WO2016142329A1 - Glycosylated aroma- and fragrance precursors and fragrance products that can be activated - Google Patents

Glycosylated aroma- and fragrance precursors and fragrance products that can be activated Download PDF

Info

Publication number
WO2016142329A1
WO2016142329A1 PCT/EP2016/054760 EP2016054760W WO2016142329A1 WO 2016142329 A1 WO2016142329 A1 WO 2016142329A1 EP 2016054760 W EP2016054760 W EP 2016054760W WO 2016142329 A1 WO2016142329 A1 WO 2016142329A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
aroma
products
sequence
glycoside
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2016/054760
Other languages
French (fr)
Inventor
Wilfried Schwab
Thomas Hoffmann
Fong-Chin Huang
Thilo Fischer
Detlef Erich HINZ
Heimo ADAMSKI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Technische Universitaet Muenchen
Original Assignee
Technische Universitaet Muenchen
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Technische Universitaet Muenchen filed Critical Technische Universitaet Muenchen
Priority to EP16708170.2A priority Critical patent/EP3264906B1/en
Priority to US15/556,209 priority patent/US20180127681A1/en
Publication of WO2016142329A1 publication Critical patent/WO2016142329A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11BPRODUCING, e.g. BY PRESSING RAW MATERIALS OR BY EXTRACTION FROM WASTE MATERIALS, REFINING OR PRESERVING FATS, FATTY SUBSTANCES, e.g. LANOLIN, FATTY OILS OR WAXES; ESSENTIAL OILS; PERFUMES
    • C11B9/00Essential oils; Perfumes
    • C11B9/0003Compounds of unspecified constitution defined by the chemical reaction for their preparation
    • AHUMAN NECESSITIES
    • A21BAKING; EDIBLE DOUGHS
    • A21DTREATMENT OF FLOUR OR DOUGH FOR BAKING, e.g. BY ADDITION OF MATERIALS; BAKING; BAKERY PRODUCTS
    • A21D2/00Treatment of flour or dough by adding materials thereto before or during baking
    • A21D2/08Treatment of flour or dough by adding materials thereto before or during baking by adding organic substances
    • A21D2/14Organic oxygen compounds
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23LFOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES, NOT OTHERWISE PROVIDED FOR; PREPARATION OR TREATMENT THEREOF
    • A23L27/00Spices; Flavouring agents or condiments; Artificial sweetening agents; Table salts; Dietetic salt substitutes; Preparation or treatment thereof
    • A23L27/20Synthetic spices, flavouring agents or condiments
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11BPRODUCING, e.g. BY PRESSING RAW MATERIALS OR BY EXTRACTION FROM WASTE MATERIALS, REFINING OR PRESERVING FATS, FATTY SUBSTANCES, e.g. LANOLIN, FATTY OILS OR WAXES; ESSENTIAL OILS; PERFUMES
    • C11B9/00Essential oils; Perfumes
    • C11B9/0007Aliphatic compounds
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11BPRODUCING, e.g. BY PRESSING RAW MATERIALS OR BY EXTRACTION FROM WASTE MATERIALS, REFINING OR PRESERVING FATS, FATTY SUBSTANCES, e.g. LANOLIN, FATTY OILS OR WAXES; ESSENTIAL OILS; PERFUMES
    • C11B9/00Essential oils; Perfumes
    • C11B9/0069Heterocyclic compounds
    • C11B9/0073Heterocyclic compounds containing only O or S as heteroatoms
    • C11B9/0076Heterocyclic compounds containing only O or S as heteroatoms the hetero rings containing less than six atoms
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/16Organic compounds
    • C11D3/20Organic compounds containing oxygen
    • C11D3/22Carbohydrates or derivatives thereof
    • C11D3/221Mono, di- or trisaccharides or derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/50Perfumes
    • CCHEMISTRY; METALLURGY
    • C11ANIMAL OR VEGETABLE OILS, FATS, FATTY SUBSTANCES OR WAXES; FATTY ACIDS THEREFROM; DETERGENTS; CANDLES
    • C11DDETERGENT COMPOSITIONS; USE OF SINGLE SUBSTANCES AS DETERGENTS; SOAP OR SOAP-MAKING; RESIN SOAPS; RECOVERY OF GLYCEROL
    • C11D3/00Other compounding ingredients of detergent compositions covered in group C11D1/00
    • C11D3/50Perfumes
    • C11D3/502Protected perfumes
    • C11D3/507Compounds releasing perfumes by thermal or chemical activation
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/10Transferases (2.)
    • C12N9/1048Glycosyltransferases (2.4)
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/02Monosaccharides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/18Preparation of compounds containing saccharide radicals produced by the action of a glycosyl transferase, e.g. alpha-, beta- or gamma-cyclodextrins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12PFERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P19/00Preparation of compounds containing saccharide radicals
    • C12P19/44Preparation of O-glycosides, e.g. glucosides
    • AHUMAN NECESSITIES
    • A23FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23VINDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00Food compositions, function of food ingredients or processes for food or foodstuffs

Definitions

  • the present invention discloses the full application of biotechnologically produced inactive aroma- and fragrance/scent precursors in new concentration ranges beyond those of natural aroma glycoside sources, which can be activated by external triggers like enzymes, temperature and pH, and then release the aroma and the fragrance.
  • the present invention discloses the use of biotechnologically produced inactive fragrance precursors in every-day commodities which can be activated by external triggers like enzymes, temperature and pH.
  • Products which - in addition to the inactive fragrance precursor - already include the necessary enzyme in e.g. a dry state for activation only need wetting/moistening by water to release the desired fragrance.
  • Flavorings and fragrances are used in the field of foods, hygiene and body care / personal hygiene in manifold ways.
  • the flavorings and fragrances applied are often coming from natural sources, particularly plants.
  • Many of these flavorings and fragrances are nowadays also produced by chemical synthesis or naturally (according to flavorings regulation (EG). No. 1334/2008 Art. 3(2)(c)) via biotechnology and are already accepted on the market in this form.
  • the quality of a flavoring or a fragrance is determined by its perceived taste and/or odor. This depends, among others, on the concentration of the added/inserted flavoring or fragrance.
  • the taste or odor should be sensed as pleasant by the consumer and have a taste or smell in line with its application. Generally, however, only a limited number of flavorings and fragrances is used. This is evident, for example, by recurring ingredients in deodorants, like geraniol (smell of roses), which is included in about 48% of such products. Variants of the products often are simply designed using finely tuned, special mixtures of well-known components.
  • a surprisingly simple, natural solution for releasing bound flavorings is found in fruits and other organs of several plants.
  • Many secondary metabolites of plant origin i.e. substances which are only present in specific plant groups, are stored in the plant in the form of glycosides, i.e. bound to a sugar (Fig. 1). In this way the substances are stabilized and commonly biologically inactive, are not volatile and water soluble.
  • Flavorings and fragrances bound to a sugar are not any more active as flavorings or fragrances in this form - as glycosides. The release of such bound aromas takes place in nature only by dissolving cellular structures by released enzymes, e.g.
  • glycosidases from the vacuole, or through microbial enzymes which release the actual active agent from its carrier molecule glucose (Fig. 2). Apart from the enzymatic cleavage the release of the aroma agent can also take place by heating or changing the pH value.
  • Basic examples are the aroma glycosides of grape vines. The terpenes released from glycosides are natural attractants promoting the consumption of the fruit and therefore the spreading of the seeds. They are also important components of the wine aroma after their release by fermentation.
  • a few hundred aroma glycosides are present in plants. They are produced in the cell by so-called glycosyltransferases which transfer to the respective aroma molecule a sugar residue, often glucose, i.e. glycosylate it. This stabilizes the compound in water-soluble and non-volatile form.
  • the glycosyltransferases often convert various flavorings and fragrances, but often prefer one substance class.
  • the multitude of flavorings and fragrances occurring is accompanied by a likewise multitude of glycosyltransferases whose genes can be isolated from exactly these plants in which such a glycoside of interest is contained. These genes can be introduced into GRAS- organisms (generally recognized as safe / genetically regarded as safe) like yeast or distinct E. co/i strains and thus enable these to glycosylate almost arbitrary substances.
  • glycosyltransferase genes have to be isolated and cloned for a specific biotechnological application. But it is usually quite difficult to identify exactly the glycosyltransferase of interest in a specific plant with an interesting glycoside as the desired glycosyltransferase is only one of hundreds present in every plant.
  • Methods for the release then are temperature, oxidation, light, enzymes, microorganism and hydrolases as well as changes of the pH-value (Herrmann, 2007, Angew. Chem. Int. Ed. Engl. 46, 5836-5863).
  • Volatile compounds are also encapsulated into wrappings of different materials and different dimensions ("micro-, macro- and nanoencapsulation”), are thus not volatile anymore and can be released by different methods: solvation in water, temperature, mechanical forces, enzymes, chemical reactions and pH change.
  • the methods of release are not related to the flavoring or fragrance, though, but to the capsule material.
  • the applicability of these methods is limited to products with high prices as the encapsulation, respectively binding to carriers, is complex and thus expensive.
  • the flavorings and fragrances can diffuse through the capsule material at longer storage times and thus be lost. This technique is less suitable for additives to foods, as the capsule material would reach the food as well (Feng et al., 2009, Recent Pat Food Nutr. Agric. 1, 193-202).
  • flavorings and fragrances are bound to carrier materials, e.g. cyclodextrins, starch, and/or proteins.
  • carrier materials e.g. cyclodextrins, starch, and/or proteins.
  • methods like extrusion, spray-drying, agglomeration, e.g. wet agglomeration in mixers or fluidized bed agglomeration, or in recent days especially fluidized bed - spray granulation, are applied.
  • An important feature herein is that the flavorings and fragrances are subject to a depot effect, i.e. they can be defined, but not be controlled during the further process of release as the desorption and diffusion rate is fixed.
  • an additional material is needed as carrier, so that also here contaminants/impurities are needed (Feng et al., 2009, Recent Pat Food Nutr. Agric. 1, 193-202).
  • glycosyltransferases only differ from natural glycosyltransferases in their coding nucleic acid sequence in a few nucleic acids, making up a change in only a few amino acids, they achieve a remarkably improved production of aroma glycosides and, apart from that, also are able to form aroma glycosides that could not be produced until now.
  • the present invention relates to a product or composition comprising at least one aroma glycoside comprising an aglycone component and at least one sugar component, wherein the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions.
  • the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in the present product or composition coded by a nucleic acid sequence that
  • a) comprises the sequence of SEQ-IDi, SEQ-I D2, or SEQ-ID3;
  • b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to SEQ-ID1, SEQ-ID2, or SEQ-ID3; or
  • c) comprises a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or
  • d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
  • a third aspect of the invention relates to a nucleic acid molecule encoding a glycosyltransferase according to the invention, wherein said nucleic acid molecule is a DNA molecule, particularly a cDNA molecule.
  • a vector comprising a DNA sequence encoding a glycosyltransferase according to the invention is disclosed.
  • a host cell containing or transfected with the nucleic acid molecule according to the invention or the vector according to the invention is disclosed as a fifth aspect of the present invention.
  • a sixth aspect of the present invention relates to a transgenic plant comprising the nucleic acid molecule of the invention or a vector of the invention.
  • a seventh aspect of the present invention is a method of forming at least one aroma glycoside, wherein an aglycone is covalently linked to a sugar donor comprising contacting the aglycone with the sugar donor and the glycosyltransferase of the invention under conditions appropriate for the transfer of the sugar group of said sugar donor.
  • a method of producing at least one aroma glycoside is disclosed, said method comprising the steps of:
  • a ninth aspect of the invention relates to a product produced by the inventive methods.
  • Fig. 1 shows an abstract schematic of the composition of the glycosides used in the present invention.
  • Fig. 2 depicts schematically the release of the flavoring or fragrance from the aroma glycosides.
  • Fig. 3 shows the use of an aglyca library to produce aroma glycosides
  • Fig. 4 discloses the data of a fragrance precursor mixture Stamm4GENEWstoffgemisch", 4GENE fragrance mixture) in body deodorant used in example 1.
  • FIG. 5 shows pictures A 1: Photos of the breads from baking test 1 in Example 5 after the baking process: 1.1 blind (negative) sample; 1.2 a-c: sample blanks; 1.3 control; 1.4 recovery
  • FIG. 6 shows pictures A 2: Photos of the breads from baking test 2 in Example 5 after the baking process: 2.1 blind (negative) sample; 2.2 a-c: sample blanks; 2.3 recovery
  • Fig. 7 shows pictures A3: Photos of the breads from baking test 3 in Example 5 after the baking process: 3.1 blind (negative) sample; 3.2 a-c: sample blanks; 3.3 recovery
  • Fig. 9 shows Picture A5 of the Triangle test in Example 5 - sensory vessels with bread samples
  • Fig. 11 the determination of the enzyme activity of FaGTsi-5 and FaGTsi-13 in Example 11 is shown. Detailed description of the present invention
  • the present invention relates to a product or composition comprising at least one aroma glycoside comprising an aglycone component and at least one sugar component, wherein the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions.
  • glycoside is a molecule in which a sugar (the “glycone” part or “glycone component” of the glycoside) is bonded to a non-sugar (the “aglycone” part or “aglycone component”) via a glycosidic bond.
  • a glycoside may consist of a sugar as glycone component linked through its anomeric carbon atom to e.g. the hydroxy group of an alcohol (chemical structure R-OH) as aglycone component.
  • R-OH chemical structure
  • the glycone component glucose is linked to the aglycone component linalool.
