide,
ii) in the setting of known or suspected exposure, such as occurs in the setting of rape victims, or commercial sex workers, or in any homosexual or heterosexual transmission without condom protection, the antibodies described herein (or fragments thereof) can be administered as post-exposure prophylaxis, e.g., IV or topically, and iii) in the setting of Acute HIV infection (AHI), the antibodies described herein (or fragments thereof) can be administered as a treatment for AHI to control the initial viral load or for the elimination of virus-infected CD4 T cells.
[0138] In accordance with the invention, the antibodies (or antibody fragments) described herein can be administered prior to contact of the subject or the subject's immune system/cells with HIV-1 or within about 48 hours of such contact. Administration within this time frame can maximize inhibition of infection of vulnerable cells of the subject with HIV-1.
[0139] In addition, various forms of the antibodies described herein can be administered to chronically or acutely infected HIV patients and used to kill remaining virus infected cells by virtue of these antibodies binding to the surface of virus infected cells and being able to deliver a toxin to these reservoir cells.
[0140] Suitable dose ranges can depend on the antibody (or fragment) and on the nature of the formulation and route of administration. Optimum doses can be determined by one skilled in the art without undue experimentation. For example but not limited, doses of antibodies in the range of 0.1-50 mg/kg, 1-50 mg/kg, 1-10 mg/kg, 1, 1.25, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5 or 10 mg/kg of unlabeled or labeled antibody (with toxins or radioactive moieties) can be used. If antibody fragments, with or without toxins are used or antibodies are used that can be targeted to specific CD4 infected T cells, then less antibody can be used (e.g., from 5 mg/kg to 0.01 mg/kg). In other embodiments, the antibodies of the invention can be administered at a suitable fixed dose, regardless of body size or weight. See Bai et al. Clinical Pharmacokinetics February 2012, Volume 51, Issue 2, pp 119-135.
[0141] In certain aspects the invention provides use of the antibodies of the invention, including bispecific antibodies, in methods of treating and preventing HIV-1 infection in an individual, comprising administering to the individual a therapeutically effective amount of a composition comprising the antibodies of the invention in a pharmaceutically acceptable form. In certain embodiment, the methods include a composition which includes more than one HIV-1 targeting antibody. In certain embodiments, the HIV-1 targeting antibodies in such combination bind different epitopes on the HIV-1 envelope. In certain embodiments, such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased killing of HIV-1 infected cells.
In other embodiments, such combinations of bispecific antibodies targeting more than one HIV-1 epitope provide increased breadth in recognition of different HIV-1 subtypes.
[0142] In certain embodiments, the composition comprising the antibodies of the invention alone or in any combination can be administered via EVI, subcutaneous, or IV delivery, or could be deposited at mucosal sites, such as the oral cavity to prevent maternal to child transmission, the rectal space or the vagina as a microbicide. In certain embodiments, the antibodies can be administered locally in the rectum, vagina, or in the oral cavity, and can be formulated as a microbiocide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525.; Multipurpose prevention technologies for reproductive and sexual health. Stone A. Reprod Health Matters. 2014 Nov;22(44):213-7. doi: 10.1016/S0968-8080(14)44801-8). In other embodiments, antibodies can be formulated such that the therapeutic antibody or combination thereof is impregnated on a vaginal ring (Chen Y et al. Drug Des. Devel. Ther 8: 1801-15, 2014;Malcolm RK et al BJOG 121 Suppl 5: 62-9, 2014). Antibodies can be administered alone or with anti-retroviral drugs for a combination microbicide (Hladik F et al ELIFE Elife. 2015 Feb 3;4. doi: 10.7554/eLife.04525).
[0143] Alternatively they can be administered in complex with a form of HIV Env, optimally gpl20, but also an Env trimer, to enhance Env immunogenicity. In certain embodiments, the antibodies can be delivered by viral vector mediated delivery of genes encoding the antibodies of the invention (See e.g. Yang et al. Viruses 2014, 6, 428-447). In certain embodiments, the antibodies can be administered in viral vector, for example but not limited to adenoassociated viral vector, for expression in muscle and plasma.
[0144] In certain embodiments, antibodies with different binding specificities are combined for use in pharmaceutical compositions and therapeutic methods. For example: CD4 binding site antibodies are combined with V3 antibodies, MPER antibodies and so forth. Figures 2, 3, and 4 show a selection of potent HIV-1 neutralizing antibodies which can be used in pharmaceutical compositions, and therapeutic methods. Non-limiting examples of selections of combinations of certain antibodies include: DH542, DH542 L4, DH542 QSA, DH429 and DH512 (or any of the DH512 variants); DH512 and CH31 (See US Publication20140205607); DH512 (or any of the DH512 variants ) and DH540 (See Example 9, and this antibody will be described elsewhere); DH542, DH542 L4, DH542 QSA, DH429, DH512 and DH540; DH542, DH542 L4,
DH542 QSA, DH429 and CH557; CH557 and DH512 (or any of the DH512 variants). These combinations are expected to give a greater overall potency and breadth. A polyclonal mixture of Abs is expected reduce or eliminate viral escape. It is readily understood by skilled artisans that in some embodiments a combination therapy envisions a composition which combines various antibodies. In other embodiments a combination therapy is provided wherein antibodies are administered as individual compositions, for example at different times, by different means, or at administered at different locations. In other embodiments, a combination therapy is provides wherein a therapeutic antibody or antibodies is combined with other therapeutic means, for example anti-retroviral drug cocktails, or drugs which activate latently infected HIV-1 cells. [0145] In some embodiments, the disclosed antibodies or antigen binding fragments thereof are used to determine whether HIV-1 envelope(s) is a suitable antigen for inclusion in a vaccine composition. For example the antibodies can be used to determine whether an antigen in a vaccine composition including gpl20 assumes a conformation including an epitope bound by the inventive antibodies or fragments thereof. This can be readily determined by a method which includes contacting a sample containing the vaccine, such as a gpl20 antigen, with a disclosed antibody or antigen binding fragment under conditions sufficient for formation of an immune complex, and detecting the immune complex, to detect an HIV-1 antigen including an epitope of an inventive antibody in the sample. In one example, the detection of the immune complex in the sample indicates that vaccine component, such as a HIV-1 Env antigen assumes a conformation capable of binding the antibody or antigen binding fragment.
[0146] The following examples are provided to illustrate particular features of certain
embodiments, but the scope of the claims should not be limited to those features exemplified.
Examples
Example 1: Isolating antibodies from natural HIV-1 infected individuals
[0147] Methods to identify and isolate antigen specific reactive antibodies were carried out essentially as described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009. Specific hooks are designed to identify antibodies which bind to specific HIV-1 envelope targets/antigens. Using such hooks, with fluorophore labeled streptavidin in two colors, cells are sorted by flow cytometry, into single wells, and the diagonally (that reacted with both colors hooks) reactive memory B cells are picked. B cells enriched from PBMC are sorted, and plated at limiting dilution (as single cell per well). Optionally, these cultures are grown and supernatants are functionally characterized.
[0148] PCR on these cells is carried out according to the protocol in Liao HX et al. J. Virol.
Methods 158: 171-9, 2009. PCR amplifications are carried out to amplify rearranged VH and VL fragment pairs from the diagonally sorted memory B cells (Liao et al JVM). Overlapping PCR is used to construct full length Ig heavy and Ig light linear genes comprising the rearranged VH and VL fragment pairs. RT-PCR and PCR reactions is carried out essentially as described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009, see for example Figure 1, Section 3.3. Sequence analysis of the VH and VL genes was carried out to determine the VH and VL gene usage, CDR lengths, the % mutation of HCDR3 and LCDR3. Based on this sequence analysis, one to two pairs of linear VH and VL genes are selected and made in linear cassettes (essentially as described in Liao HX et al. J. Virol. Methods 158: 171-9, 2009, see for example Figure 1, Section 3.3) to produce recombinant monoclonal antibodies by transient transfection, e.g. in 293T cells.
[0149] Recombinant antibodies are grown and supernatants and/or purified antibodies are functionally characterized.
[0150] Pairs of VH and VL genes as selected above can also be used to produce plasmids for stable expression of recombinant antibodies. In certain embodiments, the plasmids or linear constructs for recombinant antibody expression also comprise AAAA substitution in and around the Fc region of the antibody that has been reported to enhance ADCC via K cells (AAA mutations) containing the Fc region aa of S298A as well as E333A and K334A (Shields RI et al JBC , 276: 6591-6604, 2001) and the 4th A (N434A) is to enhance FcR neonatal mediated transport of the IgG to mucosal sites (Shields RI et al. ibid).
[0151] The antibodies of the invention were selected based on a combination of criteria including sequence analyses, and functional analyses including but not limited as neutralization breadth, and potency.
[0152] In certain embodiments, the antibodies of the invention comprise naturally rearranged VH and VL fragment pairs, wherein the rest of the Ig gene is not naturally occurring with the identified rearranged VH and VL fragments. In certain embodiments, the antibodies of the invention are recombinantly produced.
Example 2: TZM-bl cells pseudo-viruses neutralization assay
[0153] TZMbl neutralization assay is a standard way to evaluate antibody breadth and potency. See Montefiori, D. Methods Mol Biol. 2009;485:395-405; HIV-1 Env-pseudoviruses infection of TZM-bl cells. Exemplary pseudovirus neutralization assays and panels of HIV-1 pseudovirus are described for example, in Li et al., J Virol 79, 10108-10125, 2005, Seaman et al, J. Virol., 84: 1439-1452, 2010; Sarzotti-Kelsoe et al., J. Immunol. Methods, 409: 131-46, 2014; and
WO2011/038290, each of which is incorporated by reference herein. Various HIV-1 isolates, both Tier 1 and Tier 2 viruses can be included in this assay.
[0154] The TZMbl assay was conducted to determine neutralization potency and breadth of the various antibodies of the invention on different HIV-1 pseudoviruses.
[0155] Figure 27A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC50 in μg/ml.
[0156] Figure 27B shows the mean IC50 and percent of isolates neutralized at different IC50 values. Figure 28A shows summary results of neutralization data of CH557, CH235, VRCOl, VRC07-523-LS, N6, 3BNC117, 8ANC131, CH103, F105, and DH522 against a panel of HIV-1 isolates in the Luc/TZM-bl neutralization assay. Values represent IC80 in μg/ml.
[0157] Figure 28B shows the mean IC80 and percent of isolates neutralized at different
IC80<50ug/ml values.
Example 3: Epitope mapping of antibodies
[0158] Binding and/or neutralization assays using various envelop antigens can be used to determine the envelop epitope recognized by these antibodies.
Example 4: Kd determination
[0159] Kd measurements of antibody binding to HIV-1 envelope, e.g. gpl20 or any other suitable peptide, will be determined by Surface Plasmon Resonance measurements, for example using Biacore, or any other suitable technology which permits detection of interaction between two molecules in a quantitative way.
[0160] Various assays and experiments can be designed to analyze prevention, treatment and/or cure.
Example 5: Assay for self-reactivity
[0161] Table 3 below summarizes some of the known types of disease associated antibodies.
Figure imgf000035_0001
esophogeal dysmotility, sclerodactyly and talangi ectasia Hi stones Drug induced SLE
[0162] Various assays for self-reactivity of human antibodies are known in the art. AtheNA Multi- Lyte ANA Plus Test System is one such assay. This is luminex-based assay, which is also used to screen patient sera. In our experiments the criteria for positivity is as follows: an antibody is positive for autoreactivity if reactive at 25 μg/ml.
[0163] Table 4. Summary of immunoflourescent (IF) staining of Hep2 cells data for antibodies DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
Figure imgf000036_0001
[0164] Table 5. Summary of Athena data for DH270IA1, CH491, CH493. DH270IA1 does not show self-reactivity. CH491 and CH493 show some self-reactivity in this assay.
Lot Antibody ID SSA SSB Sm RNP Scl 70 Jo 1 dsDNA Cent B Histone
294HC DH270_IAl/293i 50 5 6 5 2 4 5 32 10 9
25 3 6 5 2 1 3 18 5 4
12.5 3 6 5 3 2 6 11 3 4 6.25 5 1 3 2 2 5 6 2 2
21 KK CH491_4A 50 68 144 6 43 16 169 47 54 59
25 44 95 4 30 9 118 39 45 44
12.5 28 60 3 24 7 79 29 34 34
6.25 21 42 4 18 4 56 11 26 26
23RKK CH493_4A 50 155 70 37 69 36 198 0 94 166
25 100 38 53 55 34 167 0 129 202
12.5 54 22 42 49 26 102 0 165 200
6.25 22 15 46 32 17 54 0 177 174
[0165] Development of auto and polyreactivity during antibody maturation toward neutralization breadth is a critical aspect that may limit the ability of generating bnAbs during natural infection and upon vaccination. We have previously reported that, in subject CH505, the CD4bs CHI 03 bnAb lineage is polyreactive and, similarly to CD4 mimic VRCOl -class bnAbs, bound to human ubiquitin ligase E3A (UBE3A) with avidity correlated with neutralization (Liao et al Nature 2013; Liu et al J Virol 2015). Since CH557 is a potent and extremely broad CD4 mimic CD4bs bnAb, we compared the auto- and polyreactivity profiles of CH557 with those of early precursors of the CH235 antibody lineage (UCA, IA4, IA3, IA2, IA1, CH235, CH236, CH239, CH240 and CH241). In line with previous observations, reactivity against autoantigens developed among early CH235 lineage members with maturation. However, bnAb CH557 itself became exquisitely HIV-1 specific: it does not react with cardiolipin or other antigens associated with autoimmune disorders, it is negative in Hep-2 IF staining (Figure 25), or any of 9,400 human antigens, including UBE3 A (Figure 26A-B). Albeit reactivity against other human antigens cannot be formally ruled out, these data demonstrate that bnAb CH557 lost the auto and polyreactivity developed by its precursors, and demonstrates that decoupling neutralization breadth of CD4 mimic CDbs bnAbs from auto- and polyreactivity is an achievable goal.
[0166] Table 6. Summary of Athena assay results for CH557. Results are expressed as relative luminescence units. Readings <100 are considered negative, results between 100 and 120 are considered "indeterminate" and results >120 are considered positive. CH557 is negative for all the antigens tested at all antibody concentrations ranging from 6.25 ug/ml to 50 ug/ml.
Histon
Antibody ug/ml SSA SSB Sm RNP Scl 70 Jo 1 dsDNA Cent B e
4 e l0 50 49 263 5 4 1 190 2 3 16 25 33 227 2 3 1 160 2 3 10
12.5 21 199 3 3 0 131 3 1 7
6.25 17 178 3 3 1 113 0 2 6 synagis 50 5 6 11 10 3 5 25 9 11
25 3 7 3 4 2 2 11 4 5
12.5 2 5 7 3 3 6 7 2 3
6.25 2 5 2 3 2 1 0 2 3
CH557_4A
/293i 50 6 15 8 10 6 10 29 46 16
25 4 12 6 6 4 2 18 25 8
12.5 3 9 6 3 3 5 10 16 6
6.25 4 5 4 4 3 5 9 11 4