  • a glycoside can be produced by carrying out a reaction in which an aglycone component is mixed under appropriate conditions with a sugar donor in the presence of a glycosyltransferase as enzymatic catalyzer.
  • a glycoside can be produced by culturing or growing a host cell or transgenic plant expressing a glycosyltransferase according to the invention when adding the respective aglycone and sugar. During culture/growth, such a host cell or transgenic plant will generate glycosides. The glycoside(s) generated in such a host cell or transgenic plant can subsequently be collected from said host cell or transgenic plant by standard methods of extraction and/or chromatography (such as solvent extraction, solid phase extraction and reversed phase chromatography).
  • the aroma - and thus the aglycone - are not particularly restricted and can be any that is available, either from natural sources or produced synthetically.
  • the aroma glycoside is produced from a natural source, e.g. in a plant or in microorganisms.
  • the aroma glycoside can then be introduced into the product or composition, thus producing a man- made product or composition, which is not particularly restricted.
  • cosmetic products e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes
  • hygienic products e.g.
  • diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds food products, e.g.. bakery products, frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes / bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g.
  • wood preservatives, wallpapers, mold-fightings /mold control, and odor colors wood preservatives, wallpapers, mold-fightings /mold control, and odor colors
  • insect repellents e.g. skin creams (topical), candies (orally), and candles
  • products for electronic devices e.g. odor TVs / 4D TVs, and smartphone gadgets.
  • concentrates of the aroma glycosides can be produced that can be then used for producing any of the products or compositions.
  • aroma glycosides being aroma and odor precursors, that can be activated and produced biotechnologically by the glycosyltransferases according to the invention are described below.
  • a basis thereof are aromas like flavorings and fragrances of natural origin that can then be glycosylated, with a small selection of the most important flavorings and fragrances presented in table 2, although not limited thereto; generally, all alcohols of the list of the European union can also be envisioned (“COMMISSION IMPLEMENTI NG REGULATION (EU) No 872/2012 of 1 October 2012 adopting the list of flavoring substances provided for by Regulation (EC) No 2232/96 of the European Parliament and of the Council, introducing it in Annex I to Regulation (EC) No 1334/2008 of the European Parliament and of the Council and repealing Commission Regulation (EC) No 1565/2000 and Commission Decision 1999/217/EC”) - source:
  • the aroma is at least one selected from the list of compounds consisting of eugenol, citronellol, thymol, carvacrol, furaneol, 1-hexanol, homofuraneol, norfuraneol, menthol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, i-octen-3-ol, sotolon, 4-mercapto-4-methy]pentan-2-on, (3-methylthio)-i- propanol, and phenylethanol, preferably from thymol, carvacrol, furaneol, homofuraneol, norfuraneol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3- mercapto-2-pentan
  • the aroma glycoside comprises an aglycone precursor selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures.
  • Table 2 Selection of flavoring and fragrance precursors that can be produced; the following flavorings and fragrances can be glycosylated, e.g. glucosilated, and thus be converted to precursors
  • x means that the compound is preferred.
  • sugar component is not particularly limited. Different sugars can be used for producing the precursors, as disclosed in e.g. table 3, although not being limited thereto.
  • concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions means that the concentration of the aroma glycoside in the product or composition is higher than a concentration in which it can be observed in a natural product, particularly any natural product.
  • concentrations can thereby vary according to the aglyca and sugar component.
  • furaneol can be contained in raspberries in concentrations of about 0.8 mg/kg fruit naturally.
  • the herein described products and compositions comprise - according to certain embodiments - glycosides of natural aroma agents.
  • the concentration of the at least one aroma glycoside in the product or composition is 1 - 10000 ppm, preferably 2 - 10000 ppm, further preferably 10 - 1000 ppm, more preferably 20 - 200 ppm, even further preferably 50 - 150 ppm, particularly preferably about 100 ppm. If more than one aroma glycoside is contained in the product or composition, more than one, e.g. each, can have a concentration in the respective ranges, although it is sufficient if at least one aroma glycoside has a concentration in the above ranges.
  • the aroma glycoside is produced by a biotechnological process.
  • genes of at least one glycosyltransferase are isolated from at least one plant, particularly from a plant in which a glycoside of interest is contained, and then introduced into an organism, particularly GRAS-organisms (generally recognized as safe / genetically regarded as safe), e.g. microorganisms like yeast or distinct E. co/i strains, and one or more aroma glycoside is produced using these organisms by known procedures, e.g. culturing in presence of educts for producing the aroma glycoside.
  • GRAS-organisms generally recognized as safe / genetically regarded as safe
  • microorganisms like yeast or distinct E. co/i strains
  • the product or composition according to the invention can further comprise at least one inactive hydrolase, preferably a glycosidase, particularly a ⁇ - glucosidase.
  • This hydrolase can then be activated in the product or composition, e.g. by water when the hydrolase is present in a dry state, so that the aroma is released.
  • the product or composition according to the invention can further also comprise at least one inactive hydrolase, preferably a glycosidase, particularly a ⁇ -glucosidase, and at least one further inactive enzyme, particularly when the aglycone is an alcohol and/or a thiol, preferably an oxidase when the aglycone is an alcohol.
  • at least one inactive hydrolase preferably a glycosidase, particularly a ⁇ -glucosidase
  • at least one further inactive enzyme particularly when the aglycone is an alcohol and/or a thiol, preferably an oxidase when the aglycone is an alcohol.
  • the further inactive enzyme can be e.g. also a dry enzyme that is activated upon contact with water, thus enabling a delayed functionality of the enzyme.
  • the additional enzyme can be inactive, but also the at least one hydrolase, preferably a glycosidase, particularly a (3- glucosidase, thus enabling a prolonged and/or delayed release of the aroma upon cleavage of the aroma glycoside by the hydrolase, e.g. glycosidase.
  • Particularly useful are ⁇ -glucosidases as the glycosyltransferases according to the invention as they can particularly catalyze the formation of ⁇ -glucosides that can be cleaved by the human microbiome. a-glucosides produced biotechnologically up to now, which further carry several sugar units, can only be released intricately using sequential reactions and with special glucosidases.
  • a further enzyme can enable the formation of a different aroma from the aroma first released, e.g. the formation of an aldehyde from an alcohol, wherein both compounds function as aromas, e.g. flavors and/or fragrances, leading to the possibility of producing mixtures of aromas that can be controlled by the release and reaction of the first aroma.
  • thiols which can be synthesized using the glycosyltransferases of the present invention, as they can be perceived in far lower amounts, and also can be oxidized to achieve new aromas.
  • oxidases are exemplified herein as further enzymes, the invention is not restricted thereto, and other enzymes can be present. In the case of alcohol aglycones an oxidase is preferred as further enzyme, though.
  • the product or composition according to the invention can also contain more than one aroma glycoside in combination/mixtures, wherein the aroma glycosides can release the aroma either by the same or different procedures after activation. It is thus possible that different aromas are released at the same time, leading to a mixture of aromas with a particular note, or that different aromas are released at different times, leading to arrangements of aromas, e.g. fragrances that change over the course of time. It is also not excluded that the same aroma is coupled to different sugars which are activated by different procedures, so that the aroma can be released from different sources over an even further prolonged period of time.
  • the product or composition according to the invention can further comprise at least one selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures, etc.
  • the product or composition first exerts the fragrance or flavor of the odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and/or fragrance mixtures, etc., whereas the same fragrance or flavor or a different one can further be maintained upon release of the aroma from the aroma glycosides, thus enabling the perception of the aroma from the beginning, even without cleavage of the aroma glycoside, and for a long time upon cleavage of the aroma glycoside. Also mixes of different aromas, one coming from the aroma glycoside, can be achieved.
  • the aroma glycoside can have a further function in the product or composition of the invention, replacing other additives.
  • One example is the usual addition of digeranly succinate or hexarose (geranyl palmitate) to softeners so that geraniol and nerol (rose fragrance) are released by the lipase - a hydrolase - present in the detergent for solving fats.
  • the aroma glycosides, respectively flavoring and fragrance glycosides according to the invention can be used in place of digeranly succinate or hexarose, which also are activated by further hydrolases (cellulases) present in detergents. Due to their bipolar structure (sugar and non-sugar component) these additionally have the advantage that they can be used as surfactant in their inactive form. Other surfactants thus would be required in decreased amounts, leading to savings for the detergent producers.
  • the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention coded by a nucleic acid sequence that
  • a) comprises the sequence of SEQ-IDi, SEQ-I D2, or SEQ-ID3;
  • b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to SEQ-ID1, SEQ-ID2, or SEQ-ID3; or
  • c) comprises a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to a part of the sequence of SEQ-I D1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-I D1, SEQ-ID2, or SEQ-ID3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
  • the glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention coded by a nucleic acid sequence comprises an amino acid sequence resulting from SEQ-ID1, SEQ-ID2, or SEQ-ID3, or a par thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths; or comprises an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ- ID1, SEQ-ID2, or SEQ-I D3, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths.
  • the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention having an amino acid sequence that
  • a) comprises the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6; or
  • b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to SEQ-ID4, SEQ-ID5, or SEQ-I D6; or
  • c) comprises a part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6, wherein said part of the sequence of SEQ-ID4, SEQ-I D5, or SEQ-I D6 is at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or
  • d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to a part of the sequence of SEQ-ID4, SEQ-I D5, or SEQ-ID6, wherein said part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6 is at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
  • amino acid sequences SEQ-ID4, SEQ-ID5, or SEQ-ID6 are coded by the nucleic acid sequences SEQ-I D1, SEQ-ID2, or SEQ-ID3, respectively.
  • the glycosyltransferase is a small molecule glycosyltransferase.
  • a small molecule glycosyltransferase is a glycosyltransferase that catalyzes the transfer of a monosaccharide moiety from a sugar donor to a small molecule as acceptor molecule.
  • a small molecule is a molecule that has a molecular weight below 1 500 Dalton, preferably below 1 000 Dalton.
  • the present invention refers to a glycosyltransferase coded by a nucleic acid sequence having the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3 or has the amino acid sequence of SEQ-ID4, SEQ-I D5, or SEQ-ID6.
  • This is meant to designate that the nucleic acid sequence, respectively amino acid sequence, of said glycosyltransferase consists of said certain nucleic acid sequence, , respectively amino acid sequence.
  • Glycosyltransferases having a nucleic acid sequence comprising SEQ-ID1 (i.e. the sequence of FaGTsi-5) or SEQ-I D2 (i.e. the sequence of FaGTsi-13) or SEQ-ID3 (i.e. the sequence of VvdGTi3) or a related nucleic acid sequence can be obtained by standard methods of recombinant DNA technology.
  • the glycosyltransferase is capable of catalyzing formation of a glycoside in which a sugar is linked to an aglycone through a (3-D-glycosyl linkage.
  • the present invention relates to a nucleic acid molecule encoding a glycosyltransferase of the invention, wherein said nucleic acid molecule is a DNA molecule, particularly a cDNA molecule.
  • the present invention also refers to a cRNA molecule based on the DNA molecule of the invention.
  • the present invention refers to a vector comprising a DNA sequence encoding a glycosyltransferase of the present invention. Construction of a vector may be performed using e.g. a restriction enzyme, ligase etc. according to a standard method known in the art.
  • a further aspect of the present invention relates to a host cell containing or transfected with the nucleic acid molecule or the vector according to the invention.
  • the cell of a prokaryotic or eukaryotic organism or the prokaryote or eukaryote itself may be used.
  • Bacteria for example, commonly used hosts such as bacteria belonging to genus Escherichia such as Escherichia coli can be used as the prokaryotic organism, although also other prokaryotes can be used.
  • a cell of a lower eukaryotic organism such as eukaryotic microorganisms including, for example, yeast (e.g. Saccharomyces cerevisiae) or fungi like Aspergillus oryzae and Aspergillus niger can be used.
  • Animal cells or plant cells also can be used as a host. Examples of animal cells that can be used include cell lines of mouse, hamster, monkey, human, etc., as well as insect cells such as silkworm cells and adult silkworm per se.
  • a host cell being transfected refers to a situation where foreign DNA is introduced into the cell.
  • a transfected host cell may be stably transfected, i.e. foreign DNA is introduced and integrated into the genome of the transfected cell.
  • a transfected host cell may be transiently transfected, wherein the foreign DNA fails to integrate into the genome of the transfected cell.
  • the transformation of a host with a nucleic acid molecule or a vector can be performed according to standard methods.
  • the present invention relates to a transgenic plant comprising a nucleic acid molecule or a vector according to the present invention.
  • the term "transgenic plant” refers thereby to a plant that has a heterologous gene, i.e. a gene not from its natural environment, integrated into its genome and that transmits said heterologous gene to its progeny.
  • a heterologous gene includes a gene from one species introduced into another species.
  • a heterologous gene also includes a gene native to an organism that has been altered in some way (e.g., mutated, added in multiple copies, or linked to non-native regulatory sequences).
  • Another aspect of the present invention is directed to a method of forming at least one aroma glycoside, wherein an aglycone is covalently linked to a sugar donor comprising contacting the aglycone with the sugar donor and a glycosyltransferase of the invention under conditions appropriate for the transfer of the sugar group of said sugar donor.
  • these appropriate conditions depend, among others, on the aglycone, the sugar donor and the glycosyltransferase, particularly its enzymatic activity, and thus also e.g. the temperature and pH, and can be suitable set once the compounds are determined.
  • said method is an in vitro method which, preferably, does not involve any steps carried out in vivo.
  • said method is an in vivo method carried out in a host cell or transgenic plant as defined above. According to certain embodiments, only one aroma glycoside is formed in this method.
  • the present invention is directed to a method of producing at least one aroma glycoside, said method comprising the steps of:
  • the culturing or growing depends on the host cell or transgenic plant and can be suitably set by the skilled person, e.g. regarding nutrient addition, culture medium, growth conditions, etc.
  • the collecting also depends on the type of host cell or transgenic plant and can be carried out using usual means like extraction, which also can be suitable set.
  • the aglycone is present in said host cell or transgenic plant during said culturing or growing said host cell or transgenic plant.
  • the sugar donor is present in the culture medium used for culturing said host cell or in the water used for watering that transgenic plant.
  • said culturing or growing said host cell is carried out in a bioreactor.
  • aroma glycoside is produced in a host cell or transgenic plant, which can be suitably carried out by selecting the respective aglycones and sugars. According to certain embodiments, only one aroma glycoside is produced in a host cell or transgenic plant of the invention.
  • the present invention relates to a product produced by the inventive methods.
  • the product herein can comprise also mixtures of aroma glycosides.
  • the product can contain the aroma glycoside in a concentration higher than its concentration in natural products or compositions, particularly higher than its concentration when produced in a host cell or transgenic plant of the same species and/or type which is not according to the invention.
  • the present invention is directed to the use of an aroma glycoside in a concentration higher than its concentration in natural products or compositions, preferably in an artificial product or composition from the group consisting of cosmetic products, e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes; hygienic products, e.g. diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds; food products, e.g..
  • bakery products frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes / bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g. wood preservatives, wallpapers, mold-fightings /mold control, and odor colors; insect repellents, e.g.
  • the aroma glycoside used is the aroma glycoside present in a product or composition according to the invention.
  • the aroma glycosides used in the product or composition according to the present invention are used.
  • the aroma precursors according to the invention e.g. the flavoring and fragrance precursors that can be activated open up many new applications with their special properties, a few of which can be seen in Table 4.
  • the identified enzymes themselves can be marketed as products by, for example, adding them together with the sugar substrates to semi-finished products in order to neutralize volatile, bad tasting or smelling flavors or odors by transferring them to non-volatile precursors using the enzymatic reaction.
  • Electric appliances e.g. 4D television
  • sensors e.g. 4D television
  • Biotechnologically produced aroma glycosides characterized in that they are inactive precursors of flavorings or fragrances, are applied in new concentration ranges beyond those of natural aroma glycoside sources, and can be appropriately activated by:
  • aroma glycosides characterized in that they are effective as taste modulators in uncleaved form, e.g. (and not limiting) as bitter-masking or sweet-enhancing agents, or also as flavorings of the perception umami or kokumi.
  • the released aglycones are understood as e.g. odorous substances/scents, aroma agents, flavorings, perfume oils, odors/smells/fragrances, odorous substance compositions, odor compositions and the like.
  • the aglycones are for example geraniol, nerol, citronellol, thymol, carvacrol, eugenol, phenyl ethanol, vanillin, menthol, hexenol, anisole, butanethiol, decalactone, ethylguaiacol, farnesol, furfuryl alcohol, furfuryl mercaptan, guaiacol, heptyl alcohol, linalool, methenthiol, octalactone, propanethiol, raspberry ketone, terpineol, 10-undecenol, hydroxycitronellol, dihydromyrcenol, borneol or hesperetin, or norfuraneol; particularly preferred are according to (1) a), b), c), but also according to d): furaneol, homofuraneol, caramel furanone, furanone,
  • organic alcohols are glycosylated, e.g. from the list of aroma agents approved in Europe (union list).
  • terpene glycosides e.g. glycosylated terpenoids with one or more hydroxy functions (CH EBI:6l777 list).
  • the aglycones are glycosylated with a proportion, e.g. molar proportion, of one or a multitude thereof with glucose, arabinose, xylose, rhamnose, apiose or galactose,
  • Aroma glycoside according to (1) characterized in that they are produced by a biotechnological process, for example via glycosyltransferases, e.g. with glucosyltransferases a) with the nucleotide sequence SEQ-I D1 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-I D1, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths,
  • nucleotide sequence SEQ-ID3 with the nucleotide sequence SEQ-ID3 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-ID3, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths,
  • d) which are for example a terpene glycosyltransferase, preferably a monoterpene glycosyltransferase,
  • UDP sugars as sugar source, e.g. UDP-glucose, UDP-arabinose, UDP- xylose, UDP-rhamnose, UDP-apiose, UDP-galactose,
  • a transgenic plant comprising a nucleic acid molecule according to (3) 6 or a vector according to (4).
  • hygienic applications and products e.g. body deodorant, diapers, urinary bags, shoe soles, trash cans, swimming and bathing pools/tubs, cat's litter boxes, animal beds, dog hygiene, pheromone pills, tampons, latex gloves, anti-mosquito candies, anti-mosquito skin cream, anti- mosquito agents, toothpaste, shower gel, body lotion, skin cream, hair gels, skin lotion, lipstick, fingernail/nail polish, skin whitening, b) applications and products in the food sector, e.g. chewing gum, tea, pills against bad breath, coffee, spices, frozen goods (pizza, etc.), pastries/baking goods, deodorant candies, drinks, taste enhancers, blocking of negative tastes, bitter taste inhibition, taste modulation,
  • body deodorant e.g. body deodorant, diapers, urinary bags, shoe soles, trash cans, swimming and bathing pools/tubs, cat's litter boxes, animal beds, dog hygiene, p
  • textiles e.g. in detergent additives, softeners,
  • scented candles e.g. scented candles, batteries, cigarettes, scented cards, 4D television, scent dispensers, candles, flowers.
  • insect repellent products e.g. with candles and in scenting of rooms.
  • the released aglycones are understood as e.g. odorous substances/scents, perfume oils, odors/smells, odorous substance compositions, odor compositions and the like.
  • the released aglycones are for example geraniol, nerol, citronellol, thymol, carvacrol, eugenol, phenyl ethanol, vanillin, menthol, hexenol, anisole, butanethiol, decalactone, ethylguaiacol, farnesol, furfuryl alcohol, furfuryl mercaptan, guaiacol, heptyl alcohol, linalool, methenthiol, octalactone, propanethiol, raspberry ketone, terpineol, 10-undecenol, hydroxycitronellol, dihydromyrcenol, borneol, hesperetin, norfuraneol and ethyl maltol; particularly preferred are according to (3)a), b), c), d): furaneol, homofuraneol, caramel furan
  • the contained aglycones are organic alcohols that have been glycosylated, e.g. from the list of aroma agents approved in Europe (union list).
  • the fragrance precursors are terpene glycosides, e.g. glycosylated terpenoids with one or more hydroxy functions (CHEBI:61777 list).
  • the contained aglycones are glycosylated with a proportion, e.g. molar proportion, of one or a multitude thereof with glucose, arabinose, xylose, rhamnose, apiose or galactose.
  • the flower petals additionally have a color that can be activated by water.
  • the artificial stigma is formed as a depot in spherical (full sphere or coated hollow sphere) form to take up bigger amounts of fragrance that can be activated and of enzyme. Thereby, whole rooms can be scented.
  • Product or composition of (1') which is a stripe, preferably self-adhering, preferably equipped with a depot, e.g. a fleece/non-woven, e.g. with a length of 1 cm to 100 cm without a restriction regarding width and height, for versatile scenting in wet rooms or usage with promotional items/articles.
  • a depot e.g. a fleece/non-woven, e.g. with a length of 1 cm to 100 cm without a restriction regarding width and height, for versatile scenting in wet rooms or usage with promotional items/articles.
  • the fragrant effect can be prolonged.
  • the fragrant effect of a deodorant can be prolonged (see Fig. 1, 4GENE fragrance mixture).
  • the activation of the fragrance precursors occurs over a prolonged period of time through the enzymes of the present skin bacteria (see Figure 4, dashed line). Below this threshold value no odor is perceptible anymore.
  • the usual odor mixture top note, solid line
  • the fragrance precursor mixture (4GENE fragrance mixture) is perceptible over 15 hours.
  • the fragrances that can be activated are put into a cellulose layer of a diaper in a dry state, through humidity and/or the bacterial enzymes contained in the excrements a release of the fragrance component is enabled, which serves as signal for the diaper change and at the same time covers bad smells.
  • Glycosides that can be activated for use in shoe soles
  • Shoe soles are treated with a spray which contains the fragrances that can be activated.
  • the bacteria in the foot sweat activate the glycosides and prevent the unpleasant smell of the shoes during prolonged use in this way.
  • the fragrances that can be activated can be added to the detergent or the softener so that they wet the textiles after washing. During wearing of the textiles the fragrance is only activated by sweat bacteria and thus protects the wearer of the textiles from bad smells.
  • Inactive aroma precursors are used in foods in order to release the aroma after activation. All foods are usable therefore which can be activated by temperature (> 70°C), microorganisms, addition of water and enzyme or influence of saliva. Examples thereof are foods which are heated during preparation like bread, cake and pizza, foods for which microorganisms are used for preparation, dry foods that come into contact with fluids like muesli and pulverized cold dishes, or foods that stay for a time in the mouth like chewing gum or drops/candies.
  • the aromas that can be activated can be introduced into: semi-finished products, cake premixes, food supplements, sugar for burnt punch, waffles, crepes, hot fruit sauces, hot drinks, noodles.
  • the release of the aromas from the precursors can be realized by: the cooking process, saliva, enzymes of microorganisms, baking, microwave, open fire, together with glycosidases only together with water.
  • a negative control (flour, salt and water), three samples (added geranyl glucoside), a recovery (addition of geraniol to the bread prior to freezing according to a postulated conversion of glucoside of about 6% in order to determine the losses during the analytical process) and a control for geraniol in the glucoside solution (addition of an aliquot amount of glucoside only after the baking process to determine the content of geraniol).
  • Several process steps are carried out according to standardized instructions, for each of the six blanks separately. Preparing the dough/paste:
  • the baked bread was left standing for 60 min at room temperature and subsequently frozen in liquid nitrogen. Storage of the breads took place at -18°C until the conditioning/preparation.
  • the analytical examination of the breads via GC resulted in the following measurement values of Table 6.
  • a Thermo Finnigan Trace DSQ mass spectrometer coupled to a Thermo Finnigan Trace GC was used.
  • the instrument was equipped with a BPX5 20 M fused silica capillary column (30 m x 0.25 mm i.d., 0.25 pm film thickness).
  • Helium gas flow rate was 1.1 ml/min.
  • the injection port was operated in splitless mode.
  • the injector temperature was 250°C, the ion source and interface temperatures were kept at 230 and 280 °C, respectively.
  • the GC parameters were as follows: initial temperature 40 °C for 3 min, increased to 100 °C at a rate of 10 °C/min and from 100 °C to 190 °C at a rate of 30 °C/min.
  • the EI-MS ionization voltage was 70 eV.
  • Mass data was acquired in the range of 30-300 m/z. Compounds were identified by comparing their mass spectra and retention indices to the N IST mass spectra library and reference compounds.
  • the blind sample 1 as well as control 3 showed no geraniol sign/peak.
  • the negative proof of control 3 post-addition of GG stock solution after the baking process into the cooled bread
  • the contents of geraniol in the bread samples therefore were determined directly from the peak areas of the extract measurements of the samples, with the results shown in Tables 7 and 8.
  • Table 8 Average conversion of GG in the samples of baking test 1
  • Table 12 Average conversion of GG in the samples of baking test 2
  • Table 14 Measurement results of the GC-MS analysis of baking test 3
  • a recovery factor of 0.68 was obtained from the quantification of the recovery sample.
  • the samples showed sufficiently constant measurement values between 5.5% (2a) and 6.1% (2b) of GG in this experiment.
  • the dough was taken out quickly and weighed a first time (El).
  • a first fermenting period of 20 min at 3"i°C took place in a water vapor saturated proofing cabinet. After taking the dough out of the cabinet a homogenization took place.
  • the ball-shaped blank was put into a round molder and turned for 10 turns. It was rolled flat to a height of 1 cm, folded two times without inclusion of air and again turned in the round molder for 20 turns. Finally a forming by hand to form a roll was performed. This roll was put into a small loaf pan made of aluminum and weighed again (E2). After the homogenization a second fermentation period of 40 min followed.
  • the baked bread was left standing for 60 min at room temperature and subsequently prepared for the sensory test.
  • For testing the crust it was taken off with a knife, simultaneously shredded and ig each weighed into an airtight sensory vessel made of glass with ground joint and cover/lid.
  • For preparing the crumb the bread that was totally freed from the crust was at first cut into 1.5 cm thick slices using a bread slicer and separated with an electronic knife into cuboids with a size of about 1.5 x 5.0 x 2.0 cm 3 and a weight of 4.0 g. A cuboid each was put into an airtight sensory vessel made of glass with ground joint and cover/lid. Directly thereafter the sensory test took place.
  • the extent of the a-risk/ a-error was determined based on the relation of correct and wrong answers: the probability of the conclusion that a perceivable difference is present although this is not the case (also termed error of the first order/type, significance lever or probability of an erroneous rejection).
  • the a-risk was determined using suitable significance tables.
  • glycosylated aroma agents also have taste-modulating properties.
  • the glycosylation can reduce or prevent a bitter taste or function as taste enhancer.
  • the enhanced stability of the glycosides is also advantageous in the application as taste modulators.
  • Example 5 The experiments of Example 5 were repeated using furaneol instead of geraniol with amounts of the aroma at a factor 2 to 5 increased. The results of Example 5 could be confirmed with these experiments.