[0167] Table 7. Summary of Athena assay results for various other antibodies of the CH235 lineage. Results are expressed as relative luminescence units. Readings <100 are considered negative, results between 100 and 120 are considered "indeterminate" and results >120 are considered positive. CH236, CH239, CH235 IA1 and IA2 are positive for multiple antigens.
Antibody ID SSA SSB Sm RNP Scl 70 Jo 1 dsDNA Cent B Histone synagis 50 13 9 6 2 1 4 3 3 0
25 11 4 4 0 2 4 0 2 2
4E10 IgGl 50 99 207 55 28 5 227 14 14 32
25 81 189 46 20 4 206 14 9 24
CH235_4A 50 12 7 16 11 8 7 25 11 14
25 13 5 7 5 4 4 13 6 7
12.5 13 5 8 6 2 3 0 5 5
6.25 12 6 5 3 2 2 3 3 5
CH236_4A/293i 50 177 207 128 65 57 145 2 84 138
25 224 175 165 69 62 72 42 129 193
12.5 185 63 258 78 50 19 179 233 234
6.25 44 15 184 40 31 7 228 208 154 CH239_4A/293i 50 289 10 250 93 kriss 15 38 173 228
25 306 8 237 96 51 11 61 199 253
12.5 277 6 277 85 48 8 108 216 263
6.25 178 5 285 78 49 8 181 260 266
CH240_4A/293i 50 16 17 33 17 6 13 75 37 42
25 16 11 22 11 6 11 50 24 27
12.5 14 5 13 8 4 7 37 15 18
6.25 12 5 9 6 3 5 14 8 9
CH241 50 23 10 12 8 5 8 23 21 30
25 15 6 11 6 4 5 18 14 20
12.5 14 8 7 5 3 6 2 8 13
6.25 15 4 4 3 1 2 6 6 9
CH235UA/293i 50 11 3 8 5 3 3 7 5 7
25 9 3 6 4 3 5 0 3 3
12.5 9 4 6 3 3 5 4 3 4
6.25 10 5 5 2 3 3 3 2 2
CH235VH_UCAtk_v2_
4A/293i 50 14 10 13 11 5 6 22 28 17
25 11 6 10 6 3 4 13 18 11
12.5 10 7 9 7 4 6 9 10 7
6.25 10 5 7 6 3 3 4 7 5
CH235VH_ll_v2_4A/
293i 50 149 217 104 80 57 176 12 80 100
25 150 197 110 67 52 171 19 80 99
12.5 151 167 77 56 40 152 58 81 100
6.25 175 117 77 46 31 129 61 87 118
CH235VH_l2_v2_4A/
293i 50 73 69 259 101 69 55 444 256 371
25 43 36 256 93 49 26 496 228 302
12.5 34 31 279 85 44 20 617 225 287
6.25 18 15 204 66 28 12 599 183 207
CH235VH_l3_v2_4A/
293i 50 14 10 18 10 5 6 35 37 17 25 10 9 13 7 4 8 33 27 12
12.5 12 6 12 5 3 3 23 15 7
6.25 12 3 7 4 2 2 15 9 5
CH235VH_l4_v2_4A/
293i 50 12 6 12 9 4 5 15 14 13
25 12 4 12 5 2 2 7 10 9
12.5 11 3 6 4 2 3 11 5 6
6.25 11 5 6 3 2 4 4 5 4
Cat-CH106 50 12 3 5 2 3 3 6 2 2
25 8 3 1 3 2 2 3 2 3
12.5 11 5 4 2 3 3 5 2 2
6.25 10 6 5 1 2 4 7 1 2
[0168] Table 8. Summary of ELISA cardiolipin assay results for CH557 and various other antibodies. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm (OD450). OD450 < 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. CH557 did not bind to cardiolipin.
Antibody lot ug/ml 100 50 25 12.5
4 e l0 11.94 2 0997 2 346 1 9027 1 6277
synagis 1.05 0 0424 0 0474 0 0408 0 0408
Ab901754 hK/PEI ZRJ070 3.86 0 0382 0 0859 0 0299 0 0394
Ab901754RhKMut58_9 ZRJ93 2.8 0 6665 0 428 0 2898 0 1681
AbTr900114147Rh/293i 226JAH 7.44 0 4615 0 2596 0 1778 0 1018
DH522 64RKK 6.67 0 1206 0 079 0 0613 0 0491
DH522UCA_Rh/293i 362HC 13.19 0 6156 0 415 0 2179 0 1302
DH522_v2Rh/293i 363HC 6.93 0 3497 0 1652 0 1081 0 0828
DH522ll.2Rh/293i 372HC 13.99 0 5506 0 2738 0 183 0 1073
CH557_4A/293i 70RKK 11.94 0 0942 0 0761 0 0591 0 0475
DH542-293i 014RM 2.51 0 062 0 0503 0 0525 0 0511 [0169] Table 9. Summary of binding of listed antibodies to cardiolipin in ELISA. Antibodies were tested at concentrations ranging from lOOug/ml to 12.5 ug/ml. Results are expressed as optical density at wavelength of 450nm (OD450). OD450 < 0.2 are negative. Synagis is used as negative control and 4E10 is used as positive control. The majority of CH235 lineage antibodies, with the exception of CH235 IA3, IA4, CH235 and CH240 (the former has borderline binding), bound to cardiolipin.
3333333.
o
o
1 111111. synagis 0.0391 0.0375 0.0359 0.0378
4E10 3703704.
IgGl 2.3179 2.2324 2.1165 1.941
105SJ CH235
A _4A 0.1198 0.0555 0.0423 0.0411 0.0 12345684. 13 0.0377 0.0378 0.0387
CH236
121S _4A/29
Ml 3i 0.5104 0.1936 0.0849 0.0524 0.0423 0.0 04115233.82 0.0425 0.0385
CH239
98JA _4A/29
0137174.
H 3i 0.5001 0.2554 0.1078 0.0612 0.0476 0.0424 0.0386 0.0405
CH240
96GE _4A/29 0045725.
H 3i 0.194 0.0893 0.0543 0.0434 0.0399 0.0408 0.0444 0.0421
108SJ
A CH241 0.248 0.1061 0.0617 0.0491 0.0405 0.0437 0.0409 0.0384
CH235
132S UA/29
Ml 3i 0.2337 0.1074 0.0738 0.0504 0.0436 0.0417 0.0395 0.0391
DH235
VH_UC
Atk_v2
137S _4A/29
Ml 3i 0.5112 0.253 0.1353 0.0658 0.0486 0.0428 0.0415 0.0427
DH235
VH_I1_
121J v2_4A/
AH 293i 0.5321 0.2638 0.0955 0.0637 0.0473 0.0409 0.0414 0.041 DH235
VH_I2_
138S v2_4A/
Ml 293i 0.9691 0.4951 0.1929 0.0894 0.0603 0.0488 0.0582 0.0442
DH235
VH_I3_
119J v2_4A/
AH 293i 0.1317 0.0743 0.0518 0.046 0.0439 0.0412 0.0429 0.0426 synagis 0.0405 0.0453 0.0414 0.0414
4E10
IgGl 2.249 2.2353 2.105 1.9205
DH235
VH_I4_
120J v2_4A/
AH 293i 0.1076 0.0609 0.0475 0.0416 0.0439 0.0399 0.0366 0.0403
Cat- CH106 0.0437 0.0443 0.0413 0.04 0.043 0.0404 0.0399 0.0407
Example 6: Antibodies from CH235 lineage
DH493 (also referred as CH493) and DH491 (also referred as CH491)
[0170] This example describes the design and making of non-naturally occurring CD4bs broad neutralizing HIV- 1 antibodies
[0171] Monoclonal antibody CH493 was designed as follows: the heavy chain VDJ rearrangement was derived from genomic DNA deep sequencing performed on memory B cells isolated from PBMCs of the 703-01-050-5 subject (CHAVIOOl protocol) obtained 152 weeks post-infection. Other V-heavy chain VDJ rearrangement sequences were retrieved with this technology from multiple time points. Figure 20 shows the heavy chain phylogenetic tree including all the sequences retrieved with deep sequencing (in black: all except for CH240, CH239, CH235, CH236, CH241). V-light chains were not identified.
[0172] Figure 20 shows the heavy chain phylogenetic tree including all the sequences retrieved from RNA of cultured memory B cells isolated from PBMCs obtained 41 weeks post-infection (in red: CH240, CH239, CH235, CH236, CH241). V-light chains of these antibodies from cultures were also identified.
[0173] Four recombinant non-naturally occurring antibodies were produced using V-heavy VDJ rearrangements identified from deep sequencing and they are called CH490, CH491, CH492 and CH493. These V-heavy sequences were chosen because they are the most mutated. [0174] The V-heavy chains were paired with the V-light chains of the antibodies identified from memory B cell cultures that are closest in the phylogenetic tree shown above. Therefore, CH491 and CH493 heavy chains were paired with CH236 light chain, while CH490 and CH492 heavy chains were paired with the CH241 light chain,
[0175] CH235 antibodies from week 41 are characterized by their inability to bind and neutralize CH505.TF envelope mutants with specific point mutations in the D loop (Gao, Bonsignori, Liao et al. Cell 158, 481-491, July 31, 2014, see also U.S. Provisional Application No. 62/027,427 filed July 22, 2014, and U.S. Provisional Application No. 61/972,531 filed March 31, 2014).
[0176] Figure 21 shows that CH493 restores almost completely the ability to bind the mutants not recognized by the early members of the lineage, indicating that this antibody is not constrained by the amino acid makeup of the D loop as tightly as the naturally occurring CH235 early lineage antibodies. CH493 still retained differential binding to the CH505.TF gpl20 delta 3711 mutant. Binding dependence to 1371 is a hallmark of neutralizing CD4bs antibodies.
[0177] Most notably, CH493 neutralized 20 of 24 tier-2 HIV-1 viruses (83%) in a multiclade virus panel optimized to represent diversity among globally circulating viruses. Naturally occurring antibodies in the same lineage neutralized only 25% of the viruses in the same panel and other engineered antibodies neutralized max 46% (Figure 22).
[0178] CH235, CH236, CH239, CH240 and CH241 are all Abs with natural pairs VH and VL from week 41 of infection of CH505 individual. CH241 is the most mutated at ~11 %. CH490, CH491, CH492 and CH493 are antibodies which comprise VH chains identified by deep sequencing and are near 20% mutated. These VH chains were paired with VL chains from the closest natural pair antibodies. So in the natural tree, CH241 is the most mutated from week 41 and it hit 38% of isolates.
[0179] For Abs CH491 and CH493, the VH chains were complemented with the VL of CH236. For antibodies CH490 and CH492 that were complemented with the VL of CH241. CH491 neutralized 46% of isolates and CH493 neutralized 83%.
[0180] In summary these antibodies were designed to include heavy chains form 454 sequencing and the heavy chains were paired with VL from observed antibodies:
[0181] CH490 and CH492 VH from 454 were paired with CH241 VL.
[0182] CH491 and CH493 VH from 454 were paired with CH236 VL. Pairing was done with the observed VL that was closer to the 454 sequence in the phylogenetic tree.
[0183] VH chains source: CH490 is from week 66; CH491 and CH492 are from week 100; CH493 is from week 152. The heavy chains were selected because were the most mutated ones. Example 7: Antibodies from CH235 lineage
Antibodies CH555, CH556, CH557and CH558
[0184] CH505 transmitted/founder (CH505.TF) gpl20 Env-specific memory B cells were isolated from 20 million PBMCs using fluorescent-activated single cell sorting (FACS) collected from chronically HIV-1 infected African CHAVI subject 703-01-050-5 264 and 323 weeks postinfection (10 million PBMCs/timepoint). Viable memory B cells were defined as Aqua Vital Dye neg, CD16neg, CD14neg, CD3neg, CD19pos, IgDneg cells. Sorted cells were cultured overnight in RPMI + 10%FCS supplemented with 2.5 ug/mL ODN2006, 2.5 ug/mL CHK2-inhibitor, 50ng/mL rHu IL-21 and 1 : 1 EBV-containing supernatants in a 96-well plates well containing 5000 CD40L-expressing MS40L feeder cells. Cells were then plated at limiting dilution in 96-well plates containing feeder cells, 2.5 ug/mL ODN2006, 2.5 ug/mL CHK2-inhibitor and 50ng/mL rHu IL-21, and cultured for 14 days, with medium refresh at days 3, 7 and 10. Culture supernatants were collected at day 14 and tested for neutralization of CH505.TF virus and binding to CH505.TF gpl20, CH505.TF gpl20 delta371I, RSC3 protein, RSC3 protein delta371I and CH505.TF mutant envelopes M6, M8 and M20 (described in Gao, Bonsignori, Liao et al. Cell 2014. Jul
31; 158(3):481-91). From selected positive cultures, recombinant monoclonal antibodies were produced as previously described (Bonsignori et al. J Virol. 2011. Oct;85(19):9998-10009).
Monoclonal antibodies CH557 was identified from a culture that neutralized 91% infectivity of CH505.TF virus, differentially bound to CH505.TF gpl20 Env and CH505.TF gpl20 delta371I Env, bound to M6, weakly bound to M8 but did not bind to M20 CH505.TF mutant gpl20s.
CH557 was identified from memory B cells collected 323 weeks post-infection. CH557 is a member of the previously described CH235 clonal lineage (Gao, Bonsignori, Liao et al. Cell 2014. Jul 31; 158(3):481-91). From the same experiment we also identified monoclonal antibodies CH555, CH556 and CH558 - all members of the CH235 clonal lineage. All monoclonal antibodies but CH555, which was identified from memory B cells collected 236 weeks post-infection, are from week 323 post-infection.
Example 8: Maturation Pathway from Germline to Broad HIV-1 Neutralizer of a CD4-Mimic Antibody
[0185] See Bonsignori et al. Cell 165, 1-15, April 7, 2016, published on-line March 3, 2016, the contents of which are hereby incorporated by reference in its entirety. Antibodies with ontogenies from VH1-2 or VHl-46-germline genes dominate the broadly neutralizing response against the CD4-binding site (CD4bs) on HIV-1. Here we define with longitudinal sampling from time-of- infection the development of a VHl-46-derived antibody lineage that matured to neutralize 90% of HIV-1 isolates. Structures of lineage antibodies CH235 (week 41 from time-of-infection, 18% breadth), CH235.9 (week 152, 77%) and CH235.12 (week 323, 90%) demonstrated the maturing epitope to focus on the conformationally invariant portion of the CD4bs. Similarities between CH235 lineage and five unrelated CD4bs lineages in epitope focusing, length-of-time to develop breadth, and extraordinary levels of somatic hypermutation suggested commonalities in maturation among all CD4bs antibodies. Fortunately, the required CH235-lineage hypermutation appeared substantially guided by the intrinsic mutability of the VH1-46 gene, which closely resembled VHI - 2. The CH235-lineage findings were integrated with a second broadly neutralizing lineage and HIV-1 co-evolution to suggest a vaccination strategy for inducing both lineages.
[0186] INTRODUCTION
[0187] Understanding the pathways and mechanisms of broadly neutralizing antibody (bnAb) induction is a critical goal of HIV-1 vaccine development (Bonsignori et al., 2012; Haynes, 2015; Haynes and Bradley, 2015; Haynes et al., 2012; Mascola and Haynes, 2013). In chronic HIV-1 infections, breadth of plasma neutralization follows a uniform distribution and broad neutralization arises in -50% of individuals after 5 years or more of infection (Hraber et al., 2014). The delayed appearance of bnAbs suggests roadblocks to their development, and one vaccine approach is to decipher these roadblocks and devise strategies to overcome them. It is possible that - because of the high diversity of antibodies resulting from recombination and somatic hypermutation (SHM) - different bnAb lineages may have different developmental pathways and roadblocks. However, for the CD4-binding site (CD4bs), a population-level analysis on 14 donors indicated only two general types of CD4bs bnAbs: VH-gene restricted and CDR H3-dominated (Zhou et al., 2015).
[0188] The VH-gene restricted classes arise from two highly similar VH -genes: VHl-2 and VHl-46 (Scheid et al., 2011; Wu et al., 2011). VHl-2*02 and VH1-46*01 share 93.4% (269/288) nucleotide sequence identity. Both classes give rise to antibodies that recognize the CD4bs via VH structural mimicry of the immunoglobulin-like N-terminal domain of CD4 (Zhou et al., 2010; Zhou et al., 2015). For the VHl-2 gene-derived antibodies, analysis of their ontogeny suggests two roadblocks based on: (i) a requirement for high levels of SHM (Klein et al., 2013; Scheid et al., 2009; Scheid et al., 2011; Wu et al., 2010), and (ii) weak binding of the inferred unmutated common ancestor (UCA) to gpl20 (Jardine et al., 2013; McGuire et al., 2013; Scheid et al., 2011; Wu et al., 2011; Zhou et al., 2010; Zhou et al., 2015), although a definitive analysis from time-of-infection had not yet provided detail. In addition, several of the CD4bs bnAbs are autoreactive with ubiquitinase enzymes (Bonsignori et al., 2014; Liao et al., 2013; Liu et al., 2015). [0189] Structure-based design of UCA-interacting immunogens has recently demonstrated a means to overcome this second roadblock, with priming of VH1-2 bnAb lineages in knock-in mice (Dosenovic et al., 2015; Jardine et al., 2015). However, the maturation of primed VHl-2 CD4bs B cell lineages to broad neutralization as well as the mechanism for the development of breadth remain unresolved.
[0190] For the VHl-46-derived antibodies, far less is known. Two chronically HIV-infected individuals, RUl and RU8, have developed VHl-46-derived bnAbs, 1B2530 and 8ANC131 (Scheid et al., 2011). An African individual (donor CH505) was recently described who, over time, developed a CD4bs bnAb lineage (the CHI 03 lineage) that recognized the CD4 supersite through a CDR H3-dominated mode of interaction (Liao et al., 2013). Analysis of the co-evolution between virus and CHI 03 lineage demonstrated a second B cell lineage (the CH235 lineage) that cooperated by selection of escape mutants from the CH235 lineage that drove the CHI 03 bnAb lineage (Gao et al., 2014). Described herein is the finding that the CH235 lineage itself progressed to bnAb over 5 years of affinity maturation. Described herein are sequences of the CH235 lineage that were identified through longitudinal samples of 17 time points spanning weeks (wks) 6-323 post infection, assessment of the neutralization breadth of sequential lineage members on a panel of -200 diverse isolates, and determination of Env-complexed crystal and EM structures for lineage members. The conformity (i.e. the level of shared mutation positions and identical sequence mutations) of CH235 lineage development is analyzed relative to other VH gene-specific bnAb lineages in other donors, as well as the co-evolution of virus and CH235 lineage. Despite an early near-optimal binding orientation, the CH235 lineage required over 20% SHM to reach 90% neutralization breadth. The results described herein provide insight into the difficulties in focusing recognition to the conserved site of HIV- 1 vulnerability, and suggest that CD4bs-directed antibodies, whether VH-gene restricted or CDR H3-dominated, face similar obstacles in