  • a skin cream with e.g. citronellol glucoside can be e.g. used as repellent for mosquitoes
  • citronellol (subfamilies Anophelinae and Culicinae).
  • the free citronellol is released by enzymes of skin bacteria from the citronellol glucoside over a prolonged period of time and enables a long- lasting mosquito protection.
  • a similar effect can be achieved by taking up the citronellol glucoside in a candy orally and releasing the citronellol during digestion, which then is released in the whole body.
  • This application is e.g. to be applied preferably during stays in the tropics to effectively repel mosquitoes that transfer sicknesses.
  • Construction materials e.g. modern stones for building walls or insulation mats, etc.
  • the fragrances that can be activated can be stored in an inactive state for a very long time in contrast to the free fragrances. This predestines them for the application in odor TV (4D TV), wherein they can then be selectively released by electric heating.
  • the fragrances that can be activated can be used for an electronic sensor system. After activation by a trigger such as enzymes, temperature, or pH the volatile flavors / odors or the released sugars of the glycosides act as a signal for an electronic sensor system and can be measured with an electronic sensor.
  • a trigger such as enzymes, temperature, or pH the volatile flavors / odors or the released sugars of the glycosides act as a signal for an electronic sensor system and can be measured with an electronic sensor.
  • inactivated fragrance precursors in an artificial flower This consists of decorative artificial flower petals which surround a surface, e.g. a circle, or ball consisting of an absorbent material functioning as depot (see Fig. 10).
  • This depot contains a dry mixture of a fragrance precursor, a glycoside, and a glycosidase, e.g. a glucosidase, in sufficient quantity.
  • This artificial flower head is on top of a stem/stalk of water-conducting material, which, in turn can contain decorative leaves. This entity together forms an artificial flower.
  • the loaded carrier materials were then wetted with 1 ml_ water. With a usage of 5 mg geranyl glucoside a distinctly perceptible odor could be smelled. With 2 mg, a weak odor could be achieved, and without either glucosidase or geranyl glucoside or water no odor could be noticed, as expected.
  • a follow-up experiment was to rewet already used carrier materials after drying again. Also here again a volatile odor was perceived. The developed aromatic flowers thus can be used repeatedly and are not disposable articles.
  • the flower petals have colors that can be activated and that only become colored by water.
  • the depot should be ball-shaped (full sphere or coated semi-sphere) so that bigger amounts of the fragrance that can be activated and the enzyme can be included. This way whole room can be scented.
  • Using smart paper a spatial change can be accomplished through feeding water and e.g. the opening of a closed flower can be mimicked.
  • Glycoside mixtures should be used so that the resulting fragrance can be smelled by as many people as possible.
  • the principle of artificial flowers can be transferred to other articles, e.g. scented balls which only release the fragrance after introduction into water, coated colored waterfalls for "fountain fragrance fireworks" ("Brunnenduftfeuerwerke"), self-adhering stripes that are furnished with an absorbent layer and can be adhered everywhere as fragrance dispensers after wetting, e.g. on promotional items.
  • glycosylated natural substances are important components of foods, pharmaceutical and cosmetic products due to their manifold physiological activities.
  • glycosylated diterpenes, steroids and flavonoids are used as sweeteners (steviosides, glycyrrhizin, neohesperidin) in the food industry, while steroid and antibiotic glycosides are used as medicines and glycoside extracts as cosmetic agents.
  • Chemical-synthetic glycosylation reactions of the take place in the presence of heavy-metal containing catalysts, so that therefore recently biocatalysts are sought which can catalyze this reaction alternatively.
  • Products obtained via biocatalysts correspond to the natural substances, are free of heavy metal residues and can therefore be declared as "natural” according to present law, which is a direct advantage for the consumer and for industry an indirect advantage in marketing.
  • regio- and enantioselective sugar transfers are catalyzed by nucleoside diphosphate carbohydrate (e.g. UDP glucose) depending glycosyltransferases (UGTs).
  • UDP glucose nucleoside diphosphate carbohydrate
  • UGTs glycosyltransferases
  • Glycosyltransferases that convert low molecular substrates transfer sugar on a plurality of acceptors like hormones and secondary metabolites as well as biotic and abiotic chemicals and toxins.
  • the enzymes are coded in the different organisms by a big multigene family and can be identified by a common motif in their primary sequence (PSPG Box, Plant Secondary Product Glycosyltransferase).
  • PSPG Box Plant Secondary Product Glycosyltransferase
  • the transfer of a carbohydrate residue to a mostly lipophilic acceptor changes its chemical properties and its bioactivity and can facilitate the access to cellular membrane transporter systems.
  • UGT protein can glycosylate several substrates of different origin, but also that several UGTs can glycosylate the same substrate, which makes the identification of substrate specificity difficult to predict and thus impedes it.
  • Fig. 11 the determination of the enzyme activity of FaGTsi-5 and FaGTsi-13 is shown.
  • Fig. 11A shows the relative activities of FaGTsi-5 and FaGTsi-13 f° r homofuraneol
  • Fig. 11 B shows the relative activities of FaGTsi-13 with different substrates, i.e. furnaeol and homofuraneol, wherein the highest values were normalized to 1.
  • the biocatalysts FaGTsi-5 and FaGTsi-13 produced the glucosides of homofuraneol (Fig. 11 B) and norfuraneol apart from the glucosides of furaneol, both of which are not present in the examined plant species.
  • homofuraneol is converted 3 times more effectively than furaneol (Fig. 11B).
  • the reaction was started by adding UDP-glucose and stopped after incubation with 1 ml n- butanol. After vortexing for at least 15 s the reaction mixture was centrifuged 2 min at 12 000 xg for separation of the phases, and 800 ⁇ of the upper organic phase containing the product were now transferred to 2 ml scintillation cocktail (Ultima-Flo AF, PerkinElmer). Non-converted UDP glucose remains in the aqueous phase and thus does not contribute to the radioactivity intensity in the sample (organic phase).
  • glycosyltransferase method described herein is highly innovative. It is based on a natural principle, uses modern methods of biotechnology and is already very efficient on a laboratory scale. It is possible to produce the required amounts of flavoring and fragrance glycosides with it. It is unparalleled and in an unique position.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Genetics & Genomics (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • General Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Food Science & Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Emergency Medicine (AREA)
  • Polymers & Plastics (AREA)
  • Nutrition Science (AREA)
  • Fats And Perfumes (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

The present invention discloses biotechnologically produced inactive aroma- and fragrance/scent precursors in new concentration ranges beyond those of natural aroma glycoside sources, which can be activated by external triggers like enzymes, temperature and p H, and then release the aroma and the fragrance.

Description

Glycosylated aroma- and fragrance precursors and fragrance products that can be activated
The present invention discloses the full application of biotechnologically produced inactive aroma- and fragrance/scent precursors in new concentration ranges beyond those of natural aroma glycoside sources, which can be activated by external triggers like enzymes, temperature and pH, and then release the aroma and the fragrance. In addition, the present invention discloses the use of biotechnologically produced inactive fragrance precursors in every-day commodities which can be activated by external triggers like enzymes, temperature and pH. Products which - in addition to the inactive fragrance precursor - already include the necessary enzyme in e.g. a dry state for activation only need wetting/moistening by water to release the desired fragrance.
Flavorings and fragrances are used in the field of foods, hygiene and body care / personal hygiene in manifold ways. The flavorings and fragrances applied are often coming from natural sources, particularly plants. Many of these flavorings and fragrances are nowadays also produced by chemical synthesis or naturally (according to flavorings regulation (EG). No. 1334/2008 Art. 3(2)(c)) via biotechnology and are already accepted on the market in this form.
The quality of a flavoring or a fragrance is determined by its perceived taste and/or odor. This depends, among others, on the concentration of the added/inserted flavoring or fragrance. The taste or odor should be sensed as pleasant by the consumer and have a taste or smell in line with its application. Generally, however, only a limited number of flavorings and fragrances is used. This is evident, for example, by recurring ingredients in deodorants, like geraniol (smell of roses), which is included in about 48% of such products. Variants of the products often are simply designed using finely tuned, special mixtures of well-known components.
In order to maintain fragrances for the consumer over a prolonged period of time, e.g. an 8 hours working day, generally high concentrations are applied, what leads to - apart of the odor aspect for the consumer, i.e. strong smell at the beginning, too weak smell at the end - higher costs for the producer due to a quantitatively higher usage of the fragrance.
A surprisingly simple, natural solution for releasing bound flavorings is found in fruits and other organs of several plants. Many secondary metabolites of plant origin, i.e. substances which are only present in specific plant groups, are stored in the plant in the form of glycosides, i.e. bound to a sugar (Fig. 1). In this way the substances are stabilized and commonly biologically inactive, are not volatile and water soluble. Flavorings and fragrances bound to a sugar are not any more active as flavorings or fragrances in this form - as glycosides. The release of such bound aromas takes place in nature only by dissolving cellular structures by released enzymes, e.g. glycosidases from the vacuole, or through microbial enzymes which release the actual active agent from its carrier molecule glucose (Fig. 2). Apart from the enzymatic cleavage the release of the aroma agent can also take place by heating or changing the pH value. Basic examples are the aroma glycosides of grape vines. The terpenes released from glycosides are natural attractants promoting the consumption of the fruit and therefore the spreading of the seeds. They are also important components of the wine aroma after their release by fermentation.
A few hundred aroma glycosides are present in plants. They are produced in the cell by so-called glycosyltransferases which transfer to the respective aroma molecule a sugar residue, often glucose, i.e. glycosylate it. This stabilizes the compound in water-soluble and non-volatile form. The glycosyltransferases often convert various flavorings and fragrances, but often prefer one substance class. The multitude of flavorings and fragrances occurring is accompanied by a likewise multitude of glycosyltransferases whose genes can be isolated from exactly these plants in which such a glycoside of interest is contained. These genes can be introduced into GRAS- organisms (generally recognized as safe / genetically regarded as safe) like yeast or distinct E. co/i strains and thus enable these to glycosylate almost arbitrary substances.
The specific glycosyltransferase genes have to be isolated and cloned for a specific biotechnological application. But it is usually quite difficult to identify exactly the glycosyltransferase of interest in a specific plant with an interesting glycoside as the desired glycosyltransferase is only one of hundreds present in every plant.
In EP 14 174 714.7 of 27.06.2014 this problem is solved by developing a test procedure that enables a fast identification of a desired glycosyltransferase gene from a plant with a glycoside relevant for aromas (Fig. 3). A so-called "aglycone-library" of a plant having an aroma/flavoring and/or fragrance glycoside of interest for aroma houses is created thereby by first isolating all glycosides thereof as an overall mixture and then cleaving their sugar residues. Candidate genes for respective glycosyltransferases, e.g. from genome data or sequencing, are used to produce the respective enzyme in bacteria or yeast and thereby treat the whole library and test it. Only the natural target molecule of this gene / enzyme, e.g. the flavoring of fragrance, is glycosylated again und can thereby be easily isolated and identified from the bulk of remaining aglycons. In this way the gene / enzyme is identified and can be transferred to production strains and thereby used of production of aromas that can be activated (see, for example, the sequences of EP 14 174 722.0 and example 8, biotechnological production of furanon-glycosides using glycosyltransferases). Up to now aroma / flavoring and fragrance glycosides can only be produced by reverse enzymatic hydrolysis with glycosidases. This biocatalysis, which mostly produces a-glucoside, is inefficient, however, and the products are therefore expensive. A chemical synthesis would also be possible. This is, however, very complex - comprising protective group chemistry, anhydrous conditions, heavy metal catalysts und double cleaning - and thus also expensive. Both these production methods have until now not lead to the commercial availability of higher amounts (kg-quantity) of aroma glycosides / flavoring and fragrance glycosides.
Several methods exist to release the aroma, respectively the odor, from chemically inactived, bound or encapsulated flavorings and fragrances just by a mechanism, see Table 1, which also shows already a comparison of these methods compared to the present method. In general the purpose is either to modify volatile flavorings and fragrances in such a way that their physical- chemical properties are changed, to bind them to various matrices or to encapsulate them, and they thus not evaporate anymore. Afterwards it has to be possible or release them by simple means. Alcohols (e.g. citronellol), aldehydes and ketones (e.g. vanillin), esters and lactones (e.g. cumarin) can be used for this purpose. Methods for the release then are temperature, oxidation, light, enzymes, microorganism and hydrolases as well as changes of the pH-value (Herrmann, 2007, Angew. Chem. Int. Ed. Engl. 46, 5836-5863).
Table 1: Strength of the technologies for important characteristics
Figure imgf000004_0001
+++ = very good, ++ = good, + = satisfactory A known example is the addition of digeranyl succinate or hexarose (geranyl palmitate) to softeners so that geraniol and nerol (rose fragrance) are released by the lipase - a hydrolase - present in the detergent for solving fats.
Volatile compounds are also encapsulated into wrappings of different materials and different dimensions ("micro-, macro- and nanoencapsulation"), are thus not volatile anymore and can be released by different methods: solvation in water, temperature, mechanical forces, enzymes, chemical reactions and pH change. Here the methods of release are not related to the flavoring or fragrance, though, but to the capsule material. Generally the applicability of these methods is limited to products with high prices as the encapsulation, respectively binding to carriers, is complex and thus expensive. Furthermore, the flavorings and fragrances can diffuse through the capsule material at longer storage times and thus be lost. This technique is less suitable for additives to foods, as the capsule material would reach the food as well (Feng et al., 2009, Recent Pat Food Nutr. Agric. 1, 193-202).
In addition, methods are known in which flavorings and fragrances are bound to carrier materials, e.g. cyclodextrins, starch, and/or proteins. Here, methods like extrusion, spray-drying, agglomeration, e.g. wet agglomeration in mixers or fluidized bed agglomeration, or in recent days especially fluidized bed - spray granulation, are applied. An important feature herein is that the flavorings and fragrances are subject to a depot effect, i.e. they can be defined, but not be controlled during the further process of release as the desorption and diffusion rate is fixed. Like in encapsulation also here an additional material is needed as carrier, so that also here contaminants/impurities are needed (Feng et al., 2009, Recent Pat Food Nutr. Agric. 1, 193-202).
Summary of the invention
This application shows the feasibility of the use of flavoring and fragrance precursors in bigger measures. The provision of a broad variety of such substances is not known until now, and this is enabled with the new glycosyltransferase method. The present inventors found that the glycosyltransferases of the present invention enable for the first time the production of aroma glycosides in amounts that are feasible for biotechnological production thereof, thus enabling the use of aroma glycosides as additives in products or compositions in amounts that could not be achieved until now. Although the present glycosyltransferases only differ from natural glycosyltransferases in their coding nucleic acid sequence in a few nucleic acids, making up a change in only a few amino acids, they achieve a remarkably improved production of aroma glycosides and, apart from that, also are able to form aroma glycosides that could not be produced until now.
According to a first aspect, the present invention relates to a product or composition comprising at least one aroma glycoside comprising an aglycone component and at least one sugar component, wherein the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions.
According to a second aspect, the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in the present product or composition coded by a nucleic acid sequence that
a) comprises the sequence of SEQ-IDi, SEQ-I D2, or SEQ-ID3; or
b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to SEQ-ID1, SEQ-ID2, or SEQ-ID3; or
c) comprises a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or
d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
A third aspect of the invention relates to a nucleic acid molecule encoding a glycosyltransferase according to the invention, wherein said nucleic acid molecule is a DNA molecule, particularly a cDNA molecule.
According to a fourth aspect, a vector comprising a DNA sequence encoding a glycosyltransferase according to the invention is disclosed.
In addition, a host cell containing or transfected with the nucleic acid molecule according to the invention or the vector according to the invention is disclosed as a fifth aspect of the present invention.
A sixth aspect of the present invention relates to a transgenic plant comprising the nucleic acid molecule of the invention or a vector of the invention.
A seventh aspect of the present invention is a method of forming at least one aroma glycoside, wherein an aglycone is covalently linked to a sugar donor comprising contacting the aglycone with the sugar donor and the glycosyltransferase of the invention under conditions appropriate for the transfer of the sugar group of said sugar donor. According to an eight aspect, a method of producing at least one aroma glycoside is disclosed, said method comprising the steps of:
culturing or growing the host cell of the invention or the transgenic plant of the invention; and
collecting from said host cell or transgenic plant said aroma glycoside.
A ninth aspect of the invention relates to a product produced by the inventive methods.
Also the use of an aroma glycoside in a concentration higher than its concentration in natural products or compositions is disclosed in a tenth aspect of the present invention.
Further embodiments are disclosed in the dependent claims and can be taken from the following description and examples, without being limited thereto.
The invention will be further described in detail in the following with reference to the figures and particular embodiments thereof, without being limited thereto.
In the figures the following is shown:
Fig. 1 shows an abstract schematic of the composition of the glycosides used in the present invention.
Fig. 2 depicts schematically the release of the flavoring or fragrance from the aroma glycosides. Fig. 3 shows the use of an aglyca library to produce aroma glycosides
Fig. 4 discloses the data of a fragrance precursor mixture („4GENE Duftstoffgemisch", 4GENE fragrance mixture) in body deodorant used in example 1.
Fig. 5 shows pictures A 1: Photos of the breads from baking test 1 in Example 5 after the baking process: 1.1 blind (negative) sample; 1.2 a-c: sample blanks; 1.3 control; 1.4 recovery
Fig. 6 shows pictures A 2: Photos of the breads from baking test 2 in Example 5 after the baking process: 2.1 blind (negative) sample; 2.2 a-c: sample blanks; 2.3 recovery
Fig. 7 shows pictures A3: Photos of the breads from baking test 3 in Example 5 after the baking process: 3.1 blind (negative) sample; 3.2 a-c: sample blanks; 3.3 recovery
In Fig. 8 picture A4 is depicted, showing a 50 g-blank bread for sensory testing in Example 5
Fig. 9 shows Picture A5 of the Triangle test in Example 5 - sensory vessels with bread samples
(pictures processed)
In Fig. 10 artificial aromatic flowers that can be activated of Example 11 are shown.
In Fig. 11 the determination of the enzyme activity of FaGTsi-5 and FaGTsi-13 in Example 11 is shown. Detailed description of the present invention
All ranges disclosed herein are to be considered to be supplemented by the term "about", unless clearly defined to the contrary or otherwise clear from the context.
According to a first aspect, the present invention relates to a product or composition comprising at least one aroma glycoside comprising an aglycone component and at least one sugar component, wherein the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions.
A "glycoside", as used herein, is a molecule in which a sugar (the "glycone" part or "glycone component" of the glycoside) is bonded to a non-sugar (the "aglycone" part or "aglycone component") via a glycosidic bond. Accordingly, a glycoside may consist of a sugar as glycone component linked through its anomeric carbon atom to e.g. the hydroxy group of an alcohol (chemical structure R-OH) as aglycone component. For example, in the glycoside linaloyl (3-D- glucoside, the glycone component glucose is linked to the aglycone component linalool.
A glycoside can be produced by carrying out a reaction in which an aglycone component is mixed under appropriate conditions with a sugar donor in the presence of a glycosyltransferase as enzymatic catalyzer.
Alternatively, a glycoside can be produced by culturing or growing a host cell or transgenic plant expressing a glycosyltransferase according to the invention when adding the respective aglycone and sugar. During culture/growth, such a host cell or transgenic plant will generate glycosides. The glycoside(s) generated in such a host cell or transgenic plant can subsequently be collected from said host cell or transgenic plant by standard methods of extraction and/or chromatography (such as solvent extraction, solid phase extraction and reversed phase chromatography).
The aroma - and thus the aglycone - are not particularly restricted and can be any that is available, either from natural sources or produced synthetically. According to certain aspects, the aroma glycoside is produced from a natural source, e.g. in a plant or in microorganisms. The aroma glycoside can then be introduced into the product or composition, thus producing a man- made product or composition, which is not particularly restricted. Several possible products and compositions will be described in the following, including, but not limited to, cosmetic products, e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes; hygienic products, e.g. diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds; food products, e.g.. bakery products, frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes / bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g. wood preservatives, wallpapers, mold-fightings /mold control, and odor colors; insect repellents, e.g. skin creams (topical), candies (orally), and candles; and products for electronic devices, e.g. odor TVs / 4D TVs, and smartphone gadgets. Also concentrates of the aroma glycosides can be produced that can be then used for producing any of the products or compositions.
A variety of the aroma glycosides, being aroma and odor precursors, that can be activated and produced biotechnologically by the glycosyltransferases according to the invention are described below. A basis thereof are aromas like flavorings and fragrances of natural origin that can then be glycosylated, with a small selection of the most important flavorings and fragrances presented in table 2, although not limited thereto; generally, all alcohols of the list of the European union can also be envisioned ("COMMISSION IMPLEMENTI NG REGULATION (EU) No 872/2012 of 1 October 2012 adopting the list of flavoring substances provided for by Regulation (EC) No 2232/96 of the European Parliament and of the Council, introducing it in Annex I to Regulation (EC) No 1334/2008 of the European Parliament and of the Council and repealing Commission Regulation (EC) No 1565/2000 and Commission Decision 1999/217/EC") - source:
http://eur-lex.europa.eu/legal-content/EN/TXT/?uri=CELEX:320i2Ro872; further, also glycosylated terpenes as disclosed in http://www.ebi.ac. uk/chebi/searchld.do?chebild=6i777 can be produced. Also derivatives, isomers of the respective substances are included in the list of possibilities. According to certain embodiments, the aroma is at least one selected from the list of compounds consisting of eugenol, citronellol, thymol, carvacrol, furaneol, 1-hexanol, homofuraneol, norfuraneol, menthol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, i-octen-3-ol, sotolon, 4-mercapto-4-methy]pentan-2-on, (3-methylthio)-i- propanol, and phenylethanol, preferably from thymol, carvacrol, furaneol, homofuraneol, norfuraneol, raspberry ketone, maltol, ethylmaltol, 2-furfurylthiol, 2-methyl-3-furanthiol, 3- mercapto-2-pentanon, sotolon, 4-mercapto-4-methylpentan-2-on, and (3-methylthio)-i-propanol, more preferably from carvacrol, norfuraneol, raspberry ketone, 2-furfurylthiol, 2-methyl-3- furanthiol, 3-mercapto-2-pentanon, sotolon, 4-mercapto-4-methylpentan-2-on, and (3-methylthio)- 1-propanol. Particularly preferably are glucosides thereof. According to certain embodiments, the aroma glycoside comprises an aglycone precursor selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures.
Table 2: Selection of flavoring and fragrance precursors that can be produced; the following flavorings and fragrances can be glycosylated, e.g. glucosilated, and thus be converted to precursors
Figure imgf000010_0001
In Table 2, "x" means that the compound is preferred. Also the sugar component is not particularly limited. Different sugars can be used for producing the precursors, as disclosed in e.g. table 3, although not being limited thereto.
Table 3: Selection of sugars: instead of using glucose (glucosides) also other sugars can be used, the resulting precursors will then generally be called glycosides or be named according to the respective sugar; list of sugars (selection):
Glucose,
Arabinose,
Xylose,
Rhamnose,
Apiose,
Galactose
The term that the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions means that the concentration of the aroma glycoside in the product or composition is higher than a concentration in which it can be observed in a natural product, particularly any natural product.
The concentrations can thereby vary according to the aglyca and sugar component. For example, furaneol can be contained in raspberries in concentrations of about 0.8 mg/kg fruit naturally. The herein described products and compositions comprise - according to certain embodiments - glycosides of natural aroma agents.
According to certain embodiments, the concentration of the at least one aroma glycoside in the product or composition is 1 - 10000 ppm, preferably 2 - 10000 ppm, further preferably 10 - 1000 ppm, more preferably 20 - 200 ppm, even further preferably 50 - 150 ppm, particularly preferably about 100 ppm. If more than one aroma glycoside is contained in the product or composition, more than one, e.g. each, can have a concentration in the respective ranges, although it is sufficient if at least one aroma glycoside has a concentration in the above ranges.
According to certain embodiments, the aroma glycoside is produced by a biotechnological process. According to certain embodiments, genes of at least one glycosyltransferase are isolated from at least one plant, particularly from a plant in which a glycoside of interest is contained, and then introduced into an organism, particularly GRAS-organisms (generally recognized as safe / genetically regarded as safe), e.g. microorganisms like yeast or distinct E. co/i strains, and one or more aroma glycoside is produced using these organisms by known procedures, e.g. culturing in presence of educts for producing the aroma glycoside.
According to certain embodiments, the product or composition according to the invention can further comprise at least one inactive hydrolase, preferably a glycosidase, particularly a β- glucosidase. This hydrolase can then be activated in the product or composition, e.g. by water when the hydrolase is present in a dry state, so that the aroma is released.
The product or composition according to the invention can further also comprise at least one inactive hydrolase, preferably a glycosidase, particularly a β-glucosidase, and at least one further inactive enzyme, particularly when the aglycone is an alcohol and/or a thiol, preferably an oxidase when the aglycone is an alcohol.
The further inactive enzyme can be e.g. also a dry enzyme that is activated upon contact with water, thus enabling a delayed functionality of the enzyme. Not only the additional enzyme can be inactive, but also the at least one hydrolase, preferably a glycosidase, particularly a (3- glucosidase, thus enabling a prolonged and/or delayed release of the aroma upon cleavage of the aroma glycoside by the hydrolase, e.g. glycosidase. Particularly useful are β-glucosidases as the glycosyltransferases according to the invention as they can particularly catalyze the formation of β-glucosides that can be cleaved by the human microbiome. a-glucosides produced biotechnologically up to now, which further carry several sugar units, can only be released intricately using sequential reactions and with special glucosidases.
The presence of a further enzyme can enable the formation of a different aroma from the aroma first released, e.g. the formation of an aldehyde from an alcohol, wherein both compounds function as aromas, e.g. flavors and/or fragrances, leading to the possibility of producing mixtures of aromas that can be controlled by the release and reaction of the first aroma. Particularly preferably is also the use of thiols, which can be synthesized using the glycosyltransferases of the present invention, as they can be perceived in far lower amounts, and also can be oxidized to achieve new aromas. Although oxidases are exemplified herein as further enzymes, the invention is not restricted thereto, and other enzymes can be present. In the case of alcohol aglycones an oxidase is preferred as further enzyme, though.
According to certain embodiments, the product or composition according to the invention can also contain more than one aroma glycoside in combination/mixtures, wherein the aroma glycosides can release the aroma either by the same or different procedures after activation. It is thus possible that different aromas are released at the same time, leading to a mixture of aromas with a particular note, or that different aromas are released at different times, leading to arrangements of aromas, e.g. fragrances that change over the course of time. It is also not excluded that the same aroma is coupled to different sugars which are activated by different procedures, so that the aroma can be released from different sources over an even further prolonged period of time.