development. For VH1-46- and VHl-2-derived CD4-mimic antibodies, the unique genetic mutability inherent in each of these two VH-germline genes helps to direct maturation, potentially providing an explanation for the prevalence of effective CD4bs antibodies derived from these two germline genes.
[0191] RESULTS
[0192] Sequencing of B cell antibody gene rearrangements in longitudinal samples.
[0193] To understand the maturation of the cooperating CH235 lineage in donor CH505, we sought to identify sequences of lineage members at 17 time points, spanning wks 6 to 323 from time of infection. First it was asked when we could detect members of the CH235 lineage. Next-generation sequencing (NGS) of antibody heavy chain gene rearrangements amplified from genomic DNA template of blood mononuclear cells from wk 6 to 152 (15 time points) identified a total of 479,028 unique, non-duplicated V-heavy sequences. The first V-heavy sequences belonging to the CH235 B cell lineage were found at wk 14, and additional CH235 lineage members were found at all subsequent time points. Only unique sequences in the CH235 lineage were further investigated and they were assigned to the earliest time-point (time-of-appearance) in which they were identified. Four V-heavy sequences were paired with the closest VL from identified antibodies and produced as recombinant monoclonal antibodies (mAbs) (CH235.6 through CH235.9). From cultured memory B cells collected 41 wks post-transmission we had previously identified five members of the CH235 lineage (CH235, CH236, CH239, CH240 and CH241) (Gao et al., 2014) and we have now identified four additional members with natural VH and VL pairing from cultured memory B cells collected at wks 264 and 323 post-transmission: CH235.10 through CH235.13 (Figure 29A, Figure 36A and Figure 40C). CH235 lineage antibodies represented 0.018% of the total memory B cell repertoire and 0.5% of the CH505 TF gpl20-specific memory B cell population.
[0194] The CH235 lineage could be separated into three clades (clade I, II and III). Clade I showed a number of early lineage members, but no additional clade I sequences were observed after wk 30; clade II showed further development and included members CH241 (wk 41) and CH235.6 (wk 66), but no additional sequences were observed after wk 66; clade III developed through wk 323 and included antibodies CH235 (wk 41), CH235.9 (wk 152), and CH235.12 (wk 323) (Figure 29A).
[0195] CH235 lineage HIV-1 neutralization.
[0196] To characterize the development of neutralization breadth in the CH235 lineage, antibodies in clade III were assessed for their ability to neutralize diverse HIV-1 isolates in a 199-isolate panel (Figure 29B and Figure 41). No isolates were neutralized by the unmutated common ancestor (UCA), whereas 18% of the viruses were neutralized by CH235 at wk 41. By wk 152, CH235.9 neutralized 77% of viruses, although with a relatively weak potency of 3 μg/ml. By wk 323, however, CH235.12 was able to neutralize 90% of viruses, and the neutralization 50% inhibitory concentration (IC50) potency increased by 5-fold to 0.6 μg/ml.
[0197] Next the heterologous neutralization pattern of these antibodies were analyzed to understand their development of broad neutralization (Figure 36B) (Georgiev et al., 2013). CH235 lineage members and previously identified HIV-1 bnAbs were clustered based on heterologous neutralization activity. CH235 neutralization activity was more similar to CD4bs bnAbs than to bnAbs with other epitope specificities. While the CH235 neutralization profile was the most divergent from other CD4bs bnAbs, CH235.9 and CH235.12 were much more similar to other CD4bs bnAbs and each other. Interestingly, despite VHl-46 usage, the CH235.9 and CH235.12 neutralizing profile was more similar to that of VHl-2-derived antibodies, such as VRCOl, than VHl-46-derived antibodies, such as 8ANC131 (Figure 36B).
[0198] Crystal structures of CH235-lineage members with HIV-1 gpl20.
[0199] To provide structural insight into the recognition and maturation of the CH235 lineage, the antigen-binding fragments (Fabs) of antibodies CH235 (wk 41 from time of infection, 18% breadth), CH235.9 (wk 152, 77%) and CH235.12 (wk 323, 90%), were prepared and co- crystallized, solved and refined these in complex with the gpl20 core of HIV-1 isolate strain (93TH057) (Figure 30, Figure 42). We mapped the location of residues altered during SHM and observed changes throughout the variable domain (Figure 30A).
[0200] Comparison of the orientation of the VH of CH235 in Env binding with that of CD4, VRCOl and 8ANC131 (Scheid et al., 2011) showed that the CH235 VH domain mimicked CD4 in Env binding and was highly similar to the VH orientation and structure of the VRCOl and 8ANC131 VH chains: in particular, the VH1-46 of CH235 preserved key contacts mediated by the CDR H2 loop for the CD4 binding loop and for the gpl20 D368 (Figure 37A,B).
[0201] Analysis of the angle of recognition for the CH235 lineage indicated little change during maturation, with CH235, CH235.9 and CH235.12 all clustering within the larger VRCOl-class of antibodies. Interestingly, other VH1-46 antibodies clustered differently, with antibody 1B2530 from HIV- 1 -positive donor RU1 at a highly similar angle and 1.5 A translated, and antibodies 8 ANC 131 and 8ANC134 from HIV-1 -positive donor RU8 occupying a cluster about 55 degrees and 3.5 A translated related to the CD4 (Figure 37C).
[0202] These results suggest that the gpl20-antibody orientation was determined early in bnAb lineage ontogeny, with further maturation maintaining the same general orientation. Overall, the structures of CH235 lineage members with HIV-1 gpl20 Env revealed CD4 mimicry. While the VH gene usage classifies the CH235 lineage within the VHl-46-derived 8ANC131 bnAb class, it is both functionally and structurally closer to the VRCOl class (Zhou et al., 2015).
[0203] Negative stain EM of CH235-lineage members with trimeric HIV-1 Env.
[0204] To visualize the recognition of the CH235 lineage in the context of the HIV-1 Env trimer, negative stain EM was used to determine 3D-reconstructions of Fabs CH235, CH235.9 and
CH235.12 bound to trimeric BG505 and B41 HIV-1 Env glycoproteins (Figure 30B)(Pugach et al.,
2015; Sanders et al., 2013). Notably, the stoichiometry increased with antibody maturation, with
CH235 (8%) VH mutation) binding with a stoichiometry of 1 : 1 (BG505; Figure 30B, top, Figure
37D-F) or 2: 1 (B41; Figure 30B, bottom, Figure 37D-F) Fabs per trimer and CH235.9 and CH235.12 (19% and 25% VH mutation, respectively) binding with a 3 : 1 Fab to trimer ratio (Figure 30B). Next the orientation and stoichiometry of CH235.12 Fab was compared with that of CH103, a CDR H3-dependent CD4bs bnAb identified from the same subject (Liao et al., 2013). EM analysis of either CH235.12 or CH103 Fab in complex with BG505 SOSIR664 revealed structural differences between the CDR H3-dominated CH103 class bnAb and the 8ANC131-class CH235.12 bnAb and, in accordance with crystallographic results, the angle of approach of CH235 was similar to that of VRCOl and other CD4 mimicking bnAbs (Figure 37G).
[0205] Despite the CD4 mimicry by CH235, the trimer remained in a closed conformation when the CH235 lineage members were bound. However, the EM-derived model of CHI 03 in complex with BG505 revealed that CHI 03 either bound to or induced a more open version of the trimer. This conformation represents an intermediate state between the closed, compact trimer in complex with CH235 or VRCOl, and the CD4-induced open model in complex with soluble CD4 or 17b Fab (Figure 37G). Similar to more mature CH235 lineage bnAb Fabs, bnAb CHI 03 bound to BG505 with a stoichiometry of 3 Fabs per trimer. (Figure 37G).
[0206] Maturation focuses CH235 lineage recognition to a conserved site of CD4
vulnerability.
[0207] To gain insight into the structural consequences of maturation, the epitope of CH235 lineage members was mapped relative to the conformationally invariant CD4 supersite of vulnerability (Zhou et al., 2015). When the CH235 footprint was mapped on gpl20, we observed portions of the CH235-binding surface on gpl20 to be outside of the CD4 supersite of vulnerability (Figure 30C, left). This surface was reduced in CH235.9 and CH235.12 structures, especially on variable loop V5. Recognition by the CH235.12 antibody concentrated almost entirely on the CD4 supersite of vulnerability, with little interactions with the inner domain or variable loop V5; there was, however, a large remaining interaction with the conserved loop D region (Figure 30C, middle and right).
[0208] To quantify targeting precision, the buried surface between antibodies and gpl20 co-crystal complexes was computed, for the region overlapping the CD4 supersite of vulnerability minus the region outside the vulnerable site. Overall targeting precision correlated with neutralization breadth (.Ρ=0.0007) (Figure 30D). The CH235-lineage antibodies all showed good targeting precision. The correlation of SHM versus neutralization breadth was also analyzed (.Ρ=0.0097) (Figure 30E): While the CH235 lineage generally trended towards lower SHM relative to neutralization breadth, all CD4bs bnAbs appeared to require a high degree of SHM, independent of whether the antibody derived from a specific VH-gene or used a CDR H3 -dominated mode of recognition. [0209] Overall, the results suggest that maturation requires a high degree of SHM to focus recognition onto the CD4 supersite of vulnerability and that this high degree of SHM is a general requirement of all CD4bs bnAb lineages, even those that begin with highly favorable orientations such as CH235.
[0210] Conformity of sequence evolution of CH235 lineage.
[0211] The mutation levels of CH235-lineage antibodies identified 41 wks post infection from memory B cell cultures was markedly lower (range 7-11%;) than that of all previously reported VH1-46 and VHl-2 CD4bs bnAbs (>25%) (Scheid et al., 2011; Sui et al., 2010; Wu et al., 2010; Zhou et al., 2015) (Figure 40C). The mutation levels of CH235-lineage antibodies identified up to 264 wks post infection increased to -20%, but were still lower than those of most other bnAbs until 323 wks post infection (CH235.12 : 26% mutations) (Figure 31A).
[0212] To quantify the conformity of CH235-lineage antibodies to the two VHl-46-derived bnAbs (1B2530 from donor RU1 and 8ANC131 from donor RU8) (Scheid et al., 2011; Zhou et al., 2015), we analyzed the similarity of shared mutation positions (positional conformity) and shared identical mutations (identity conformity) of the VH genes (Figure 31B, Figure 38A). As a comparison, the positional conformity and identity conformity of non-HIV-1 targeting antibodies identified from 3 HIV-1 negative donors relative to template antibodies 1B2530 and 8ANC131 were also calculated. Positional conformity in SHM was spread over a large range (50-90%), and there did not seem to be much discrimination between VHl-46 in antibodies that effectively neutralized HIV-1 and those that did not (Figure 31B, top panels). Identity conformity in SHM was also spread over a large range (0-75%) (Figure 31B, bottom panels), and while little discrimination was observed between VH1-46 in antibodies that effectively neutralized HIV-1 and those that did not for antibody
8ANC131, there was discrimination among CD4bs antibodies when 1B2530 was used as a reference (Figure 31B, bottom left panel). The differences in CH235-lineage identify conformity to 1B2530 or to 8ANC131 may reflect the greater similarity of the recognition orientation of CH235- lineage members withlB2530 (Figure 37C) and suggested that slight differences in recognition orientation can substantially alter factors associated with identity conformity.
[0213] Overall, these results indicated SHM in response to HIV-1 infection to proceed in a manner that depended less on functional selection and more on intrinsic properties of the VHl-46-gene, especially related to the position of residues that undergo SHM. To investigate further the contribution of the VHl-46 gene, we analyzed SHM observed in VHl-46 gene transcripts from three uninfected individuals (Figure 31C, top); notably, all 11 positions mutated in CH235, 1B2530 and 8ANC131 were also mutated among non-HIV-1 neutralizing antibodies with high frequency (>20%). Moreover, the residue substitutions in CH235 were frequently found in the top three most commonly observed substitutions for that position in the VH1-46 gene. To quantify the impact of gene mutability, we compared the difference in probability distributions of positional and identity conformity for sequences simulated with and without taking into account the intrinsic VH1-46 gene mutability. The simulations showed that both positional and identity conformity shifted to a higher level of similarity when considering gene mutability (Figure 38B and 38C). Notably, a substantial shift in probability was observed for the positional conformity of CH235 (Figure 38B, Figure 43 A). Similar shifts in identity conformity were also observed for CH235 (Figure 38C, Figure 43B). Thus, the intrinsic susceptibility at specific sites of the VH1-46 germline gene to mutation as well as to the frequency of specific mutations that existed at each of these sites appeared to be a dominant factor in the SHM alteration of the CH235 lineage. These results are in line with our previous finding that selection and mutability synergized during affinity maturation of an influenza HA-reactive clone from a non-HIV-1 infected person to hemagglutinin (HA) (Kepler et al., 2014): hence, the dominant role of intrinsic susceptibility at specific sites may be a more general biological phenomenon in dictating the course of SHM.
[0214] Because VH1-2 is genetically the most closely related germline gene to VH1-46, we also examined the mutability of the VH1-2 gene (Figure 31C, bottom). Consistent with VH1-46 antibodies, the mutated positions among VH1-2 derived bnAbs also showed high frequency of mutation among non-HIV-1 targeting VHl-2 antibodies, suggesting that gene mutability contributes to VH1-2 derived HIV-1 antibody evolution. Notably, the average mutability of the VH1-2 gene at positions where the CH235 antibody showed SHM was generally high: 9 of 15 positions mutated in CH235 antibody were also mutated in more than 15% of VHl-2-derived NGS reads. In 10 of these 15 positions, the mature VHl-2-derived bnAbs (VRCOl, VRC-CH31 and VRC-PG04) also showed changes. When we analyzed mutability of other VH genes used by CD4bs bnAbs (VH1-69, VH3-23, VH3-30, and VH4-59) (Zhou et al., 2015) (Figure 38D), we observed gene mutability patterns different from that of VH 1-46 while, in contrast, the mutability patterns of VH1-2 and VH1-46 were more similar (Figure 43C). Despite the similarity between VHl-2 and VHl-46, we did observe that antibody sequences from CD4bs bnAbs of each gene segregated phylogenetically (Figure 31E), indicating differences in maturation pathway between bnAbs evolving from these two germline genes.
[0215] These data suggested that for both VHl-2 and VHl-46 germline genes-derived bnAbs, somatic mutations that lead to neutralization breadth appeared to be primarily determined by the intrinsic mutability of VH1-46 and VH1-2 germline genes. The differences in the intrinsic mutabilities of these VH genes may contribute to the high occurrence of CD4bs bnAbs that originate from either VH1-2 or VH1-46 (Zhou et al., 2015).
[0216] Interaction between CH235 and CH103 bnAb lineages.
[0217] While gene mutability plays a role in determining the position where SHM occurs, binding between antibody and HIV-1 Env likely also plays a role in selecting or fixing a mutation. A hallmark of cooperating B cell lineages is that they interact at the same site as the bnAb lineage that is being driven (Gao et al., 2014).