According to certain embodiments, the product or composition according to the invention can further comprise at least one selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures, etc. This way it is possible that the product or composition first exerts the fragrance or flavor of the odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and/or fragrance mixtures, etc., whereas the same fragrance or flavor or a different one can further be maintained upon release of the aroma from the aroma glycosides, thus enabling the perception of the aroma from the beginning, even without cleavage of the aroma glycoside, and for a long time upon cleavage of the aroma glycoside. Also mixes of different aromas, one coming from the aroma glycoside, can be achieved.
It is not excluded that the aroma glycoside can have a further function in the product or composition of the invention, replacing other additives. One example is the usual addition of digeranly succinate or hexarose (geranyl palmitate) to softeners so that geraniol and nerol (rose fragrance) are released by the lipase - a hydrolase - present in the detergent for solving fats. Here, also the aroma glycosides, respectively flavoring and fragrance glycosides according to the invention can be used in place of digeranly succinate or hexarose, which also are activated by further hydrolases (cellulases) present in detergents. Due to their bipolar structure (sugar and non-sugar component) these additionally have the advantage that they can be used as surfactant in their inactive form. Other surfactants thus would be required in decreased amounts, leading to savings for the detergent producers.
According to a second aspect, the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention coded by a nucleic acid sequence that
a) comprises the sequence of SEQ-IDi, SEQ-I D2, or SEQ-ID3; or
b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to SEQ-ID1, SEQ-ID2, or SEQ-ID3; or
c) comprises a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to a part of the sequence of SEQ-I D1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-I D1, SEQ-ID2, or SEQ-ID3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
According to certain embodiments, the glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention coded by a nucleic acid sequence comprises an amino acid sequence resulting from SEQ-ID1, SEQ-ID2, or SEQ-ID3, or a par thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths; or comprises an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ- ID1, SEQ-ID2, or SEQ-I D3, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths.
According to certain embodiments, the present invention relates to a glycosyltransferase for producing an aroma glycoside as used in a product or composition of the present invention having an amino acid sequence that
a) comprises the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6; or
b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to SEQ-ID4, SEQ-ID5, or SEQ-I D6; or
c) comprises a part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6, wherein said part of the sequence of SEQ-ID4, SEQ-I D5, or SEQ-I D6 is at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or
d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, further preferably at least 99%, identical to a part of the sequence of SEQ-ID4, SEQ-I D5, or SEQ-ID6, wherein said part of the sequence of SEQ-ID4, SEQ-ID5, or SEQ-ID6 is at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
Herein, the amino acid sequences SEQ-ID4, SEQ-ID5, or SEQ-ID6 are coded by the nucleic acid sequences SEQ-I D1, SEQ-ID2, or SEQ-ID3, respectively.
In some embodiments, the glycosyltransferase is a small molecule glycosyltransferase. A small molecule glycosyltransferase is a glycosyltransferase that catalyzes the transfer of a monosaccharide moiety from a sugar donor to a small molecule as acceptor molecule. A small molecule is a molecule that has a molecular weight below 1 500 Dalton, preferably below 1 000 Dalton.
According to certain embodiments, the present invention refers to a glycosyltransferase coded by a nucleic acid sequence having the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3 or has the amino acid sequence of SEQ-ID4, SEQ-I D5, or SEQ-ID6. This is meant to designate that the nucleic acid sequence, respectively amino acid sequence, of said glycosyltransferase consists of said certain nucleic acid sequence, , respectively amino acid sequence.
Glycosyltransferases having a nucleic acid sequence comprising SEQ-ID1 (i.e. the sequence of FaGTsi-5) or SEQ-I D2 (i.e. the sequence of FaGTsi-13) or SEQ-ID3 (i.e. the sequence of VvdGTi3) or a related nucleic acid sequence can be obtained by standard methods of recombinant DNA technology.
According to certain embodiments, the glycosyltransferase is capable of catalyzing formation of a glycoside in which a sugar is linked to an aglycone through a (3-D-glycosyl linkage.
According to a further aspect the present invention relates to a nucleic acid molecule encoding a glycosyltransferase of the invention, wherein said nucleic acid molecule is a DNA molecule, particularly a cDNA molecule. The present invention also refers to a cRNA molecule based on the DNA molecule of the invention.
According to another aspect, the present invention refers to a vector comprising a DNA sequence encoding a glycosyltransferase of the present invention. Construction of a vector may be performed using e.g. a restriction enzyme, ligase etc. according to a standard method known in the art.
A further aspect of the present invention relates to a host cell containing or transfected with the nucleic acid molecule or the vector according to the invention.
As host cell transfected with the nucleic acid molecule as described above, the cell of a prokaryotic or eukaryotic organism or the prokaryote or eukaryote itself may be used. Bacteria, for example, commonly used hosts such as bacteria belonging to genus Escherichia such as Escherichia coli can be used as the prokaryotic organism, although also other prokaryotes can be used. Alternatively, a cell of a lower eukaryotic organism such as eukaryotic microorganisms including, for example, yeast (e.g. Saccharomyces cerevisiae) or fungi like Aspergillus oryzae and Aspergillus niger can be used. Animal cells or plant cells also can be used as a host. Examples of animal cells that can be used include cell lines of mouse, hamster, monkey, human, etc., as well as insect cells such as silkworm cells and adult silkworm per se. A host cell being transfected refers to a situation where foreign DNA is introduced into the cell. A transfected host cell may be stably transfected, i.e. foreign DNA is introduced and integrated into the genome of the transfected cell. Alternatively, a transfected host cell may be transiently transfected, wherein the foreign DNA fails to integrate into the genome of the transfected cell. The transformation of a host with a nucleic acid molecule or a vector can be performed according to standard methods.
According to a further aspect, the present invention relates to a transgenic plant comprising a nucleic acid molecule or a vector according to the present invention. The term "transgenic plant" refers thereby to a plant that has a heterologous gene, i.e. a gene not from its natural environment, integrated into its genome and that transmits said heterologous gene to its progeny. For example, a heterologous gene includes a gene from one species introduced into another species. According to certain embodiments, a heterologous gene also includes a gene native to an organism that has been altered in some way (e.g., mutated, added in multiple copies, or linked to non-native regulatory sequences).
Another aspect of the present invention is directed to a method of forming at least one aroma glycoside, wherein an aglycone is covalently linked to a sugar donor comprising contacting the aglycone with the sugar donor and a glycosyltransferase of the invention under conditions appropriate for the transfer of the sugar group of said sugar donor. These appropriate conditions depend, among others, on the aglycone, the sugar donor and the glycosyltransferase, particularly its enzymatic activity, and thus also e.g. the temperature and pH, and can be suitable set once the compounds are determined. In certain embodiments, said method is an in vitro method which, preferably, does not involve any steps carried out in vivo. In some embodiments, said method is an in vivo method carried out in a host cell or transgenic plant as defined above. According to certain embodiments, only one aroma glycoside is formed in this method.
According to a still further aspect the present invention is directed to a method of producing at least one aroma glycoside, said method comprising the steps of:
culturing or growing a host cell or a transgenic plant of the invention; and
collecting from said host cell or transgenic plant said aroma glycoside.
The culturing or growing depends on the host cell or transgenic plant and can be suitably set by the skilled person, e.g. regarding nutrient addition, culture medium, growth conditions, etc. The collecting also depends on the type of host cell or transgenic plant and can be carried out using usual means like extraction, which also can be suitable set. Preferably, the aglycone is present in said host cell or transgenic plant during said culturing or growing said host cell or transgenic plant. Further preferably, the sugar donor is present in the culture medium used for culturing said host cell or in the water used for watering that transgenic plant. In certain embodiments, said culturing or growing said host cell is carried out in a bioreactor.
It is not excluded that more than one aroma glycoside is produced in a host cell or transgenic plant, which can be suitably carried out by selecting the respective aglycones and sugars. According to certain embodiments, only one aroma glycoside is produced in a host cell or transgenic plant of the invention.
In a further aspect the present invention relates to a product produced by the inventive methods. The product herein can comprise also mixtures of aroma glycosides. Furthermore, the product can contain the aroma glycoside in a concentration higher than its concentration in natural products or compositions, particularly higher than its concentration when produced in a host cell or transgenic plant of the same species and/or type which is not according to the invention.
According to a further aspect, the present invention is directed to the use of an aroma glycoside in a concentration higher than its concentration in natural products or compositions, preferably in an artificial product or composition from the group consisting of cosmetic products, e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes; hygienic products, e.g. diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds; food products, e.g.. bakery products, frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes / bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g. wood preservatives, wallpapers, mold-fightings /mold control, and odor colors; insect repellents, e.g. skin creams (topical), candies (orally), and candles; and products for electronic devices, e.g. odor TVs / 4D TVs, and smartphone gadgets. According to certain aspects, the aroma glycoside used is the aroma glycoside present in a product or composition according to the invention. According to certain embodiments, the aroma glycosides used in the product or composition according to the present invention are used.
As already noted above, the aroma precursors according to the invention, e.g. the flavoring and fragrance precursors that can be activated open up many new applications with their special properties, a few of which can be seen in Table 4. The identified enzymes themselves can be marketed as products by, for example, adding them together with the sugar substrates to semi-finished products in order to neutralize volatile, bad tasting or smelling flavors or odors by transferring them to non-volatile precursors using the enzymatic reaction.
Table 4 Selection of applications of the flavoring and fragrance precursors that can be activated;
Use in:
Figure imgf000018_0001
Electronics ; Electric appliances, e.g. 4D television; sensors
Certain specific embodiments of the present invention are described in the following:
(1) Biotechnologically produced aroma glycosides, characterized in that they are inactive precursors of flavorings or fragrances, are applied in new concentration ranges beyond those of natural aroma glycoside sources, and can be appropriately activated by:
a) biological mechanisms, e.g. addition of enzymes, e.g. β-glucosidase,
b) physical mechanisms, e.g. an increase in temperature, e.g. above 70°C,
c) chemical mechanisms, e.g. a pH change, e.g. below a pH of 3, d) aroma glycosides, characterized in that they are effective as taste modulators in uncleaved form, e.g. (and not limiting) as bitter-masking or sweet-enhancing agents, or also as flavorings of the perception umami or kokumi.
(2) Aroma glycoside according to (1), characterized in that
a) the released aglycones are understood as e.g. odorous substances/scents, aroma agents, flavorings, perfume oils, odors/smells/fragrances, odorous substance compositions, odor compositions and the like.
b) the aglycones are for example geraniol, nerol, citronellol, thymol, carvacrol, eugenol, phenyl ethanol, vanillin, menthol, hexenol, anisole, butanethiol, decalactone, ethylguaiacol, farnesol, furfuryl alcohol, furfuryl mercaptan, guaiacol, heptyl alcohol, linalool, methenthiol, octalactone, propanethiol, raspberry ketone, terpineol, 10-undecenol, hydroxycitronellol, dihydromyrcenol, borneol or hesperetin, or norfuraneol; particularly preferred are according to (1) a), b), c), but also according to d): furaneol, homofuraneol, caramel furanone, furanthiol, maltol, ethyl maltol, octenol, sotolon.
b) organic alcohols are glycosylated, e.g. from the list of aroma agents approved in Europe (union list).
c) they are terpene glycosides, e.g. glycosylated terpenoids with one or more hydroxy functions (CH EBI:6l777 list).
d) the aglycones are glycosylated with a proportion, e.g. molar proportion, of one or a multitude thereof with glucose, arabinose, xylose, rhamnose, apiose or galactose,
e) they have additional functions, e.g. antimicrobial, antifungal effect, flavor enhancement, sweetening agent, repellent, detergent.
(3) Aroma glycoside according to (1), characterized in that they are produced by a biotechnological process, for example via glycosyltransferases, e.g. with glucosyltransferases a) with the nucleotide sequence SEQ-I D1 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-I D1, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths,
b) with the nucleotide sequence SEQ-ID2 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-I D2, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths,
c) with the nucleotide sequence SEQ-ID3 and the amino acid sequence resulting thereof, or an amino acid sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the amino acid sequence resulting from SEQ-ID3, or a part thereof, wherein the part constitutes at least 50, preferably at least 80 or most preferably at least 200 amino acids in lengths,
d) which are for example a terpene glycosyltransferase, preferably a monoterpene glycosyltransferase,
e) which for example bind an aglycone containing a hydroxy group with a sugar via a B-D-glykosyl- bond to a glycoside,
f) which use for example UDP sugars as sugar source, e.g. UDP-glucose, UDP-arabinose, UDP- xylose, UDP-rhamnose, UDP-apiose, UDP-galactose,
g) which for example glycosylate the aglycones according to (2).
(4) A vector with the DNA-sequence from (3), which codes a glycosyltransferase.
(5) A host cell containing or transfected with the nucleic acid molecule according to (3) or containing the vector according (4).
(6) The host cell according to (5), which produces a glycosyltransferase according to (3).
(7) A transgenic plant comprising a nucleic acid molecule according to (3) 6 or a vector according to (4).
(8) The transgenic plant according to (7), which produces a glycosyltransferase according to (3)·
(9) Use of a glycosyltransferase according to (3) or a vector according to (4) or a host according to (5) - (6) or a transgenic plant according to (7) - (8) for producing aroma glycosides according to (i) - (2).