[0218] To determine a mechanism whereby the initial interaction of the early CH235 and CHI 03 lineage members bind to the same or similar epitope and result in CH235 selection of escape mutants that stimulated the CH103 bnAb lineage (Gao et al., 2014), cross-competition between early CH235 lineage antibodies and the CHI 03 lineage antibody CHI 06 in ELISA was evaluated, as an example of early CHI 03 lineage development, and measured their association rate constant with surface plasmon resonance (SPR). Since both the CH235 and CHI 03 lineages bound to the loop D gpl20 region, we asked if the early CH235 lineage antibodies could block the binding of the CHI 03 lineage mature antibody CHI 06, or block the binding of soluble (s)CD4 to CH505 TF gpl20 Env. CH241 was the only antibody in the CH235 lineage that strongly blocked CH106 bnAb and sCD4 binding to CH505 gpl20 (IC50 = 2.6 and 1.5 μg/ml, respectively) (Figure 44A).
[0219] To confirm early dominance of the binding of CHI 03 lineage compared to the CH235 lineage to CH505 TF Env, the blocking assay was reversed and asked if bnAb CHI 06 could block the binding of biotinylated CH235, CH236, CH239, CH240 or CH241. CH106 strongly blocked the binding of all the CH235 mature antibodies with IC50s ranging from 2.3 μg/ml (for CH240) to 14.3 μg/ml (for CH241) (Figure 44B). These data suggested that the earliest maturation intermediates of the CH235 lineage antibodies could not outcompete CH106 bnAb for binding to CH505 TF gpl20 Env.
[0220] Affinity maturation in germinal centers is subjected to kinetic selection and involves improvement in dissociation rate constant (Kd) that is often driven by an improvement in the kinetic association rate (ka), which is a key variable in conferring a binding advantage for the cognate epitope to an antibody over other competing antibodies (Foote and Milstein, 1991; Kepler et al., 2014). The ka and dissociation kinetic rate (kd) of the CH505 TF gpl20 Env binding by CH235 and CHI 03 was measured with SPR to identify differences that might explain the relative inability of the CH235 lineage to block the binding of the CHI 03 lineage bnAbs to autologous CH505 TF Env and found that the two lineages followed two distinct trajectories and modalities to increase their overall affinity. [0221] The UCA of the CHI 03 lineage bound to CH505 TF Env with a Kd of 227 nM which increased one order of magnitude throughout affinity maturation (Figure 32A). The CH103 UCA displayed a fast association rate (ka = 37 x 103 M'V1) which was maintained across the
intermediate and mature mAbs (ka = 11.9 - 37.3 xlO3 M'V1), suggesting that maintaining the fast association rate was important for survival and maturation of the CHI 03 lineage (Figure 32B). In contrast, the CH235 lineage mAb Kd increased four orders of magnitude during affinity maturation (from 30.6 mM of IA4 - the earliest intermediate mAb in the CH235 lineage for which kinetic rates could be measured - to 0.7 nM of CH241) (Figure 32C). Such increase was predominantly facilitated by slower dissociation rates (kd) observed in later intermediates and mature mAbs, which decreased from 88.1 xlO"3 s"1 of IA4 to 0.33 xlO"3 s"1 of CH241 (Figure 32D). Conversely, CH235 lineage mAbs bound to CH505 TF gpl20 Env with ka that started off an order of magnitude slower than CH103 UCA and its earlier intermediates (IA4 ka =2.9 xlO3 M'V1) and only modestly improved - primarily between IA1 and CH235 mAbs - with the majority of the early CH235 mAbs having slower ka than CHI 03 mAbs (Figure 32D).
[0222] Thus, the relative inability of wk 41 CH235 lineage antibodies to block early mature CHI 03 lineage mAbs could be explained by the observed differences in their association rates, and these data provide an explanation of how the CH235 antibody lineage exerted its cooperating function in driving autologous virus toward better neutralization by the CHI 03 antibody lineage without impeding concurrent development of the CHI 03 antibody lineage itself.
[0223] Late CH235 lineage broadly neutralizing antibodies neutralize autologous loop D escape viruses selected by early CH235 lineage members.
[0224] It has previously been demonstrated that the CH235 lineage selected escape viruses with mutations in the loop D region of gpl20 Env that rendered loop D mutant viruses more sensitive to the CHI 03 bnAb lineage and that autologous virus escaped from early CH235 lineage antibodies by wk 30 after infection (Gao et al., 2014). Described herein is the isolation of autologous viruses through wk 323 and the determination of the neutralization capacity of the late CH235 lineage bnAbs. Viruses partially sensitive to the later members of the CH235 lineage (particularly bnAbs CH235.9 and CH235.12) were found as late as wk 176 (Figure 33 A, Figure 45). These viruses still contained the loop D mutations that were selected by virus escape from early antibody members of the CH235 lineage (Gao et al., 2014). Hence, the ability of the late CH235 lineage bnAbs to neutralize the panel of CH505 TF loop D mutants was tested (Gao et al., 2014). Remarkably, CH235.9, CH235.12 and CH235.13 bnAbs acquired the ability to neutralize all loop D mutants that were resistant to the early members of the CH235 lineage (Figure 33B and Figure 46). In particular, CH235.9, CH235.12 and CH235.13 neutralized CH505 TF gpl20 M8, M20 and M21 (not neutralized by early lineage member CH236), which differed from CH505 TF gpl20 M6 and M10 (neutralized by CH236) by a single mutation at position 280 (N280S for M8 and M20, and N280T for M21) (Figure 33B).
[0225] In the gpl20-complexed structure, the side chains of N280 forms three hydrogen bonds with two residues in the CDR L3 and these hydrogen bonds are predicted to be disrupted by the N280S and N280T mutations (Figure 39A). Since the CH235.9 antibody had the VL of CH236, the direct implication was that mutations in the heavy chain were responsible for the ability of CH235.9 to neutralize loop D mutant viruses. Interestingly, CH235.7, which did not neutralize autologous viruses beyond wk 53, also had the VL of CH236 but, in contrast to CH235.9, failed to neutralize CH236-resistant loop D mutants M7, M8, M9, M20 and M21.
[0226] Therefore, we reverted the 5 amino acids (aa) in CH235.9 VH at gpl20 contact positions that were different from those present in CH236 VH but not shared with CH235.7 VH: N30T and D3 IT in CDR HI, G62Q and G65Q in FR H3 and A103E in CDR H3 (Figure 39B). Five of the six CH235.9 mutants retained the ability to potently neutralize all the CH505 TF loop D mutant viruses. In contrast, the N30T mutation in CDR HI reverted CH235.9 to the CH236 phenotype (CH236 has a threonine in position 30): M21 neutralization was abrogated, M20, M7 and M9 were near completely abrogated (CH235.9 N30T IC50 >44 ug/ml) and M8 IC50 increased 37-fold (CH235.9 IC50 = 0.66μg/ml vs CH235.9 N30T IC50 = 24.31 ug/ml) (Figure 46).
[0227] Thus, acquisition of extraordinary breadth in the CH235 bnAb lineage was associated with accumulation of somatic mutations in CDR HI that enabled late CH235 lineage antibodies to neutralize autologous loop D mutant viruses that were escape mutants from early CH235 antibodies. CH235.9 bnAb residue N30 contacts R429 in the β20-β21 loop of the C4 region of gpl20 Env, which is on the opposite face of the CD4bs from loop D (Figure 33C). In addition, CH505 TF has a glutamic acid in position 429 that is in close enough proximity to N30 to form a hydrogen bond.
[0228] These findings indicate a mechanism for acquiring the ability to neutralize loop D mutants via a compensatory mutation in the CH235 VHD½ which strengthens the binding to the gpl20 C4 region by introducing hydrogen bonds that correct the loss of neutralization due to disruption of the hydrogen bonds between loop D and the CH235 mAb light chain.
[0229] CH235 and CH103 lineage antibody binding to CH505 gpl20 Env.
[0230] The CH235 lineage antibodies were tested for binding to 113 recombinant CH505 gpl20 Env isolated from time of transmission to wk 160 post-transmission, including CH505 TF loop D mutant Envs (Figure 34A and Figure 47). Of note, CH235.9 and CH235.12 bound to 4/22 and 8/22 Envs isolated from wk 136 and 160 post-transmission, respectively, including Envs from viruses that were also neutralized. Env binding to the initial members of the CHI 03 lineage has previously been reported (Hraber et al., 2015), and described herein is the same Env binding analysis of the CH103 lineage with 10 additional matured bnAb members of the CH103 lineage (Figure 34A and Figure 47). We have used these data to select CH505 gpl20 Env quasi-species that bound to mature and precursor bnAbs of both lineages, defining a series of CH505 Env immunogens now optimized and predicted to induce both bnAb lineages (Figure 40A).
[0231] It has previously been reported that CH235 UCA weakly reacted with CH505 TF gpl20 at ~ 10 μΜ as determined by SPR (Gao et al., 2014). Here we show stronger binding of the CH235 UCA to 8/113 autologous CH505 gpl20 Envs measured in ELISA (Figure 34A and Figure 47). Moreover, in a panel of 15 heterologous Envs from multiple clades, CH235 UCA bound to 3/15 Envs and the introduction of only 3 mutations (W47L, G54W and S56R), which were selected based on the increase in surface area of interaction (G54W and S56R) or the reduction in clash score (W47L), increased this recognition (to 5/15 Envs), of which the dominant effect appeared to be reduction in clash (Figure 34B and Figure 40B).
[0232] Autoreactivity in the CH235 B cell lineage.
[0233] Development of auto- and polyreactivity during antibody maturation toward neutralization breadth is a critical aspect that may limit the ability of generating bnAbs during natural infection and upon vaccination (Bonsignori et al., 2014; Haynes et al., 2005; Haynes et al., 2012; Haynes and Verkoczy, 2014; Liu et al., 2015; Verkoczy et al., 2013; Verkoczy et al., 2010; Verkoczy et al., 2011). It has previously been reported that in HIV- 1 -infected individual CH505, the CD4bs CH103 bnAb lineage was polyreactive and, similar to VRCOl -class bnAbs, bound to human ubiquitin ligase E3A (UBE3A) with avidity correlated with neutralization (Liao et al., 2013; Liu et al., 2015). In addition, most of the mutations introduced in VRC07 - a somatic variant of VRCOl - that enhanced neutralizing activity also resulted in increased autoreactivity (Rudicell et al., 2014). Since CH235.12 is a potent and extremely broad CD4-mimic CD4bs bnAb, we compared the auto- and polyreactivity profile of CH235.12 with other members of the CH235 lineage. Most CH235 lineage antibodies displayed reactivity against DNA and sporadic reactivity with Scl70 (CH235.7) (Figure 35A). CH241 bound to cardiolipin (Figure 35B). In Hep-2 IF staining CH236, CH235.7 and CH235.9 were all cytoplasmic positive (Figure 35C). Conversely, CH235.12, despite being highly mutated and broadly neutralizing, did not display autoreactivity in any of these assays (Figure 35A-C) Of particular note, CH235 lineage antibodies, including CH235.12, did not react with UBE3A (Figure 35D).
[0234] These data identify CH235.12 as an antibody that has developed neutralization breadth without being itself auto- and polyreactive, while less mutated precursor antibodies (CH235 is in the same clade of CH235.12) did develop autoreactivity. Therefore, in vivo decoupling of neutralization breadth of CD4 mimic CD4bs bnAbs from auto- and polyreactivity can occur, even for bnAb lineages that have developed autoreactivity during the course of their maturation and, therefore, inducing such bnAbs from such lineages through vaccination, though difficult, is an achievable goal.
[0235] DISCUSSION
[0236] Here we have traced the ontogeny of the CH235 VHl-46 8ANC131 class of CD4bs bnAbs from acute infection to chronic infection and defined both the structural and functional pathways of bnAb lineage induction. That the CH235 bnAb lineage that selected virus escape mutants that drove the CH103 CD4bs CDR H3-dependent bnAb lineage is itself an 8ANC131 -class bnAb lineage and co-evolved with the CH103 bnAb is a remarkable demonstration of a bnAb-to virus-to bnAb interaction in the same HIV-1 infected individual. In addition, the similarity of VH 1-46 8ANC131-like and VH1-2 VRCOl family CD4 supersite bnAbs demonstrates dramatic convergence of antibody structures to recognize the CD4 supersite. The CH235 lineage required over 20% SHM in heavy chain variable domain to achieve 90% breadth. Fortunately, a substantial portion of the VH-gene SHM was guided by the intrinsic mutability of the VH1-46 germline gene. Moreover, the CH235 lineage Ab that became broadly neutralizing acquired the ability to neutralize loop D mutants selected by early Ab lineage members (Gao et al., 2014) with a mechanism involving a compensatory mutation (T30N) in CDR HI, which allowed the formation of H-bonds with the HIV-1 gpl20 C4 region, thus correcting the original loss of binding.
[0237] The driving forces of the CH235 lineage were the natural transmitted/founder and M5 Envs. In addition, despite near-complete autologous virus escape from CH235 lineage antibodies by wk 100, viruses arose later during the course of infection, which were sensitive to the more mature CH235 bnAb members and likely contributed to antigen drive. It is interesting to note that many of these late viruses were less sensitive to CHI 03 CDR H3 binder bnAbs prompting the hypothesis that the CHI 03 lineage may have the capacity for cooperation with the CH235 lineage after 5-6 years of co-development. Finally, the CH235.12 antibody that evolved late in CH235 development is an extraordinary broad and potent non-autoreactive antibody and is a candidate for preventive and therapeutic uses. [0238] In summary, the acquisition of neutralization breadth in the CH235 VRCOl-like VH1-46 CD4 mimic bnAb occurred with the sequence of transmitted/founder and early mutant-initiated antigen drive, selection of Env loop D mutants that cooperated with the CHI 03 bnAb lineage to drive it to bnAb breadth, followed by acquisition of the ability of the CH235 lineage itself to neutralize autologous loop D mutants coincident with potent neutralization of a broad array of heterologous HIV-1 isolates. Mapping these events points to a strategy for the simultaneous induction of both CDR H3 and VRCOl -class CD4bs bnAbs, whereby sequential immunizations with transmitted founder Env followed by loop D mutant Envs comprise a rational immunization strategy.
[0239] EXPERIMENTAL PROCEDURES
[0240] Donor and sample information. Donor and sample information was previously reported (Liao et al., 2013) and is summarized in Supplemental Experimental Procedures. Memory B cell cultures were performed on PBMCs collected at 264 and 323 wks post-transmission. All work related to human subjects was in compliance with Institutional Review Board protocols approved by the Duke University Health System Institutional Review Board.
[0241] Preparation of libraries for 454 DNA pyrosequencing. 454 DNA pyrosequencing was performed on genomic DNA template isolated with Qiagen kits from PBMCs collected at 6, 7, 8, 9, 14, 20, 22, 30, 41, 53, 66, 92, 100, 144 and 152 wks post-transmission as described in (Boyd et al., 2009) and in Supplemental Experimental Procedures. Only unique V-heavy rearrangements were included in the analysis to generate the phylogeny; in the case of duplicated sequences, the earliest occurrence was included in the analysis.
[0242] Phylogenetic analysis. For clonal phylogenetics, the UCA was inferred using Cloanalyst (Kepler, 2013), which simultaneously estimates the UCA and the phylogenetic tree relating the observed sequences to each other and to the UCA. Internally, Cloanalyst uses dnaml from the PHYLIP suite of phylogenetic software (Felsenstein, 2005). The CH235 antibody lineage clonogram was displayed using the ete2 Python package.
[0243] Isolation of CH235 Lineage Antibodies from Donor CH505. Fluorescence-activated cell sorting of antigen-specific IgG+ B cells from PBMC and the amplification and cloning of immunoglobulin genes were performed as described in (Bonsignori et al., 2011). CH505.TF gpl20 Env-positive memory B cells were cultured as described in Supplemental Experimental Procedures.
[0244] Neutralization assays. Neutralization of donor CH235 mAbs were measured using single- round-of-infection HIV-1 Env pseudovimses and TZM-bl target cells as described in Supplemental Experimental Procedures. [0245] Neutralization signature. Antibody neutralization signatures were computed and compared as described in Supplemental Experimental Procedures.
[0246] Monoclonal Antibody and Antigen-Binding Fragment (Fab) Production. Ig genes of mAbs were amplified from RNA and expression plasmids for heavy and kappa chains were constructed. Expression and purification of recombinant IgG mAbs and preparation of Fab fragments are described in Supplemental Experimental Procedures.
[0247] Crystallization, X-Ray Data Collection, Structure Determination, and Refinement of Donor CH235 Antibodies in Complex with HIV-1 gpl20. Purification, crystallization of antibody-gpl20 complexes, data collection, structure solution, refinement and analysis are described in Supplemental Experimental Procedures. Diffraction data were integrated and scaled with the HKL2000 suite (Otwinowski and Minor, 1997).
[0248] Electron microscopy data collection and processing. BG505 SOSIP.664 and B41 SOSIP.664 gpl40 trimers and donor CH235-derived Fab complex negative-stain electron microscopy images, analysis and visualization are described in the Supplemental Experimental Procedures.
[0249] Focused maturation and conformity analysis. Focused maturation and mAb conformity analysis are described in the Supplemental Experimental Procedures.
[0250] Surface Plasmon Resonance Affinity and Kinetics Measurements. MAb binding to autologous CH505 gpl40 was measured using a BIAcore 3000 or BIAcore T200 instrument (GE Healthcare) as described in (Alam et al., 2007; Alam et al., 2009; Liao et al., 2013) and in
Supplemental Experimental Procedures.
[0251] Direct-Binding ELISA. Direct-binding ELISAs were performed as described in
Supplemental Experimental Procedures.
[0252] MAb CH235.9 Amino Acid Reversion. Site-directed mutagenesis of the CH235.9 mAb genes was performed using the Quikchange lightning multi-site-directed mutagenesis kit (Agilent) following manufacturer's protocol. Primers are listed in Supplemental Experimental Procedures.
[0253] Structural Modeling. Loop D mutations were structurally modeled using PyMOL with sidechains placed in the most frequently observed rotamer that did not result in steric clashing with neighboring residues. Hydrogen bonds were calculated using HBPLUS software (McDonald and Thornton, 1994).
[0254] Recombinant HIV-1 Proteins. HIV-1 genes of autologous CH505 Env were determined from samples collected from 4 to 323 wks post-infection by single genome amplification (Keele et al., 2008) and produced as described in (Liao et al., 2013). [0255] Protein Array. MAbs were screened for binding on protein microarrays (ProtoArray) (PAH0525101; Invitrogen) pre-coated with 9,400 human proteins in duplicate and screened following manufacturer's instructions and as described in (Liu et al., 2015; Yang et al., 2013).
[0256] HEp-2 cell staining. Indirect immunofluorescence binding of mAbs or plasma to HEp-2 cells (Zeuss Scientific) was performed as previously described (Bonsignori et al., 2014; Haynes et al., 2005).
[0257] Supplemental Experimental Procedures
[0258] Donor and Sample Information.
[0259] The CH505 donor, from which the CHI 03 and the CH235 antibody lineages were identified, is an African male enrolled in the CHAVIOOl acute HIV-1 infection cohort (Tomaras et al., 2008) and followed for over 6 years. During this time viral load ranged from 14,460 to 847,279 copies/ml (median = 173,667 copies/ml), and CD4 counts ranged from 69 to 431 cells/mm3 (median = 294 cells/ mm3).
[0260] The time of infection was estimated by analyzing the sequence diversity in the first available sample using the Poisson Fitter tool (Giorgi et al., 2010) as described in (Liao et al., Nature 2013). Results were consistent with a single founder virus establishing the infection and with the earliest isolated virus sequences being taken 4 weeks post-transmission.
[0261] Flow Cytometry, Memory B Cell Cultures and mAb Isolation.
[0262] The HIV-1 CH505.TF gpl20 envelope glycoprotein was produced and used in flow cytometry on PBMC collected from donor CH505 at week 264 and 323 post-transmission using a two-color technique as described (Gray et al., 2011).
[0263] CH505.TF gpl20 Env-positive memory B cells were cultured as described (Bonsignori et al., 2011) with the following modifications: non-irradiated MS40L cells were used as feeder cells at a concentration of 3,000 cells/well and were added to wells in which memory B cells were sorted in bulk; 50 ng/ml of recombinant human (rHu) IL-21 (200-21; Peprotech, Rocky Hill, NJ) were added to the complete medium; memory B cells were distributed by limiting dilution at a calculated concentration of 2 cells/well; culture medium was refreshed every 5 days.
[0264] Cell culture supernatants were screened for neutralization of autologous CH505.TF virus using the tzm-bl neutralization assay (Bonsignori et al., 2011; Montefiori, 2005) and for binding to CH505.TF gpl20 Env, CH505.TF Δ371Ι gpl20 Env mutant, HIV-1 Env resurface core protein 3 (RSC3) and RSC3 Δ371Ι (Wu et al., 2010). [0265] MAbs CH235.10 through CH235.13 were identified from cultures that displayed differential binding of CH505.TF and CH505 TF Δ371Ι gpl20 Env, did not bind to RSC3 (Gao et al., 2014) and neutralized 13 to 99% CH505.TF infectivity.
[0266] CH235 lineage antibody frequency over total memory B cells was calculated by dividing the number of CH235 lineage antibodies identified at week 41 (n = 5; Gao et al., 2014) for the number of memory B cells analyzed (n = 27,950). CH235 lineage antibody frequency over CH505.TF gpl20 Env-specific memory B cells was calculated by dividing the number of CH235 lineage antibodies identified at weeks 264 and 323 (n = 4) for the number of CH505.Env gpl20- specific memory B cells analyzed (n = 794).
[0267] 454 Pyrosequencing of CH235 lineage heavy chains.
[0268] Antibody heavy chain gene rearrangements were PCR amplified from 6 independent lOOng genomic DNA aliquots to generate 6 barcoded libraries per sample. Multiplexed primers complementary to the IGHV FR1 or FR2 framework regions, and an IGHJ-primer were modified from the BIOMED-2 consortium primers (Boyd et al., 2009; van Dongen et al., 2003). 10- nucleotide 'barcode' sequences in the primer sets encoded sample identity and replicate library identity. AmpliTaq Gold (Roche) enzyme was used for PCR following the manufacturer's instructions, with a thermocycler program: 94°C 5 min; 35 cycles of (94°C 30 sec, 60°C 45 sec, 72°C 90 sec); and final extension at 72°C for 10 min. Following quantitation, PCR products from each replicate library were pooled in equimolar amounts, then the pooled library was run on a 1.5% agarose gel and gel extracted (Qiagen). High-throughput sequencing was performed on the 454 (Roche) platform using Titanium chemistry.
[0269] Antibody production.
[0270] Immunoglobulin genes of mAbs CH235.10 through CH235.13 were amplified from RNA from isolated cells, expression cassettes made, and mAbs expressed as described (Gao et al. 2014).
The VH genes of mAbs CH235.6 through CH235.9 were retrieved from sequences obtained through genomic DNA 454 sequencing, which were restored to full length and complemented with the VL of the phylogenetically closest identified antibody in the CH235 lineage (i.e. CH241 for CH235.6 and CH235.8, and CH236 for CH235.7 and CH235.9). We have previously described the isolation of mAbs CH235, CH236, CH239, CH240 and CH241and the inference of unmutated common ancestor (UCA) and intermediate antibodies IA1 through IA4 (Gao et al., 2014; Kepler, 2013).
[0271] Heavy chain plasmids were co-transfected with appropriate light chain plasmids at an equal ratio in Expi 293 cells using either 293Fectin or ExpiFectamine 293 transfection reagents (Thermo
Fisher Scientific) according to the manufacturer's protocols. Cultures were supplemented with
AbBooster antibody expression enhancer media (ABI Scientific) at 10% of the final culture volume 24 h after transfection. . Cultures were then incubated at 33°C for 5 more days, and supernatants were harvested and passed over a protein A affinity column. Following PBS wash and low pH elution, the pH of eluate was neutralized with lMTris pH 8.5 and samples were dialyzed against PBS. Antibodies were then aliquoted and stored at -80°C prior to use. Alternatively, for
ExpiFectamine transfections we used the enhancer provided with the kit, transfected cultures were incubated at 37°C 8% C02 for 2-6 days, harvested, concentrated and incubated overnight with Protein A beads at 4°C on a rotating shaker before loading the bead mixture in columns for purification; following PBS/NaCl wash, eluate was neutralized with trizma hydrochloride and antibody concentration was determined by Nanodrop. Purified antibodies were tested in SDS-Page Coomassie and western blots, and stored at 4°C.
[0272] Direct-binding ELISA.
[0273] Direct-binding ELISAs were performed as described previously (Bonsignori et al., 2011) with the following modifications: plates were blocked for 1 h at room temperature (RT) or overnight at 4°C (both procedures were previously validated); primary purified antibodies were tested at a starting concentrations of 100μg/ml, serially three-fold diluted and incubated for 1 h at RT; FIRP-conjugated human IgG antibody was added at optimized concentration of 1 :30,000 in assay diluent for 1 hour and developed using TMB substrate; plates were read at 450 nm in a SpectraMax 384 PLUS reader (Molecular Devices, Sunnyvale, CA); results are reported as logarithm area under the curve (LogAUC) unless otherwise noted.
[0274] For cell culture supernatant screening of RSC3 and RSC3 Δ371Ι HIV-1 Env core proteins reactivity, plates were coated with streptavidin ^g/ml); blocked plates were stored at -20°C until used; 10 μΐ/well of biotinylated avi -tagged RSC3 and RSC3 Δ371Ι were added at 2 μg/ml for 30 minutes at RT and culture supernatants were added at 1 :3 dilution in assay diluent; plates were developed for 10 min using SureBlue Reserve TMB (53-00-03; KPL, Gaithersburg, MD) equilibrated at RT.
[0275] Competition ELISAs were performed using ΙΟμΙ of primary purified monoclonal antibody, starting at 100μg/ml and diluted in a two-fold concentration, incubated for 1 h at RT; for CD4 binding site blocking assays, 10 μΐ of a saturating concentration soluble CD4 (Progenies Pharm Inc.) was added following antibody incubation step. Ten μΐ of biotinylated target Mab was added at the EC50 determined by a direct binding of biotinylated-Mab for one hour at RT. After background subtractions, percent inhibition was calculated as follows: 100-(sera triplicate mean/no inhibition control mean)* 100.
[0276] Autoimmune purified antigens histones (whole), Jo-1, RNP/Sm, Scl-70, Sm, SSA (Ro),
SSB (all from Immuno Vision) and centromere B (Prospec) were coated at optimal concentrations determined by lot-specific checkerboard with positive controls. All plasma antibody positive controls were purchased from Immuno Vision; lot-specific optimal ranges for standard curves were determined. All antibodies were tested using the same lots for each antigen and positive controls with the protocol described above. For DNA ELISA, plates were coated with 2μg/ml poly-lysine (Sigma-Aldrich) for 2 h at RT, washed 3X with PBS and blocked with PBS/2%BSA/0.05% Tween- 20 for 2h at RT. After 3X wash, DNA (LS002195, Worthington) in saline sodium citrate buffer was added for 1 h, washed and antibodies were incubated for 1 h. Secondary antibody was diluted in PBS/0.05% Tween-20. Plates were developed for 30 min. Human recombinant monoclonal antibody Ab008391 (courteously provided by David Easterhoff, Duke Human Vaccine Institute) was used as positive control. For all autoantigen ELISAs, palivizumab was used as negative control. For each antibody, LogAUC was calculated and data are presented semi -quantitatively: no binding = logAUCAb≤ 2X negative control logAUCneg ctri; to quantify antibody binding we divided (logAUCpos ctri - 2X logAUCneg ctri) in tertiles and expressed test antibody binding as weak (+), intermediate (+ +) or strong (+ + +) if logAUCAb was in the first, second or higher tertile, respectively.
[0277] Anti-cardiolipin ELISA was performed using the QUANTA Lite AC A IgG III kit (708625; INOVA Diagnostics) following manufacturer's protocol.
[0278] Assessment of virus neutralization using a large panel and calculation of
neutralization dendrograms.
[0279] Neutralizing antibody assays in TZM-bl cells were performed as described previously (Montefiori, 2005). Neutralization breadth of CH235 UCA, CH235, CH235.9 and CH235.12 neutralization breadth was assessed using the 384-well plate declination of the assay using an updated panel of 199 geographically and genetically diverse Env-pseudoviruses representing the major circulating genetic subtypes and recombinant forms as described (Seaman et al., 2010; Wu et al., 2010). The data were calculated as a reduction in luminescence units compared with control wells, and reported as IC50 in μg/ml (Montefiori, 2005).
[0280] Dendrograms were calculated using the neighbor-joining method, showing the protein sequence distance from the HIV-1 Env gpl60 sequences of 190 HIV-1 primary isolates. The clades of HIV-1, including circulating recombinant forms (CRFs) are indicated.
[0281] Antibody neutralization fingerprinting analysis.
[0282] Neutralization fingerprints were computed and compared for CH235, CH235.9 and
CH235.12 from the CH235 lineage, other CD4-binding-site antibodies, and antibodies targeting other sites of vulnerability on HIV-1 Env. The fingerprints were computed over a common panel of 165 HIV-1 strains with neutralization data for all antibodies, and a hierarchical clustering procedure was applied for building the tree, as described in (Georgiev et al., 2013). Briefly, for each antibody, the neutralization data for the common set of 165 HIV-1 strains formed that antibody's
neutralization fingerprint. The Spearman correlation coefficients for all pairs of antibody neutralization fingerprints were then computed, transforming the antibody-virus neutralization matrix into an antibody-antibody correlation matrix. This correlation matrix was then input into a hierarchical clustering procedure as a way to visualize the similarities between the neutralization fingerprints for the different antibodies. The distances in the resulting tree are thus a function of the differences between fingerprints.
[0283] VH1-46 and VH1-2 antibody dendrogram calculation.
[0284] Phylogenic trees for multiple antibodies derived from VH1-46 and VH1-2 heavy chain variable genes were calculated using the neighbor-joining method. The sequences are aligned by
Clustal Omega, calculated using ClustalW2. Dendrograms were drawn in Figtree.
[0285] Production and purification of HIV-1 Env protein complexed to antigen-binding fragments.
[0286] HIV-1 gpl20 protein from clade AE 93TH057 and antibodies of CH235, CH235.9 and CH235.12 were produced and purified as described previously (Zhou et al., 2010). Fab fragments of antibodies were prepared by digesting purified IgG with Lys-C at 37°C for 2-4 h. The digestion reaction was quenched by the addition of cOmplete protase inhibitors (Roche). The digested antibodies were passed over Protein A agarose to remove the Fc fragment. The Fab was further purified over a Superdex 200 gel filtration column and concentrated aliquots were stored at -80 °C.
[0287] X-ray crystallography.
[0288] The gpl20-antibody complexes were formed by mixing deglycosylated gpl20 with the antibody Fab in a 1 : 1.5 molar ratio. The complexes were purified by size exclusion
chromatography (Hiload 26/60 Superdex S200 prep grade; GE Healthcare) with buffer containing 0.35 M NaCl, 2.5 mM Tris (pH 7.0), and 0.02% NaN3. Fractions with gpl20-antibody complexes were concentrated to -10 mg/ml and used for crystallization experiments. All gpl20-Fab complexes were screened against 576 crystallization conditions using a Cartesian Honeybee crystallization robot. Initial crystals were grown by the vapor diffusion method in sitting drops at 20 °C by mixing 0.2 μΐ of protein complex with 0.2 μΐ of reservoir solution. Crystals were manually reproduced in hanging drops by mixing 0.50 μΐ protein complex solution with 0.5 μΐ reservoir solution.