(10) Aroma glycose according to 1, characterized in that they are used for
a) hygienic applications and products, e.g. body deodorant, diapers, urinary bags, shoe soles, trash cans, swimming and bathing pools/tubs, cat's litter boxes, animal beds, dog hygiene, pheromone pills, tampons, latex gloves, anti-mosquito candies, anti-mosquito skin cream, anti- mosquito agents, toothpaste, shower gel, body lotion, skin cream, hair gels, skin lotion, lipstick, fingernail/nail polish, skin whitening, b) applications and products in the food sector, e.g. chewing gum, tea, pills against bad breath, coffee, spices, frozen goods (pizza, etc.), pastries/baking goods, deodorant candies, drinks, taste enhancers, blocking of negative tastes, bitter taste inhibition, taste modulation,
c) textiles, e.g. in detergent additives, softeners,
Particularly preferred are applications in steam irons or ironers, even more preferred therein special applications in which the part cleaving thermally according to (i)b) is technically set exactly by choice of temperature and exposure time, and the not immediately released part of the odor in impregnated form stays as depot on the texiles/fabrics for future activation during use (particularly according to (i)a).
d) applications and products in the construction sector, e.g. wood preservatives, wallpapers, building materials (mould control), odor color ("Geruchsfarbe"),
e) applications in household products, e.g. scented candles, batteries, cigarettes, scented cards, 4D television, scent dispensers, candles, flowers.
(11) Product or composition containing one or more aroma glycosides in concentrations that are higher than their concentrations in natural products or compositions.
(12) Product or composition according to (11), wherein the aroma glycoside is produced biotechnologically.
(13) Product or composition according to (11) or (12), in which the concentration of the one or more aroma glycoside, respectively, is from 1-10000, preferably 10-1000, further preferably 20-200, most preferably around 100 ppm.
(14) Product or composition according to one of (11) - (13), which is a pharmaceutical or cosmetic product or composition, personal hygiene products, consumer articles, foods, nutraceuticals, food supplements, textile care products, household products or products in the construction sector.
(15) Glycosyltransferase, coded by a nucleic acid
a) with the nucleotide sequence SEQ-ID1 or a nucleotide sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the SEQ-ID1, or a part thereof, which codes at least 50, preferably at least 80 or most preferably at least 200 amino acids, b) with the nucleotide sequence SEQ-ID2 or a nucleotide sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the SEQ-I D2, or a part thereof, which codes at least 50, preferably at least 80 or most preferably at least 200 amino acids, c) with the nucleotide sequence SEQ-ID3 or a nucleotide sequence which is at least 90%, preferably at least 95% or most preferably at least 98% identical to the SEQ-ID3, or a part thereof, which codes at least 50, preferably at least 80 or most preferably at least 200 amino acids, (1') Product or composition, preferably fragrance article that can be activated, containing fragrance glycosides, wherein the fragrance glycosides are contained in concentration ranges that are higher than that of natural fragrance glycoside sources, and the fragrance article is used a) as fragrance article in the area of household products and promotional products, e.g. as scented candles, batteries, cigarettes, scented cards, 4D television, scent dispensers, candles, flowers, adhesive strips, strips, patch/band-aid.
b) as insect repellent products, e.g. with candles and in scenting of rooms.
(2') Product or composition according to (1'), wherein - beside the fragrance glycosides - an activating enzyme, e.g. β-glucosidase, is contained.
(3') Product or composition according to (1') and/or (2'), wherein the fragrances can be activated according to need by
a) biological mechanisms, e.g. an addition of enzymes, e.g. β-glucosidase,
b) physical mechanisms, e.g. an increase of temperature, e.g. above 70°C,
c) chemical mechanisms, e.g. a change in pH, e.g. below a pH of 3,
d) according to (2) only through addition of water.
(4') Product or composition according to (2'), wherein a repeated activation is possible by having a phase of drying after the first activation.
(5') Product or composition according to (1'), in which
a) the released aglycones are understood as e.g. odorous substances/scents, perfume oils, odors/smells, odorous substance compositions, odor compositions and the like.
b) the released aglycones are for example geraniol, nerol, citronellol, thymol, carvacrol, eugenol, phenyl ethanol, vanillin, menthol, hexenol, anisole, butanethiol, decalactone, ethylguaiacol, farnesol, furfuryl alcohol, furfuryl mercaptan, guaiacol, heptyl alcohol, linalool, methenthiol, octalactone, propanethiol, raspberry ketone, terpineol, 10-undecenol, hydroxycitronellol, dihydromyrcenol, borneol, hesperetin, norfuraneol and ethyl maltol; particularly preferred are according to (3)a), b), c), d): furaneol, homofuraneol, caramel furanone, furanthiol, maltol, ethyl maltol, octenol, sotolon.
c) the contained aglycones are organic alcohols that have been glycosylated, e.g. from the list of aroma agents approved in Europe (union list). d) the fragrance precursors are terpene glycosides, e.g. glycosylated terpenoids with one or more hydroxy functions (CHEBI:61777 list).
e) the contained aglycones are glycosylated with a proportion, e.g. molar proportion, of one or a multitude thereof with glucose, arabinose, xylose, rhamnose, apiose or galactose.
(6') Product or composition of (1'), wherein the fragrance glycosides are produced biotechnolgically.
(7') Product or composition of (1'), in which the concentration of the one or more fragrance glycosides, respectively, is from 1-10000, preferably 10-1000, further preferably 20-200, most preferably around 100 ppm.
(8') Product or composition of (1'), which is an artificial flower, for example without a stem as swimming flower, for example as flower with absorbing stem which transfers water from a glass to the flower / flower blosson and releases the fragrance there.
(9') Product or composition of (8'), optionally with one or more properties of the following list:
a) The flower petals additionally have a color that can be activated by water.
b) The artificial stigma is formed as a depot in spherical (full sphere or coated hollow sphere) form to take up bigger amounts of fragrance that can be activated and of enzyme. Thereby, whole rooms can be scented.
c) Using smart papers a spatial change can be achieved by water supply, and thereby e.g. the opening of a closed flower can be mimicked.
d) Surprising artistic effects can be displayed by an intelligent arrangement of origami components.
(10') Product or composition of (1'), which is a stripe, preferably self-adhering, preferably equipped with a depot, e.g. a fleece/non-woven, e.g. with a length of 1 cm to 100 cm without a restriction regarding width and height, for versatile scenting in wet rooms or usage with promotional items/articles.
Examples
The present invention will now be described in detail with reference to several examples thereof. However, these examples are illustrative and do not limit the scope of the invention. Cosmetics / hygiene
Example i
Fragrances in cosmetic articles that can be activated
By adding aromas/aroma agents and fragrances to cosmetic articles the fragrant effect can be prolonged. For example the fragrant effect of a deodorant can be prolonged (see Fig. 1, 4GENE fragrance mixture). The activation of the fragrance precursors occurs over a prolonged period of time through the enzymes of the present skin bacteria (see Figure 4, dashed line). Below this threshold value no odor is perceptible anymore. The usual odor mixture (top note, solid line) has been volatilized after 3 hours, whereas the fragrance precursor mixture (4GENE fragrance mixture) is perceptible over 15 hours.
Example 2
Wetness display through fragrances that can be activated in diapers
The fragrances that can be activated are put into a cellulose layer of a diaper in a dry state, through humidity and/or the bacterial enzymes contained in the excrements a release of the fragrance component is enabled, which serves as signal for the diaper change and at the same time covers bad smells.
Example 3
Glycosides that can be activated for use in shoe soles
Shoe soles are treated with a spray which contains the fragrances that can be activated. The bacteria in the foot sweat activate the glycosides and prevent the unpleasant smell of the shoes during prolonged use in this way.
Example 4
Glycosides that can be activated for use in textiles
The fragrances that can be activated can be added to the detergent or the softener so that they wet the textiles after washing. During wearing of the textiles the fragrance is only activated by sweat bacteria and thus protects the wearer of the textiles from bad smells.
Particularly innovative are applications in steam irons or ironers, in which the part cleaving thermally is technically set exactly by choice of temperature and exposure time (immediate scent effect), and the not immediately released part of the odor in impregnated form stays as depot on the texiles/fabrics for future activation during use. Foods
Example 5
Food flavors that can be activated
Inactive aroma precursors are used in foods in order to release the aroma after activation. All foods are usable therefore which can be activated by temperature (> 70°C), microorganisms, addition of water and enzyme or influence of saliva. Examples thereof are foods which are heated during preparation like bread, cake and pizza, foods for which microorganisms are used for preparation, dry foods that come into contact with fluids like muesli and pulverized cold dishes, or foods that stay for a time in the mouth like chewing gum or drops/candies.
The proof-of-principle was now shown successfully for the example bread. Dough from three different kinds of bread was treated with the aroma precursor geranyl glucoside. In summary the breads with an addition of 100 ppm geranyl glucoside showed a conversion of about 6% glucoside to geraniol. This conversion is ascribed to the biggest extent to pyroiytic processes (about 5%) during the ten-minute baking process at 230°C and partly on the enzyme-catalyzed hydrolytic processes (about 1%) during the preparation of yeast- β-glucosidase.
The realization of a sensoric orthonasal test with testing the difference (triangle test) between bread with and without addition of geranyl glucoside for crust and crumb showed that the added amount of 100 ppm with a conversion of 6%, corresponding to a content of 1.7 mg/kg, respectively 1.7 ppm geraniol, in bread is sufficient to perceive a change of the total aroma.
The aromas that can be activated can be introduced into: semi-finished products, cake premixes, food supplements, sugar for burnt punch, waffles, crepes, hot fruit sauces, hot drinks, noodles. The release of the aromas from the precursors can be realized by: the cooking process, saliva, enzymes of microorganisms, baking, microwave, open fire, together with glycosidases only together with water.
Baking test 1 - flower dough
Dough blanks of 10 g flour each were used as base. A negative control (flour, salt and water), three samples (added geranyl glucoside), a recovery (addition of geraniol to the bread prior to freezing according to a postulated conversion of glucoside of about 6% in order to determine the losses during the analytical process) and a control for geraniol in the glucoside solution (addition of an aliquot amount of glucoside only after the baking process to determine the content of geraniol). Several process steps are carried out according to standardized instructions, for each of the six blanks separately. Preparing the dough/paste:
For a blank/blind test (1) 9.98 g well-mixed flour were weighed into a glass vessel and 0.2 g NaCI were added. The mixture was at first mixed in a dry state for 1 min in a farinograph (= kneader) and kneaded for 8 min after pipetting 6.4 ml dist. water. The dough was taken out quickly and weighed for a first time (El). A first fermenting period of 20 min at 31°C took place in a water vapor saturated proofing cabinet. After taking the dough out of the cabinet a second weighing (E2) took place as well as the homogenization. The ball-shaped blank was put into a round molder ("Rundwirker") and turned for 10 turns with a superimposed pestle. It was drawn through a pasta/noodle roller, folded two times without inclusion of air and again turned in the round molder for 20 turns. Finally a forming by hand was performed. After the homogenization a second fermentation period of 35 min follows.
For samples (2a-c) additionally 10 μΙ of a geranyl glucoside (GG) solution (c = 98 mg/ml) were quickly pipetted after the addition of water into the kneader.
In the control (3) no glucoside was added during preparation of the dough. The addition of 10 μΙ glucoside solution takes place for testing on impurities of the solution by geraniol immediately before reconditioning for the measurement to the baked, frozen bread.
In the recovery (4) no glucoside was added during preparation of the dough. The addition of 170 μΙ geraniol solution (1.24 m!Vl) takes place for recovery of geraniol (0.0124 μιτιοΙ/g bread, corresponding to a conversion of 6% GG) immediately before freezing with liquid nitrogen into the interior of the cooled bread.
Baking
Baking took place on a tray in the oven for 10 min at 230°C. Before and after putting the samples vapor was put into the closed oven, respectively (spraying and evaporating of 25 ml dist. H20).
Cooling/post-processing
The baked bread was left standing for 60 min at room temperature and subsequently frozen in liquid nitrogen. Storage of the breads took place at -18°C until the conditioning/preparation.
Result
For the bread samples the following weights of Table 5 were recorded: Table 5: Mass of bread samples of baking test 1
Sample 1 2b . ¾c > :!'.:. 3
E1 in g 15,9 15,5 15,7 15,9 15,7 16,
E2 in g 15,9 15,5 15,7 16, 15,7 16,
After baking the breads were compared according to their appearance and smell in order to check first perceivable differences. All 5 breads showed a desired ball-like form of about same size. Inflation during the two-time fermentation only took place to a very small degree. Blank (negative) test (1.1), control (1.3) and recovery (1.4) showed a pale, hardly browned crust. The sample blanks (i.2a-c) had dark, brown spots. These came possibly from an increased content of glucose after release of the added glucoside and the increasingly taking-place Maillard-reaction resulting therefrom. Sample (2b) showed the coloration most pronounced, what indicates slightly changed conditions during baking.
The results are shown in Fig. 5, pictures A1. From the smell samples 1, 3 and 4 reminded of the typically roasted, slightly sweet and intensive aroma of baked flour dough. With the sample blanks a slight fruity odor component could be perceived in addition after taking it from the oven, particularly at the bottom of the bread.
The sensory observations regarding the individual samples were in accordance to the expectations according to the different sample preparations with and without GG-dosage.
The analytical examination of the breads via GC resulted in the following measurement values of Table 6. For GC analysis, a Thermo Finnigan Trace DSQ mass spectrometer coupled to a Thermo Finnigan Trace GC was used. The instrument was equipped with a BPX5 20 M fused silica capillary column (30 m x 0.25 mm i.d., 0.25 pm film thickness). Helium gas flow rate was 1.1 ml/min. The injection port was operated in splitless mode. The injector temperature was 250°C, the ion source and interface temperatures were kept at 230 and 280 °C, respectively. The GC parameters were as follows: initial temperature 40 °C for 3 min, increased to 100 °C at a rate of 10 °C/min and from 100 °C to 190 °C at a rate of 30 °C/min. The EI-MS ionization voltage was 70 eV. Mass data was acquired in the range of 30-300 m/z. Compounds were identified by comparing their mass spectra and retention indices to the N IST mass spectra library and reference compounds.