[0289] The 93TH057 coree gpl20-CH235 complex was crystallized with a reservoir solution of
25% (w/v) of PEG2000, 0.2 M of Li2S04, 0.1 M of Tris-HCl pH 8.5 and 5% (v/v) of isopropanol and was flash frozen in liquid nitrogen in mother liquor supplemented with 15% of 2R,3R- butanediol as a cryoprotectant. The 93TH057 coree gpl20-CH235.9 complex was crystallized with a reservoir solution of 9% (w/v) of PEG8000, 19% (w/v) of PEG400, 0.1 M HEPES pH 7.5 and was flash frozen in mother liquor supplemented with an additional 15% PEG 400 as a
cryoprotectant. The 93TH057 coree gpl20-CH235.12 complex was crystallized with a reservoir solution of 10% PEG 8000, 20% PEG 400 and 100 mM HEPES, pH7.5 and was flash frozen in mother liquor supplemented with an additional 15 - 20% PEG 400 as a cryoprotectant.
[0290] Data for all crystals were collected at a wavelength of l .OOA at SER-CAT beamlines ID-22 and BM-22 (Advanced Photon Source, Argonne National Laboratory). All diffraction data were processed with the HKL2000 suite, structures were solved by molecular replacement using
PHASER, and iterative model building and refinement were performed in COOT and PHENIX, respectively. For 93TH057coree complexes with CH235.9 and CH235.12, molecular replacement solutions were obtained using EAF31403.1-CH235 complex as a search model.
[0291] Throughout the refinement processes, a cross validation (Rfree) test set consisting of 5% of the data was used and hydrogen atoms were included in the refinement model. Structure validations were performed periodically during the model building/refinement process with MolProbity. The 93TH057 coree-CH235 structure was refined to a final Rfree value of 22.9% with 96% residues in the favored region of the Ramachandran plot, and 0.1% outliers. The 93TH057 coree-CH235.9 structure was refined to a final Rfree value of 22% with 97.1% residues in the favored region of the Ramachandran plot, and 0% outliers. The 93TH057 coree-CH235.12 structure was refined to a final Rfree value of 23% with 97.0% residues in the favored region of the Ramachandran plot, and 0.1% outliers. All figures containing representations of the protein crystal structures were made with PyMOL. Gpl20 and antibody interactions were analyzed with the PISA server.
[0292] Surface Plasmon Resonance Affinity and Kinetics Measurements.
[0293] For kinetic measurement, each antibody was captured on an anti-human IgFc immobilized sensor surface (200-500RU) and gpl20 proteins at varying concentrations were injected to monitor association and dissociation phases. Buffer reference and non-specific binding to a control antibody (palivizumab) captured surface were used to derive specific binding signals. Kinetic rate constants and dissociation constant (Kd) were derived from global curve fitting analysis using a Langmuir 1 : 1 interaction model using the BIAevaluation 4.1 software (GE Healthcare).
[0294] Electron microscopy data collection and processing.
[0295] BG505 SOSIP.664 and B41 SOSIP.664 gpl40 trimers were expressed in HEK293F cells and purified by 2G12-affinity and gel filtration chromatography as described elsewhere (Pugach et al., 2015; Sanders et al., 2013). Trimers were incubated with a 10 molar excess of Fab (CH235, CH235.9, or CH235.12) overnight at room temperature and the complexes were diluted to -0.03 mg/mL prior to application onto a carbon-coated 400 Cu mesh grid that had been glow discharged at 20 mA for 30 s. The grids were stained with 2% (w/v) uranyl formate for 60 seconds. Samples were imaged using a FEI Tecnai T12 electron microscope operating at 120 keV, with an electron dose of - 25 eVA2 and a magnification of 52,000x that resulted in a pixel size of 2.05 A at the specimen plane. Images were acquired with Leginon (Suloway et al., 2005) using a Tietz TemCam- F416 CMOS camera with a nominal defocus range of 1000-1500 nm. Automated particle picking, stack creation, and initial 2D classification was performed in the Appion software suite (Lander et al., 2009). Noise and junk particles were discarded and the remaining stack was subjected to 3D classification using Relion (Scheres, 2012) with an EM volume created from the x-ray structure of ligand-free BG505 SOSIP.664 (PDB: 4zmj) low pass filtered to 60 A as the reference model. While both CH235.9 and CH235.12 bound to either B41 or BG505 at predominantly full stoichiometry (3 Fabs per trimer), CH235 bound to either trimer at sub-stoichiometric ratios (1 Fab per BG505 trimer and 2 Fabs per B41 trimer). The 3D classes representing the predominant stoichiometry for each complex were used as the initial models (low pass filtered to 40 A) for further refinement using Relion, with C3 symmetry imposed for complexes with CH235.9 or CH235.12. The total number of particles used in refinement and final resolution of the map using a Fourier shell correlation of 0.5 are as follows: BG505 in complex with CH235 - 3,467 particles (-25 A); B41 in complex with CH235 - 4,248 particles (-24 A); BG505 in complex with CH235.9 - 2,567 particles (25 A); B41 in complex with CH235.9 - 8,061 particles (19 A); BG505 in complex with CH235.12 - 15,565 particles (17 A); B41 in complex with CH235.12 - 17,023 particles (16 A).
[0296] To create figures of each Fab in complex with a representative trimer, the 3D
reconstructions for each complex were fit into an EM volume created from the x-ray structure of unliganded BG505 SOSIP.664 (PDB: 4ZMJ) low pass filtered to 30 A in UCSF Chimera (Pettersen et al., 2004) and using the "segment map" option to isolate the density of the Fab components alone. Two-dimensional back projections of the final 3D models were generated using EMAN (Tang et al., 2007).
[0297] Epitope visualization.
[0298] The HIV-1 gpl20 epitopes targeted by donor CH235 antibodies were visualized using PyMOL (Schrodinger, 2010). In this graphic program, we used 5.5-A distance for selection of epitope atom sets which were virtually identical to those defined by protein interface analysis program PISA. [0299] Monoclonal antibody CH235.9 amino acid reversion.
[0300] Primers were designed with the online Agilent Quikchange primer designer tool
(www.thermofisher.com) and were as follows (SEQ ID NOs: 184-191, in order of appearance): CH235.9N3OT: CGTGGCGTCTGGATACAACTTCACCGACTACTATATAC;
CH235.9D3 IT : CGTCTGGAT AC AACTTC AAC ACCT ACT AT AT AC ACTGGGTGC;
CH235.9G62Q: GGTCGCACAGATTACGCACAGGCGTTTGGGGA;
CH235.9G65Q: GATTACGCAGGGGCGTTTCAGGACAGAGTGTCCA;
CH235.9AIO3E: GTTAGAAATGTGGGAACGGAGGGCAGCTTGCTCCACTATG;
CH235.9G62Q/G65Q: GGTCGCACAGATTACGCACAGGCGTTTCAGGACAGAGTGTCCA; CH235.9S54R: GGATCGACCCT AGGGGTGGTCGC AC AG;
CH235.9A6 is : GTGGTCGC AC AGATT ACTC AGGGGCGTTTG.
[0301] Presence of mutations in plasmid products was confirmed by single-colony sequencing.
[0302] Structural bioinformatics.
[0303] Average buried surface area (BSA) on gpl20 was calculated for residues with BSA > 1 A2 for the gpl20-antibody complexes, and the corresponding antibody neutralization potencies were averaged for each of those residues based on data from neutralization assays. Spearman correlation between BSA on gpl20 and antibody potencies was calculated for BSA cutoffs = 0 to 85 A2 and potency loglCso cutoffs = 0.60 to 1.62 μg/ml.
[0304] Sample preparation for 5' RACE method and 454 pyrosequencing.
[0305] Human PBMCs (6x l07) were obtained from three HIV-1 and hepatitis C negative individuals (LP32647, LP08248 and LP23810). A 5 'RACE approach was developed to amplify immunoglobulin genes based on previously described methods (Venturi et al., 2011). Briefly, the PBMCs were pelleted at 1200 rpm for 8 min. mRNA was then extracted and eluted in 50 μΐ elution buffer using [iMACS mRNA isolation kit (Miltenyi Biotec) according to manufacturer's instructions. To synthesize cDNA, 10 μΐ mRNA was mixed with 1 μΐ 5'CDS Oligo dT primers (12 μΜ) and incubated at 70 °C for 1 min and then -20 °C for 1 min. Then 1 μΐ SMARTER Oligo Primer (12 μΜ) (Clontech), 4 μΐ 5X RT buffer, 1 μΐ DTT 20 (20mM), 1 μΐ dNTP (lOmM), 1 μΐ RNAse out and 1 μΐ Superscript II reverse transcriptase (Invitrogen) were added to the reaction. After 2 hours incubation at 42 °C, the cDNA products were purified using Nucleospin II kit (Macherey-Nagel) and eluted in 50 μΐ water. 454 pyrosequencing was performed as described previously (Wu et al., 2011). The first PCR amplification was performed with a common 5' primer II A (Clontech) and an Ig gene specific 3' primer
(5 ' GGGGAAGACCGATGGGCCCTTGGTGG3 ' ) (SEQ ID NO: 192) using KAPA HIFI qPCR kit (Kapa Biosystems). The PCR products were purified with 2% Size Select Clonewell E-gel (Invitrogen) and Agencourt AMPure XP beads (Beckman Coulter). The second PCR amplification was performed with primers with 454 sequencing adapters (454-RACE-F:
5 ' CC ATCTC ATCCCTGCGTGTCTCCGACTC AGAAGC AGTGGTATC AACGC AGAGT3 ' (SEQ ID NO: 193); 454-IgG-R:
5 ' CCT ATCCCCTGTGTGCCTTGGC AGTCTC AGGGGGAAGACCGATGGGCCCTTGGTGG3 ' (SEQ ID NO: 194)). The PCR products were again purified with 2% Size Select Clonewell E-gel and Agencourt AMPure XP beads.
[0306] Germline V gene specific substitution profile.
[0307] The raw reads from three healthy donors shorter than 300 nucleotides or longer than 600 nucleotides in length were not analyzed. Germline V gene was then assigned to each read using an in-house bioinformatics pipeline (Wu et al., 2015). We removed reads containing stop codons. Functional reads were then clustered using Usearch at 97% sequence identity, and one unique sequence was selected from each cluster to derive a curated dataset. To further reduce reads containing sequencing errors in the curated dataset, unique sequences having only one read in the clustering step were excluded. Finally, the curated dataset of the three donors were pooled for substitution frequency analyses.
[0308] Reads from the curated dataset that were assigned to germline V genes of interest were extracted, and were aligned using MUSCLE (Edgar, 2004). The amino acid substitution frequency or mutability of a V gene position was calculated by counting how many reads contain amino acids that are different from the germline V gene, and normalized by the total number of reads. We further calculated the frequency of the 19 types of amino acid substitutions at a position, which was used to generate positional substitution logo. The similarity of positional substitution frequency profiles between V genes of interest was measured by Pearson correlation coefficient.
[0309] Conformity analysis.
[0310] The positional conformity of a conforming antibody sequence d to a reference sequence d is defined as the number of mutated positions shared by both sequences divided by the total number of mutations in the conforming sequence. Thus:
[031 ,] c^; fi) = ^
[0312] where , represents the set of amino acid positions in sequence i which are mutated from the germline V residue. Insertions and missing data are ignored, but deletions relative to the germline V are counted as mutations. For 8ANC131 and CH235 (Figure 38 A): MsANc = {2, 9, 10, 11, 16, 19, 20, 23, 26, 30, 31, 32, 33, 34, 37, 45, 46, 48, 50, 52, 53, 55, 57, 58, 59, 60, 62, 63, 66, 68, 69, 70, 71, 74, 77, 80, 84, 85, 88, 89}
MCH235 = { 19, 23, 31, 34, 46, 47, 50, 52, 55, 57, 59, 63, 68, 83, 84}
M8ANC131 n MCH235 = { 19, 23, 31, 34, 46, 50, 52, 55, 57, 59, 63, 68, 84}
C 8ANC131, CH235j = 13 / 15 = 86.7%
[0313] Identity conformity was defined the number of positionally conforming sites in conforming antibody A which were also mutated to the same residue as in the reference antibody B. Thus:
Figure imgf000068_0001
where δ is the Kronecker delta function and Ax is the identity of the residue at position x of sequence d. For 8ANC131 and CH235 (Figure 38B): c;|8ANC131, CH235j = 4 / 15 = 26.7%
[0314] Targeting precision of CD4bs-directed antibodies.
[0315] The targeting precision of the CD4bs-directed antibodies was defined as the buried surface area inside of the CD4 binding site minus the buried surface area outside of the CD4 binding site. The buried surface area of each antigen residue was determined by NACCESS. The buried surface area from the following residue numbers were considered inside of the CD4 binding site: 257, 279, 280, 281, 282, 283, 365, 366, 367, 368, 370, 371, 455, 456, 457, 458, 459, 460, 469, 472, 473, 474, 475, 476, and 477 (Zhou et al., 2007). The buried surface areas from the rest of the residues were considered outside of the CD4 binding site. Somatic hypermutation was defined using nucleotide sequences and P values were calculated based on linear regression.
[0316] Antibody binding orientation calculation.
[0317] To calculate the relative rotation angles and translation to gpl20-bound CD4 for gpl20- bound CD4-binding site antibodies, all antibody-gpl20 complexes to be analyzed were first superposed over the outer domain of gpl20 (residue ranges: 252-392, 412-422, 437-476) with gpl20 in its CD4 complex (PDB ID: 2NXY). The calculations of rotation angles and translation were then carried out with the gpl20-aligned structures. For comparison of position of heavy chain variable domain relative to gpl20-bound CD4, the frame work regions (residues 46-52, 56-59, 66- 71 and 76-82) were superimposed to regions of CD4 domain 1 (residues 34-40, 43-46, 54-59, 65- 71). The superposition procedures were performed with the Superpose Molecules module in CCP4 (Collaborative Computational Project, 1994). The Chi angle and distance between centroids in the Superpose output was taken as the rotation angle and translation distance between CD4 and a CD4- binding site antibody. [0318] Supplemental References
[0319] Collaborative Computational Project (1994). The CCP4 suite: programs for protein crystallography. Acta Crystallogr., Sect D: Biol. Crystallogr. 50, 760-763.
[0320] Edgar, R.C. (2004). MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res. 32, 1792-1797.
[0321] Giorgi, E.E., Funkhouser, B., Athreya, G., Perelson, A.S., Korber, B.T., Bhattacharya, T. (2010). Estimating time since infection in early homogeneous HIV-1 samples using a poisson model. BMC Bioinformatics 11, 532.
[0322] Gray, E.S., Moody, M.A., Wibmer, C.K., Chen, X., Marshall, D., Amos, J., Moore, P.L., Foulger, A., Yu, J.S., Lambson, B., et al. (2011). Isolation of a monoclonal antibody that targets the alpha-2 helix of gpl20 and represents the initial autologous neutralizing-antibody response in an HIV-1 subtype C-infected individual. J. Virol. 85, 7719-7729.
[0323] Lander, G.C., Stagg, S.M., Voss, N.R., Cheng, A., Fellmann, D., Pulokas, J., Yoshioka, C, Irving, C, Mulder, A., Lau, P.W., et al. (2009). Appion: an integrated, database-driven pipeline to facilitate EM image processing. J. Struct. Biol. 166, 95-102.
[0324] Montefiori, D.C. (2005). Evaluating neutralizing antibodies against HIV, SIV, and SHIV in luciferase reporter gene assays. Current protocols in immunology / edited by John E Coligan [et al] Chapter 12, Unit 12 11.
[0325] Pettersen, E.F., Goddard, T.D., Huang, C.C., Couch, G.S., Greenblatt, D.M., Meng, E.C., and Ferrin, T.E. (2004). UCSF Chimera—a visualization system for exploratory research and analysis. J. Comput. Chem. 25, 1605-1612.
[0326] Scheres, S.H. (2012). A Bayesian view on cryo-EM structure determination. J. Mol. Biol. 415, 406-418.
[0327] Seaman, M.S., Janes, H., Hawkins, N., Grandpre, L.E., Devoy, C, Giri, A., Coffey, R.T., Harris, L., Wood, B., Daniels, M.G., et al. (2010). Tiered categorization of a diverse panel of HIV- 1 Env pseudoviruses for assessment of neutralizing antibodies. J. Virol. 84, 1439-1452.
[0328] Schrodinger, LLC (2010). The PyMOL Molecular Graphics System, Version 1.3rl .
[0329] Suloway, C, Pulokas, J., Fellmann, D., Cheng, A., Guerra, F., Quispe, J., Stagg, S., Potter, C.S., and Carragher, B. (2005). Automated molecular microscopy: the new Leginon system. J. Struct. Biol. 151, 41-60.
[0330] Tang, G, Peng, L., Baldwin, P.R., Mann, D.S., Jiang, W., Rees, I, and Ludtke, S.J. (2007).
EMAN2: an extensible image processing suite for electron microscopy. J. Struct. Biol. 157, 38-46.
[0331] Tomaras, G,D„ Yates, N.L., Liu, P., Qin, L., Fouda, G.G., Chavez, L.L., Decamp, A.C.,
Parks, R.J., Ashley, V.C., Lucas, J.T., et al. (2008). Initial B-cell responses to transmitted human immunodeficiency vims type 1 : virion-binding immunoglobulin M (IgM) and IgG antibodies followed by plasma anti-gp41 antibodies with ineffective control of initial viremia. J. Virol. 82, 12449-12463
[0332] van Dongen, J. J., Langerak, A.W., Bruggemann, M., Evans, P. A., Hummel, M., Lavender, F.L., Delabesse, E., Davi, F., Schuuring, E., Garcia-Sanz, R., et al. (2003). Design and
standardization of PCR primers and protocols for detection of clonal immunoglobulin and T-cell receptor gene recombinations in suspect lymphoproliferations: report of the BIOMED-2 Concerted Action BMH4-CT98-3936. Leukemia 17, 2257-2317.
[0333] Venturi, V., Quigley, M.F., Greenaway, H.Y., Ng, P.C., Ende, Z.S., Mcintosh, T., Asher, T.E., Almeida, J.R., Levy, S., Price, D.A., et al. (2011). A mechanism for TCR sharing between T cell subsets and individuals revealed by pyrosequencing. J Immunol. 186, 4285-4294.
[0334] Wu, X., Yang, Z.Y., Li, Y., Hogerkorp, CM., Schief, W.R., Seaman, M.S., Zhou, T., Schmidt, S.D., Wu, L., Xu, L., et al. (2010). Rational design of envelope identifies broadly neutralizing human monoclonal antibodies to HIV-1. Science 329, 856-861.
[0335] Wu, X., Zhang, Z., Schramm, C.A., Joyce, M.G., Kwon, Y.D., Zhou, T., Sheng, Z., Zhang, B., O'Dell, S., McKee, K., et al. (2015). Maturation and Diversity of the VRCOl -Antibody Lineage over 15 Years of Chronic HIV-1 Infection. Cell 161, 470-485.
[0336] Zhou, T., Xu, L., Dey, B., Hessell, A.J., Van Ryk, D., Xiang, S.H., Yang, X., Zhang, M.Y., Zwick, M.B., Arthos, J., et al. (2007). Structural definition of a conserved neutralization epitope on HIV-1 gpl20. Nature 445, 732-737.
[0337] ACCESSION NUMBERS
[0338] Coordinates and structure factors for CH235, CH235.9 and CH235.12 in complex with HIV-1 gpl20 have been deposited with the Protein Data Bank (PDB ID 5F9W, 5F90 and 5F96). Next-generation sequencing data have been deposited with the NCBI Sequence Reads Archive (SRP067168). Antibody heavy and light chains have been deposited with GenBank (KU570032- KU570053).
[0339] Antibodies Names correlation
[0340] Various antibodies names are used throughout the application. Antibodies names correlation is as follows: CH490=CH235.6; CH491=CH235.7; CH492=CH235.8;
CH493=CH235.9; CH555=CH235.10; CH556=CH235.11; CH557=CH235.12.
[0341] REFERENCES FOR EXAMPLE 8
[0342] Alam, S.M., McAdams, M., Boren, D., Rak, M., Scearce, R.M., Gao, F., Camacho, Z.T.,
Gewirth, D., Kelsoe, G., Chen, P., et al. (2007). The role of antibody polyspecificity and lipid reactivity in binding of broadly neutralizing anti -HIV-1 envelope human monoclonal antibodies 2F5 and 4E10 to glycoprotein 41 membrane proximal envelope epitopes. J. Immunol. 178, 4424- 4435.
[0343] Alam, S.M., Morelli, M., Dennison, S.M., Liao, H.X., Zhang, R., Xia, S.M., Rits-Volloch, S., Sun, L., Harrison, S.C., Haynes, B.F., et al. (2009). Role of HIV membrane in neutralization by two broadly neutralizing antibodies. Proc. Natl. Acad. Sci. U. S. A. 106, 20234-20239.
[0344] Bonsignori, M., Alam, S.M., Liao, H.X., Verkoczy, L., Tomaras, G.D., Haynes, B.F., and Moody, M.A. (2012). HIV-1 antibodies from infection and vaccination: insights for guiding vaccine design. Trends Microbiol. 20, 532-539.
[0345] Bonsignori, M., Hwang, K.K., Chen, X., Tsao, C.Y., Morris, L., Gray, E., Marshall, D.J., Crump, J. A., Kapiga, S.H., Sam, N.E., et al. (2011). Analysis of a clonal lineage of HIV-1 envelope V2/V3 conformational epitope-specific broadly neutralizing antibodies and their inferred unmutated common ancestors. J. Virol. 85, 9998-10009.
[0346] Bonsignori, M., Wiehe, K., Grimm, S.K., Lynch, R., Yang, G., Kozink, D.M., Perrin, F., Cooper, A. J., Hwang, K.K., Chen, X., et al. (2014). An autoreactive antibody from an SLE/HIV-1 individual broadly neutralizes HIV-1. J. Clin. Invest. 124, 1835-1843.
[0347] Boyd, S.D., Marshall, E.L., Merker, J.D., Maniar, J.M., Zhang, L.N., Sahaf, B., Jones, CD.,
Simen, B.B., Hanczaruk, B., Nguyen, K.D., et al. (2009). Measurement and Clinical Monitoring of
Human Lymphocyte Clonality by Massively Parallel V-D-J Pyrosequencing. Sci. Transl. Med. 1.
[0348] Dosenovic, P., von Boehmer, L., Escolano, A., Jardine, J., Freund, N.T., Gitlin, A.D.,
McGuire, A.T., Kulp, D.W., Oliveira, T., Scharf, L., et al. (2015). Immunization for HIV-1 Broadly
Neutralizing Antibodies in Human Ig Knockin Mice. Cell 161, 1505-1515.
[0349] Felsenstein, J. (2005). PHYLIP (Phylogeny Inference Package), 3.6a3 edn (Seattle, WA: distributed by the author: Department of Genome Sciences, University of Washington).
[0350] Foote, J., and Milstein, C. (1991). Kinetic maturation of an immune response. Nature 352,
530-532.
[0351] Gao, F., Bonsignori, M., Liao, H.X., Kumar, A., Xia, S.M., Lu, X., Cai, F., Hwang, K.K., Song, H., Zhou, T., et al. (2014). Cooperation of B cell lineages in induction of HIV-1 -broadly neutralizing antibodies. Cell 755, 481-491.
[0352] Georgiev, I S., Doria-Rose, N.A., Zhou, T.Q., Do Kwon, Y., Staupe, R.P., Moquin, S., Chuang, G.Y., Louder, M.K., Schmidt, S.D., Altae-Tran, H.R., et al. (2013). Delineating Antibody Recognition in Polyclonal Sera from Patterns of HIV-1 Isolate Neutralization. Science 340, 751- 756.
[0353] Haynes, B.F. (2015). New approaches to HIV vaccine development. Curr. Opin. Immunol. 35, 39-47. [0354] Haynes, B.F., and Bradley, T. (2015). Broadly Neutralizing Antibodies and the Development of Vaccines. JAMA 313, 2419-2420.
[0355] Haynes, B.F., Fleming, J., St Clair, E.W., Katinger, H., Stiegler, G., Kunert, R., Robinson,
J., Scearce, R.M., Plonk, K., Staats, H.F., et al. (2005). Cardiolipin polyspecific autoreactivity in two broadly neutralizing HIV- 1 antibodies. Science 308, 1906-1908.
[0356] Haynes, B.F., Kelsoe, G, Harrison, S.C., and Kepler, T.B. (2012). B-cell-lineage immunogen design in vaccine development with HIV-1 as a case study. Nat. Biotechnol. 30, 423-
433.
[0357] Haynes, B.F., and Verkoczy, L. (2014). AIDS/HIV. Host controls of HIV neutralizing antibodies. Science 344, 588-589.
[0358] Hraber, P., Korber, B., Wagh, K., Giorgi, E.E., Bhattacharya, T., Gnanakaran, S., Lapedes, A.S., Learn, G.H., Kreider, E.F., Li, Y., et al. (2015). Longitudinal Antigenic Sequences and Sites from Intra-Host Evolution (LASSIE) Identifies Immune- Selected HIV Variants. Viruses 7, 5443- 5475.
[0359] Hraber, P., Seaman, M.S., Bailer, R.T., Mascola, J.R., Montefiori, D.C., and Korber, B.T. (2014). Prevalence of broadly neutralizing antibody responses during chronic HIV-1 infection. AIDS 28, 163-169.
[0360] Jardine, J., ien, J.P., Menis, S., Ota, T., Kalyuzhniy, O., McGuire, A., Sok, D., Huang, P.S., MacPherson, S., Jones, M., et al. (2013). Rational HIV immunogen design to target specific germline B cell receptors. Science 340, 711-716.
[0361] Jardine, J.G, Ota, T., Sok, D., Pauthner, M., Kulp, D.W., Kalyuzhniy, O., Skog, P.D., Thinnes, T.C., Bhullar, D., Briney, B., et al. (2015). HIV-1 VACCINES. Priming a broadly neutralizing antibody response to HIV-1 using a germline-targeting immunogen. Science 349, 156- 161.
[0362] Keele, B.F., Giorgi, E.E., Salazar-Gonzalez, J.F., Decker, J.M., Pham, K.T., Salazar, M.G., Sun, C, Grayson, T., Wang, S., Li, H., et al. (2008). Identification and characterization of transmitted and early founder virus envelopes in primary HIV-1 infection. Proc. Natl. Acad. Sci. U. S. A. 105, 7552-7557.
[0363] Kepler, T.B. (2013). Reconstructing a B-cell clonal lineage. I. Statistical inference of unobserved ancestors. FlOOORes 2, 103.
[0364] Kepler, T.B., Munshaw, S., Wiehe, K., Zhang, R., Yu, J.S., Woods, C.W., Denny, T.N., Tomaras, G.D., Alam, S.M., Moody, M.A., et al. (2014). Reconstructing a B-Cell Clonal Lineage. II. Mutation, Selection, and Affinity Maturation. Front. Immunol. 5, 170. [0365] Klein, F., Diskin, R., Scheid, J.F., Gaebler, C, Mouquet, H., Georgiev, I S., Pancera, M., Zhou, T., Incesu, R.B., Fu, B.Z., et al. (2013). Somatic mutations of the immunoglobulin framework are generally required for broad and potent HIV-1 neutralization. Cell 153, 126-138.
[0366] Liao, H.X., Lynch, R., Zhou, T., Gao, F., Alam, S.M., Boyd, S.D., Fire, A.Z., Roskin, K.M., Schramm, C.A., Zhang, Z., et al. (2013). Co-evolution of a broadly neutralizing HIV-1 antibody and founder virus. Nature 496, 469-476.
[0367] Liu, M., Yang, G., Wiehe, K., Nicely, N.I., Vandergrift, N.A., Rountree, W., Bonsignori, M., Alam, S.M., Gao, J., Haynes, B.F., et al. (2015). Polyreactivity and autoreactivity among HIV- 1 antibodies. J. Virol. 89, 784-798.
[0368] Mascola, J.R., and Haynes, B.F. (2013). HIV-1 neutralizing antibodies: understanding nature's pathways. Immunol. Rev. 254, 225-244.
[0369] McDonald, I.K., and Thornton, J.M. (1994). Satisfying hydrogen bonding potential in proteins. J. Mol. Biol. 238, 777-793.
[0370] McGuire, A.T., Hoot, S., Dreyer, A.M., Lippy, A., Stuart, A., Cohen, K.W., Jardine, J., Menis, S., Scheid, J.F., West, A.P., et al. (2013). Engineering HIV envelope protein to activate germline B cell receptors of broadly neutralizing anti-CD4 binding site antibodies. J. Exp. Med. 210, 655-663.
[0371] Otwinowski, Z., and Minor, W. (1997). Processing of X-ray diffraction data collected in oscillation mode. Method Enzymol. 276, 307-326.
[0372] Pugach, P., Ozorowski, G., Cupo, A., Ringe, R., Yasmeen, A., de Val, N., Derking, R., Kim, H.J., Korzun, J., Golabek, M., et al. (2015). A native-like SOSIP.664 trimer based on an HIV- 1 subtype B env gene. J. Virol. 89, 3380-3395.
[0373] Rudicell, R.S., Do Kwon, Y., Ko, S.Y., Pegu, A., Louder, M.K., Georgiev, I S., Wu, X.L., Zhu, J., Boyington, J.C., Chen, X.J., et al. (2014). Enhanced Potency of a Broadly Neutralizing HIV-1 Antibody In Vitro Improves Protection against Lentiviral Infection In Vivo. J. Virol. 88, 12669-12682.
[0374] Sanders, R.W., Derking, R., Cupo, A., Julien, J.P., Yasmeen, A., de Val, N., Kim, H.J., Blattner, C, de la Pena, A.T., Korzun, J., et al. (2013). A next-generation cleaved, soluble HIV-1 Env trimer, BG505 SOSIP.664 gpl40, expresses multiple epitopes for broadly neutralizing but not non-neutralizing antibodies. PLoS Pathog. 9, el003618.
[0375] Scheid, J.F., Mouquet, H., Feldhahn, N., Seaman, M.S., Velinzon, K., Pietzsch, J., Ott, R.G., Anthony, R.M., Zebroski, H., Hurley, A., et al. (2009). Broad diversity of neutralizing antibodies isolated from memory B cells in HIV-infected individuals. Nature 458, 636-640. [0376] Scheid, J.F., Mouquet, H., Ueberheide, B., Diskin, R., Klein, F., Oliveira, T.Y., Pietzsch, J., Fenyo, D., Abadir, A., Velinzon, K., et al. (2011). Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding. Science 333, 1633-1637.
[0377] Sui, Z.W., Chen, Q.J., Wu, R., Zhang, H.B., Zheng, M., Wang, H.Z., and Chen, Z. (2010). Cross-protection against influenza virus infection by intranasal administration of M2 -based vaccine with chitosan as an adjuvant. Arch. Virol. 155, 535-544.
[0378] Verkoczy, L., Chen, Y., Zhang, J., Bouton-Verville, H., Newman, A., Lockwood, B., Scearce, R.M., Montefiori, D.C., Dennison, S.M., Xia, S.M., et al. (2013). Induction of HIV-1 broad neutralizing antibodies in 2F5 knock-in mice: selection against membrane proximal external region-associated autoreactivity limits T-dependent responses. J. Immunol. 191, 2538-2550.
[0379] Verkoczy, L., Diaz, M., Holl, T.M., Ouyang, Y.B., Bouton-Verville, H., Alam, S.M., Liao, H.X., Kelsoe, G., and Haynes, B.F. (2010). Autoreactivity in an HIV-1 broadly reactive
neutralizing antibody variable region heavy chain induces immunologic tolerance. Proc. Natl. Acad. Sci. U. S. A. 107, 181-186.
[0380] Verkoczy, L., Kelsoe, G., Moody, M.A., and Haynes, B.F. (2011). Role of immune mechanisms in induction of HIV-1 broadly neutralizing antibodies. Curr. Opin. Immunol. 23, 383- 390.
[0381] Wu, X., Yang, Z.Y., Li, Y., Hogerkorp, CM., Schief, W.R., Seaman, M.S., Zhou, T., Schmidt, S.D., Wu, L., Xu, L., et al. (2010). Rational design of envelope identifies broadly neutralizing human monoclonal antibodies to HIV-1. Science 329, 856-861.
[0382] Wu, X., Zhou, T., Zhu, J., Zhang, B., Georgiev, L, Wang, C, Chen, X., Longo, N.S., Louder, M., McKee, K., et al. (2011). Focused evolution of HIV-1 neutralizing antibodies revealed by structures and deep sequencing. Science 333, 1593-1602.
[0383] Yang, G, Holl, T.M., Liu, Y., Li, Y., Lu, X., Nicely, N.I., Kepler, T.B., Alam, S.M., Liao, H.X., Cain, D.W., et al. (2013). Identification of autoantigens recognized by the 2F5 and 4E10 broadly neutralizing HIV-1 antibodies. J. Exp. Med. 210, 241-256.
[0384] Zhou, T., Georgiev, I, Wu, X., Yang, Z.Y., Dai, K., Finzi, A., Kwon, Y.D., Scheid, J.F., Shi, W., Xu, L., et al. (2010). Structural basis for broad and potent neutralization of HIV-1 by antibody VRC01. Science 329, 811-817.
[0385] Zhou, T., Lynch, R.M., Chen, L., Acharya, P., Wu, X., Doria-Rose, N.A., Joyce, M.G., Lingwood, D., Soto, C, Bailer, R.T., et al. (2015). Structural Repertoire of HIV-1 -Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors. Cell 161, 1280-1292. Example 9: DH540 antibody is described elsewhere.
[0386] DH540 sequences are described in Figure 13 and the antibody is described in detail in US Ser. No. 62/170,558, filed June 3, 2015.
Example 10: DH542 antibodies
[0387] The nucleotide and amino acid sequences of the VH and VL of DH542 QSA are shown below. DH542 QSA antibody has the VH of DH542 and the VL called DH542-QSA
[0388] >DH542_HC_nt (SEQ ID NO: 178)
CAGGTGCAGCTGGTGCAGTCTGGGGCTCAAATGAAGAACCCTGGGGCCTCAGTGAAGGTCTCCTGCGCGCCT TCTGGATATACCTTCACCGACTTTTACATACATTGGTTGCGCCAGGCCCCTGGCCAGGGGCTTCAGTGGATG GGATGGATGAACCCTCAGACTGGTCGCACAAACACTGCACGAAACTTTCAGGGGAGGGTCACCATGACCAGG GACACGTCCATCGGCACAGCCTACATGGAGTTGAGAAGCCTGACATCTGACGACACGGCCATATATTACTGT ACGACAGGGGGATGGATCAGTCTTTACTATGATAGTAGTTATTACCCCAACTTTGACCACTGGGGTCAGGGA ACCCTGCTCACCGTCTCCTCAG
[0389] >DH542_HC_aa (SEQ ID NO: 179)
QVQLVQSGAQMKNPGASVKVSCAPSGYTFTDFYIHWLRQAPGQGLQWMGWMNPQTGRTNTARNFQGRVTMTR DTSIGTAYMELRSLTSDDTAIYYCTTGGWISLYYDSSYYPNFDHWGQGTLLTVSS
[0390] >DH542_LC_nt_corrected (DH542 QSA) (SEQ ID NO: 180)
CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTGGGTCTCCTGGACAGTCGATCACCATCTCCTGCACTGGA ACCAAGTATGATGTTGGGAGTCATGACCTTGTCTCCTGGTACCAACAGTACCCAGGCAAAGTCCCCAAA AC ATGATTTATGAAGTCAATAAACGGCCCTCAGGAGTTTCTAATCGCTTCTCTGGCTCCAAATCTGGCAACACG GCCTCCCTGACAATCTCTGGGCTCCGGGCTGAGGACGAGGCTGACTATTATTGCTGTTCATTTGGAGGGAGT GCCACCGTGGTCTGCGGCGGCGGGACCAAGGTGACCGTCCTAg
[0391] >DH542_LC_aa_corrected (DH542_QSA) (SEQ ID NO: 181)
QSALTQPASVSGSPGQSITISCTGTKYDVGSHDLVSWYQQYPGKVPKYMIYEVNKRPSGVSNRFSGSKSGNT ASL ISGLRAEDEADYYCCSFGGSA VVCGGGTKV VL
[0392] DH542-L4 is an antibody that has a VH of DH542 and VL of DH429 (Figure 2).
Example 11: MPER antibodies
[0393] DH512 K3 is a combination of VH DH512 and VL called DH511 2AVK
[0394] >DH511 2AVK Kappa Chain Nucleotide Sequence (SEQ ID NO: 182)
GACATCCAGATGACCCAGTCTCCGTCTTTCCTGTACGGCTCTGTAGGCGATAGAGTCACCATCACTTGCCGG GCAAGTCAGAATATTAAGGACTATTTAAATTGGTATCAGCAGAGACCAGGGAGAGCCCCTAGACTCCTGATC TATGCTGCATCCAATTTGCAAAGTGGGGTCCCGTCAAGGTTCAGTGGCAGTGGATATGGGACAGACTTTACT CTCATCATCAGCAGTCTGCAACCTGAGGACTTTGCGACTTATTTCTGTCAAGAGAGTTATAGTTCTACGCCC ACACACATTTTTGGCCTGGGGACCAAATTGGAGAAGAAAC
[0395] >DH511 2AVK Kappa Chain Amino Acid Sequence (SEQ ID NO: 183)
DIQMTQSPS FLYGSVGDRVT ITCRASQNIKDYLNWYQQRPGRAPRLLIYAASNLQSGVPSRFSGSGYGTDFT LI I S SLQPEDFATY FCQE SY SSTPTH I FGLGTKLEKKX
[0396] There are also MPER antibodies which have a mutated VH from DH512 (See Figure 48).
Other assays
[0397] Epitope mapping of antibodies: Binding and/or neutralization assays using various envelope antigens can be used to determine the epitope recognized by these antibodies.
[0398] The stability and properties of the antibodies, for example as formulated in a composition for treatment will be tested.
[0399] Animal studies (PK and PD studies) could be conducted to determine the distribution and half life of the antibodies.
[0400] Various assays and experiments can be designed to analyze prevention, treatment and/or cure.
[0401] The antibodies will be expressed in a CHO line, e.g. CHO-DG44 cell line for preparation of pharmaceutical compositions. These CHO-expressed antibodies will be analyzed in various suitable assays.

Claims

WHAT IS CLAIMED IS:
1. A recombinant antibody or fragment thereof with the binding specificity of the CD4 binding site antibody CH557.
2. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof is fully human.
3. A recombinant antibody or fragment thereof comprising: a variable heavy chain (VH) amino acid sequence, or fragment thereof, selected from the group of VH amino acid sequences of an antibody CH490, CH491, CH492, CH493, CH555, CH556 and CH557 and
a variable light chain (VL) amino acid sequence or fragment thereof, selected from the group of VL amino acid sequences of an antibody CH490, CH491, CH492, CH493, CH555, CH556 and CH557, wherein the recombinant antibody or fragment thereof binds to the CD4 binding site of the HIV- 1 envelope.
4. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises a VH chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VH chain of antibody CH557 and comprises a VL chain that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the VL chain of antibody CH557.
5. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises a VH chain which comprises the HCDR1, HCDR2, and HCDR3 of antibody CH557 and a VL chain which comprises the LCDR1, LCDR2, and LCDR3 of antibody CH557.
6. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises the VH chain and the VL chain of antibody CH557.
7. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof
comprises a modified Fc portion.
8. The antibody or fragment thereof of claim 1 wherein the antibody or fragment thereof is
bispecific.
9. A pharmaceutical composition comprising anyone of the antibodies or fragments thereof of any one of claims 1-8.
10. A pharmaceutical composition comprising anyone of the antibodies of any one of claim 1-8 and another HIV-1 broad neutralizing antibody.
11. A composition comprising a vector comprising a nucleic acid encoding the antibody or
fragment thereof of any one of claims 1-8.
12. The composition of claim 11, wherein the vector is suitable for gene delivery and expression.
13. A method to treat or prevent HIV-1 infection in a subject comprising administering to the subject a composition comprising an antibody or fragment thereof with the binding specificity of CH557 in a therapeutically effective amount.
14. The method of claim 13 wherein the pharmaceutical composition is administered in a
therapeutically effective dose and regimen.
15. The method of claim 13 further comprising administering an additional HIV-1 broad
neutralizing antibody.
PCT/US2016/023355 2015-03-19 2016-03-21 HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF (CD4bs ANTIBODIES) Ceased WO2016149695A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US15/559,171 US10450368B2 (en) 2015-03-19 2016-03-21 HIV-1 neutralizing antibodies and uses thereof (CD4bs antibodies)
PCT/US2016/041809 WO2017011414A1 (en) 2015-07-10 2016-07-11 Bispecific molecules comprising an hiv-1 envelope targeting arm

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US201562135309P 2015-03-19 2015-03-19
US62/135,309 2015-03-19
US201562191095P 2015-07-10 2015-07-10
US62/191,095 2015-07-10
US201562222115P 2015-09-22 2015-09-22
US62/222,115 2015-09-22
US201562260100P 2015-11-25 2015-11-25
US62/260,100 2015-11-25
US201662301993P 2016-03-01 2016-03-01
US62/301,993 2016-03-01

Publications (1)

Publication Number Publication Date
WO2016149695A1 true WO2016149695A1 (en) 2016-09-22

Family

ID=56919383

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/023355 Ceased WO2016149695A1 (en) 2015-03-19 2016-03-21 HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF (CD4bs ANTIBODIES)

Country Status (2)

Country Link
US (1) US10450368B2 (en)
WO (1) WO2016149695A1 (en)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10450368B2 (en) 2015-03-19 2019-10-22 Duke University HIV-1 neutralizing antibodies and uses thereof (CD4bs antibodies)
EP3519428A4 (en) * 2016-10-03 2020-07-08 Duke University METHOD FOR IDENTIFYING IMMUNOGENIC BY TARGETING UNLIKIBLE MUTATIONS
EP3831848A1 (en) * 2019-12-02 2021-06-09 Universität zu Köln Broadly neutralizing antibodies against hiv
WO2021248198A1 (en) * 2020-06-10 2021-12-16 The University of Melbourne Hiv-1 antibodies
US11246920B2 (en) 2016-03-03 2022-02-15 Duke University Compositions and methods for inducing HIV-1 antibodies
US11299751B2 (en) 2016-04-29 2022-04-12 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11318197B2 (en) 2016-03-03 2022-05-03 Duke University Compositions and methods for inducing HIV-1 antibodies
US11326182B2 (en) 2016-04-29 2022-05-10 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11795226B2 (en) 2017-12-12 2023-10-24 Macrogenics, Inc. Bispecific CD16-binding molecules and their use in the treatment of disease
EP3997119A4 (en) * 2019-07-08 2023-11-22 California Institute of Technology Anti-hiv vaccine antibodies with reduced polyreactivity
US12138304B2 (en) 2018-10-01 2024-11-12 Duke University HIV-1 envelope stabilizing mutations
US12612449B2 (en) 2020-06-10 2026-04-28 The University Of Melbourne HIV-1 antibodies

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2016232693B2 (en) 2015-03-19 2021-08-12 Duke University HIV-1 neutralizing antibodies and uses thereof
CN106047857B (en) * 2016-06-01 2020-04-03 苏州金唯智生物科技有限公司 A method for discovering specific functional antibodies
EP4474392A1 (en) * 2023-06-09 2024-12-11 Universität zu Köln Broadly neutralizing antibodies targeting the cd4 binding site on hiv env
TW202504925A (en) * 2023-06-09 2025-02-01 科隆大學 Broadly neutralizing antibodies targeting the cd4 binding site on hiv env

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001043779A2 (en) * 1999-12-16 2001-06-21 Tanox, Inc. Anti-hiv-1 conjugates for treatment of hiv disease
US20040162298A1 (en) * 2002-02-23 2004-08-19 Hsu-Tso Ho Method of treating HIV infection by preventing interaction of CD4 and gp120
US20140248295A1 (en) * 2012-12-18 2014-09-04 The Rockefeller University Glycan-modified anti-cd4 antibodies for hiv prevention and therapy

Family Cites Families (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2006524039A (en) 2003-01-09 2006-10-26 マクロジェニクス,インコーポレーテッド Identification and production of antibody containing mutant Fc region and use thereof
US7960512B2 (en) 2003-01-09 2011-06-14 Macrogenics, Inc. Identification and engineering of antibodies with variant Fc regions and methods of using same
SI1629011T1 (en) 2003-05-31 2010-05-31 Micromet Ag Human anti-human cd3 binding molecules
US20050249723A1 (en) 2003-12-22 2005-11-10 Xencor, Inc. Fc polypeptides with novel Fc ligand binding sites
US8802820B2 (en) 2004-11-12 2014-08-12 Xencor, Inc. Fc variants with altered binding to FcRn
US9284375B2 (en) 2005-04-15 2016-03-15 Macrogenics, Inc. Covalent diabodies and uses thereof
US9963510B2 (en) 2005-04-15 2018-05-08 Macrogenics, Inc. Covalent diabodies and uses thereof
US7458704B2 (en) 2005-12-14 2008-12-02 Konica Minolta Opto, Inc. Optical element and illuminating device
EP3424951A1 (en) 2007-06-21 2019-01-09 MacroGenics, Inc. Covalent diabodies and uses thereof
US8795667B2 (en) 2007-12-19 2014-08-05 Macrogenics, Inc. Compositions for the prevention and treatment of smallpox
CN107325182A (en) 2008-04-02 2017-11-07 宏观基因有限公司 HER2/neu specific antibodies and its application method
ES2675730T3 (en) 2008-06-04 2018-07-12 Macrogenics, Inc. Antibodies with altered FcRn binding and methods of use thereof
EP2376109B1 (en) 2008-12-19 2019-01-23 MacroGenics, Inc. Covalent diabodies and uses thereof
AU2010298025B2 (en) 2009-09-25 2016-04-21 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Neutralizing antibodies to HIV-1 and their use
US8637035B2 (en) * 2010-07-16 2014-01-28 Academia Sinica Anti-dengue virus antibodies
EP2601216B1 (en) 2010-08-02 2018-01-03 MacroGenics, Inc. Covalent diabodies and uses thereof
CA2832389A1 (en) 2011-04-20 2012-10-26 Genmab A/S Bispecific antibodies against her2 and cd3
CA2835522C (en) 2011-05-09 2019-06-11 Duke University Focused evolution of hiv-1 neutralizing antibodies revealed by crystal structures and deep sequencing
CA2836873C (en) 2011-05-21 2019-10-22 Macrogenics, Inc. Deimmunized serum-binding domains and their use for extending serum half-life
DK2714733T3 (en) 2011-05-21 2019-05-06 Macrogenics Inc CD3 BINDING MOLECULES ABLE TO BIND TO HUMAN AND NON-HUMAN CD3
AU2012265156B2 (en) 2011-05-27 2017-01-19 F. Hoffmann-La Roche Ag Dual targeting
JOP20200236A1 (en) 2012-09-21 2017-06-16 Regeneron Pharma Anti-cd3 antibodies, bispecific antigen-binding molecules that bind cd3 and cd20, and uses thereof
JP6676521B2 (en) 2013-03-14 2020-04-08 マクロジェニクス,インコーポレーテッド Bispecific molecules, pharmaceutical compositions and uses thereof
US10286057B2 (en) * 2013-04-15 2019-05-14 Duke University Cyclic HIV-1 Env V3 glycopeptide immunogens
UA116479C2 (en) 2013-08-09 2018-03-26 Макродженікс, Інк. SPECIFIC MONOVALENT Fc-DIATELY CONNECTING BACKGROUND OF THE CD32B AND CD79b AND ITS APPLICATION
EP2840091A1 (en) 2013-08-23 2015-02-25 MacroGenics, Inc. Bi-specific diabodies that are capable of binding gpA33 and CD3 and uses thereof
EP2839842A1 (en) 2013-08-23 2015-02-25 MacroGenics, Inc. Bi-specific monovalent diabodies that are capable of binding CD123 and CD3 and uses thereof
WO2016149695A1 (en) 2015-03-19 2016-09-22 Duke University HIV-1 NEUTRALIZING ANTIBODIES AND USES THEREOF (CD4bs ANTIBODIES)
WO2016196975A1 (en) 2015-06-03 2016-12-08 The United States Of America, As Represented By The Secretary Department Of Health & Human Services Neutralizing antibodies to hiv-1 env and their use

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2001043779A2 (en) * 1999-12-16 2001-06-21 Tanox, Inc. Anti-hiv-1 conjugates for treatment of hiv disease
US20040162298A1 (en) * 2002-02-23 2004-08-19 Hsu-Tso Ho Method of treating HIV infection by preventing interaction of CD4 and gp120
US20140248295A1 (en) * 2012-12-18 2014-09-04 The Rockefeller University Glycan-modified anti-cd4 antibodies for hiv prevention and therapy

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
BONSIGNOR I ET AL.: "An autoreactive antibody from an SLE/HIV-1 individual broadly neutralizes HIV-1", J CLIN INVEST., vol. 124, no. 4, 10 March 2014 (2014-03-10), pages 1835 - 43, XP055311706 *
FERA ET AL.: "Affinity maturation in an HIV broadly neutralizing B- cell lineage through reorientation of variable domains", PROC NATL ACAD SCI USA., vol. 111, no. 28, 30 June 2014 (2014-06-30), pages 10275 - 80, XP055311707 *
LIU ET AL.: "Polyreactivity and autoreactivity among HIV-1 antibodies", J VIROL., vol. 89, no. 1, 29 October 2014 (2014-10-29), pages 784 - 98, XP055311708 *

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10450368B2 (en) 2015-03-19 2019-10-22 Duke University HIV-1 neutralizing antibodies and uses thereof (CD4bs antibodies)
US11246920B2 (en) 2016-03-03 2022-02-15 Duke University Compositions and methods for inducing HIV-1 antibodies
US11318197B2 (en) 2016-03-03 2022-05-03 Duke University Compositions and methods for inducing HIV-1 antibodies
US11326182B2 (en) 2016-04-29 2022-05-10 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11299751B2 (en) 2016-04-29 2022-04-12 Voyager Therapeutics, Inc. Compositions for the treatment of disease
US11161895B2 (en) 2016-10-03 2021-11-02 Duke University Methods to identify immunogens by targeting improbable mutations
US11746143B2 (en) 2016-10-03 2023-09-05 Duke University Methods to identify immunogens by targeting improbable mutations
EP3519428A4 (en) * 2016-10-03 2020-07-08 Duke University METHOD FOR IDENTIFYING IMMUNOGENIC BY TARGETING UNLIKIBLE MUTATIONS
US11795226B2 (en) 2017-12-12 2023-10-24 Macrogenics, Inc. Bispecific CD16-binding molecules and their use in the treatment of disease
US12138304B2 (en) 2018-10-01 2024-11-12 Duke University HIV-1 envelope stabilizing mutations
EP3997119A4 (en) * 2019-07-08 2023-11-22 California Institute of Technology Anti-hiv vaccine antibodies with reduced polyreactivity
US12459990B2 (en) 2019-07-08 2025-11-04 California Institute Of Technology Anti-HIV vaccine antibodies with reduced polyreactivity
EP3831848A1 (en) * 2019-12-02 2021-06-09 Universität zu Köln Broadly neutralizing antibodies against hiv
WO2021110764A1 (en) * 2019-12-02 2021-06-10 Universität Zu Köln Broadly neutralizing antibodies against hiv
CN115023437A (en) * 2019-12-02 2022-09-06 科隆大学 Broadly neutralizing antibodies against HIV
CN116171165A (en) * 2020-06-10 2023-05-26 墨尔本大学 HIV-1 antibody
WO2021248198A1 (en) * 2020-06-10 2021-12-16 The University of Melbourne Hiv-1 antibodies
EP4165079A4 (en) * 2020-06-10 2024-06-12 The University of Melbourne ANTI-HIV-1 ANTIBODIES
US12612449B2 (en) 2020-06-10 2026-04-28 The University Of Melbourne HIV-1 antibodies

Also Published As

Publication number Publication date
US10450368B2 (en) 2019-10-22
US20180079801A1 (en) 2018-03-22

Similar Documents

Publication Publication Date Title
US10450368B2 (en) HIV-1 neutralizing antibodies and uses thereof (CD4bs antibodies)
US11071783B2 (en) HIV-1 neutralizing antibodies and uses thereof
US12202886B2 (en) Neutralizing antibodies to GP120 and their use
Cale et al. Virus-like particles identify an HIV V1V2 apex-binding neutralizing antibody that lacks a protruding loop
US10344077B2 (en) HIV-1 neutralizing antibodies and uses thereof (V3 antibodies)
Kumar et al. An HIV-1 broadly neutralizing antibody from a clade C-infected pediatric elite neutralizer potently neutralizes the contemporaneous and autologous evolving viruses
WO2017011414A1 (en) Bispecific molecules comprising an hiv-1 envelope targeting arm
US20200199204A1 (en) Broadly Neutralizing Monoclonal Antibodies Against HIV-1 V1V2 Env Region
US20250019443A1 (en) Antibodies that target hla-e-host peptide complexes and uses thereof
EP2707388B1 (en) Focused evolution of hiv-1 neutralizing antibodies revealed by crystal structures and deep sequencing
CA3192706A1 (en) Coronavirus antibodies and uses thereof
CN115023437A (en) Broadly neutralizing antibodies against HIV
Wang et al. Human CD4-binding site antibody elicited by polyvalent DNA prime-protein boost vaccine neutralizes cross-clade tier-2-HIV strains
WO2018053328A1 (en) Bispecific molecules comprising an hiv-1 envelope targeting arm
US11944681B2 (en) HIV-1 neutralizing antibodies and uses thereof
EP4388012A1 (en) Antibodies that target hla-e-host peptide complexes and uses thereof
WO2024206190A1 (en) Antibodies that target hla-e-host peptide complexes and uses thereof
WO2023122211A2 (en) Coronavirus antibodies and uses thereof
HK40046504A (en) Broadly neutralizing monoclonal antibodies against hiv-1 v1v2 env region

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16765887

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15559171

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 16765887

Country of ref document: EP

Kind code of ref document: A1