The blind sample 1 as well as control 3 showed no geraniol sign/peak. The negative proof of control 3 (post-addition of GG stock solution after the baking process into the cooled bread) showed that no residue contents of geraniol due to impurities or decomposition processes were present in the GG stock solution and falsifications/errors could be excluded. The contents of geraniol in the bread samples therefore were determined directly from the peak areas of the extract measurements of the samples, with the results shown in Tables 7 and 8.
Table 6 Measurement results of the GC-MS analysis of baking test 1
Sample Weight E for extraction in g Peak area y in mAU*s
1 1,0011 0
2a 1,0002 37.103.623
2b 0,9989 39.631.114
2C 1,0003 36.519-788
3 0,9990 0
4 0,9967 51.424.887
Table 7: Calculation of the conversion of GG in the samples of baking test 1
sample C (geraniol) in Recovery C (geraniol), conversion
μηιοΙ/g factor F corrected, in μιτιοΙ/g U in %
1 0 - 0 0
2a 2,99E-02 0,30 8,95E-03 4,8
2b 3.19E-02 0,30 9.56E-03 5,1
2C 2,94E-02 0,30 8,81 E-03 4,7
3 0 - 0 0
4 4,l4E-02 0,30 V4E-02 6,6
Averaging resulted in the following:
Table 8: Average conversion of GG in the samples of baking test 1
Sample C (geraniol), Conversion U in %
corrected in μιτιοΙ/g
2a 8,95E-03 4,8
2 b 9,56E-03 5,1
2C 8,8iE-03 : 4,7
Mean value 9,ioE-03 4,8
With a recovery factor of 0.30, calculated from adding geraniol to the recovery sample before freezing (4), quite stable measurement results were achieved for the respective samples with 4.7% (2c) to 5.1% (2b) conversion of GG to geraniol in the baking test with flour dough. The slightly deviating result of sample 2b is most likely related to the changed conditions during the bread preparation. It seems contradictory that the named sample has lower contents of geraniol in spite of a stronger browning. Since the difference could not be tackled exactly all three results were taken for averaging. The calculated mean value of the triplicate determination was therefore 4.8 % conversion from 3.2 μ ιο] GG in 17 g bread based on flour dough. The cited conversion was already perceivable as fruity component of the crust aroma after baking.
Baking test 2 - simple yeast dough
As samples dough blanks of 10 g flour each were used. A negative control (flour, salt, sugar, yeast and water), three samples (additionally geranyl glucoside) and a recovery (addition of geraniol to the bread before freezing according to a postulated conversion of glucoside of 6% in order to determine losses during the analytical procedure) were used. Several process steps were carried out according to standardized specifications, separate for each of the five blanks.
Preparing the dough/paste:
For a blank/blind test (1) 9.98 g well-mixed flour were weighed into a glass vessel. 0.2 g NaCI and 0.1 g sucrose were added and the mixture was put in the kneader. An addition of 0.7 g (cooled) baking yeast directly to the kneader followed. The mixture was at first kneaded in a dry state for 1 min and kneaded for 8 min after pipetting 6.3 ml dist. H20. All further steps including the work-up and sample taking ware carried out according to the sample with flour dough (1). In the samples (2a-c) 10 μΙ GG-solution were pipetted directly after the addition of water to the kneader. The preparation of the recovery (3) was carried out analogous to the blind sample. After cooling for one hour 170 μΙ geraniol solution were injected herein into the breadcrumb directly before freezing with liquid nitrogen.
Result
For the bread samples the following weights of Table 9 were recorded:
Table 9: Mass of bread samples of baking test 2
Sample :-%:!::ά: 2b 3
E1 in g 16,3 16,7 16, 16, 16,94
E2 in g 16,3 16,5 16, 16,7 16,68 All five breads showed a bigger volume and stronger coloring of the crust compared to the baking test based on flour dough. The inflating during the fermentation process is attributed to the formation of gases due to the added yeast, which are held back due to the net-like dough structure. The strong brown color resulted either from an increased glucose and protein content or stronger heating processes in the crust, which are related to the changed bread structure. Striking was the irregular browning of sample 2b in contrast to the two other bread samples. The reason for this is an erroneous production of the bread. Contrary to the specification two homogenization steps were carried out during preparation of the dough, which lead to a stronger densification of the bread blank. As a result also the degree of the release of geraniol is influenced to an unknown degree due to the changed thermo and pyrolysis conditions. This circumstance had to be taken into account during evaluation of the baking test.
The results are shown in Fig. 6, pictures A2. The olfactory examination of blind sample (i) and recovery (3) showed in this experiment a typical yeast-sour, roasty, intensive baking aroma which showed the addition of yeast clearly. As already observed in baking test 1 a fruity note could be perceived in the total aroma in the samples with added GG solution (2a-c) directly after taking out of the oven, which thus reminded strongly of the scent of fine baking products (croissant).
The GC-MS analysis showed the following results of Table 10.
Table 10: Measurement results of the GC-MS analysis of baking test 2
Sam le Weight E for extraction in g Peak area y in mAU*s
Figure imgf000030_0001
2b 0,999 83.377.607
2C 1,0025 0.436.82Ο
3 0,9979 46.384.744
The measurement of blind samplei showed no geraniol peak. The amounts of geraniol in the bread samples are shown in Table 11.
A recovery factor of 0.33 was found from the quantification of the recovery sample. In the samples of this baking test the strong variation between the measurement results of the three breads was apparent, whose conversion was between 5.1% (2a) and 11.8% (2b). Since the higher result for sample 2b could be attributed to the deviations during the preparation of the bread, only samples 2a and 2c were taken into account during averaging of the results, the results of which are shown in Table 12.
Table 11: Calculation of the conversion of GG in the samples of baking test 2
Sample C (Geraniol) in Recovery C (Geraniol), Conversion
μιτιοΙ/g factor F corrected, in μιτιοΙ/g U in %
1 0 - 0 0
2a 2,88E-02 0,33 9,53E-03 5,1
2b 6,72E-02 0,33 2.23E-02 11,8
2C 4,05E-02 0,33 i,34E-02 7,1
3 3-75E 02 0,33 1,24E 02 6,6
Table 12: Average conversion of GG in the samples of baking test 2
Sample C (Geraniol), Conversion U in %
corrected in μιηοΙ/g
2a 9.53E-03 5,1
2C i,34E-02 7,1
Mean value V5E-02 6,1
The calculated mean value of the two-fold determination resulted in a conversion of 6.1% from 3.2 rnol GG in 17 g bread on the basis of a simple yeast dough. The obtained results were 1.2% higher than the one of baking test 1 with bread from flour dough (4.9%).
Baking test 3 - standard yeast dough
As samples dough blanks of 10 g flour each were used. A negative control (flour, salt, sugar, fat, yeast, L-ascorbic acid and water), three samples (additionally geranyl glucoside) and a recovery (addition of geraniol to the bread before freezing according to a postulated conversion of glucoside of 6% in order to determine losses during the analytical procedure) were used. Several process steps were carried out according to standardized specifications, separate for each of the five blanks. Preparing the dough/paste:
For a blank/blind test (1) 9.98 g well-mixed flour were weighed into a glass vessel. 0.2 g NaCI and 0.1 g sucrose and 0.1 g palm fat were added and the mixture was put in the kneader. An addition of 0.7 g (cooled) baking yeast directly to the kneader followed. The mixture was at first kneaded in a dry state for 1 min and kneaded for 8 min after pipetting 6.0 ml dist. H20 and 0.3 ml ascorbic acid solution.
All further steps including the work-up and sample taking ware carried out according to the sample with flour dough (1). In the samples (2a-c) 10 μΙ GG-solution were pipetted directly after the addition of water and ascorbic acid solution to the kneader. The preparation of the recovery (3) was carried out analogous to the blind sample. After cooling for one hour 170 μΙ geraniol solution were injected herein into the breadcrumb directly before freezing with liquid nitrogen.
Result
For the bread samples the following weights of Table 13 were recorded:
Table 13: Mass of bread samples of baking test 3
Sample 1 2a r v 2C 3
E1 in g 17,0 16, 16, 16, 16.90
E2 in g 16, 16, 16, 16, 16,87
All five breads showed a similarly increased volume after baking as in the baking test with simple yeast dough. The breads were all colored brown uniformly and strongly, so that no difference could be seen between the samples with and without precursor. The results are shown in Fig. 7, pictures A3. From an olfactory point the blind sample (1) and recovery (3) could not be differentiated from the analogue samples from baking test 2 with their typical yeast-like aroma. The samples (2a-c) showed a fatty fruity odor quality, as described before, which thus imparted the impression of fine baking products. In the aroma the respective breads of baking tests 2 and 3 are thus in accordance. The analysis of the release of geraniol in these experiments gave the following results shown in Table 14.
The measurement of blind sample 1 again showed no geraniol peak.
From the calculation the following values of Table 15 are obtained. Table 14: Measurement results of the GC-MS analysis of baking test 3
Sample Weight E for extraction in g Peak area y in mAU*s
Figure imgf000033_0001
2a 1,0009 18.938.801
2b 1,0008 20.885.92
2C 0,9989 19.411.178
3 1,0000 22.663.151
Table 15: Calculation of the conversion of GG in the samples of baking test 3
Sample C (Geraniol) in Recovery C (Geraniol), Conversion
μιτιοΙ/g factor F corrected, in μιτιοΙ/g U in %
1 0 . 0 0
2a 1,52E-02 0,68 1,04E-02 5,5
2b 1.68E-02 0,68 1,14E-02 6,1
2C i,57E-02 0,68 1,06E-02 5,6
3 . i i,83E-02 0,68 1,24E-02 6,6
A recovery factor of 0.68 was obtained from the quantification of the recovery sample. The samples showed sufficiently constant measurement values between 5.5% (2a) and 6.1% (2b) of GG in this experiment.
The averaging of the triple determination resulted in the values given in Table 16.
Table 16: Average conversion of GG in the samples of baking test 3
Sample C (Geraniol), corrected in μιηοΙ/g Conversion U in %
2a i,04E-02 5,5
2b V4E-02 6,1
2C 1,06E-02 5,6
Mean value i,o8E-02 5,7
The calculated mean value of the triplicate determination resulted in a conversion of 5.7% from 3.2 mol GG in 17 g bread based on standard yeast dough. It was thus a little under the value of conversion determined in baking test 2 (simple yeast dough without ascorbic acid) of 6.1% and above the one of baking test 1 (flour dough) of 4.8%, with the results summarized in Table 17. Table 17: Comparison of the average conversion from the different baking tests
Baking Type of dough C (Geraniol), C (Geraniol), Conversion U in % test corrected in μιηοΙ/g corrected in mg/kg
Flour dough ¾ioE-03 4,8
Simple yeast dough I,15E-02 6,1
Standard yeast dough i,o8E-02
In total similarly low conversion rates of geranyl glucoside for the differently prepared baking tests were obtained. The bread samples based on yeast dough showed similarly pronounced results with 6.1% (simple yeast dough) and 5.7% conversion (standard yeast dough). In the bread this translated to a content of geraniol of 1.77 and 1.67 mg/kg, respectively. Bread based on flour dough showed a result about 1% lower with a conversion of 4.8% GG, what corresponds to a content of 1.40 mg/kg geraniol in the baked bread.
A statement if the determined conversion of geranyl glucoside to aromatic geraniol can also be perceived by untrained consumer resulted in the following sensory test.
Sensory test
In order to test the influence of the amount of geraniol released in the baking test on the total aroma of the breads and its impression on the consumer an orthonasalic sensory test was carried out. In a triangle test with untrained panelists breads based on standard yeast dough with and without addition of GG were tested for a perceivable difference.
Bread made of standard yeast dough was tested analogous to the amount of 100 ppm geraniol (corresponds to 1 mg/10 g) used until now in raw bread dough and its difference to a blind sample. As sample dough blanks of 50 g flour each based on standard yeast dough (baking test 3 - standard yeast dough) were used (see Fig. 8, picture A4) A blind sample A (flour, salt, sugar, fat, yeast, L-ascorbic acid and water) and a positive control B (additionally geranyl glucoside) were used. Several process steps were carried out according to standardized specifications, separate for each of the two blanks.
Preparing the dough/paste:
For the blind sample A 94.9 g well-mixed flour were weighed into a glass vessel. 1.0 g NaCI, 0.5 g sucrose and 0.5 g palm fat were added and the mixture was put in the kneader. An addition of 3.5 g (cooled) baking yeast directly to the kneader followed. The mixture was at first kneaded in a dry state for 1 min and kneaded for 8 min after addition of 30.0 ml dist. H20 and 1.5 ml ascorbic acid solution. For the positive sample B additionally 50 μΙ of a GG stock solution (c = 98 mg/ml) were pipetted quickly after the addition of water and ascorbic acid to the kneader.
The dough was taken out quickly and weighed a first time (El). A first fermenting period of 20 min at 3"i°C took place in a water vapor saturated proofing cabinet. After taking the dough out of the cabinet a homogenization took place. The ball-shaped blank was put into a round molder and turned for 10 turns. It was rolled flat to a height of 1 cm, folded two times without inclusion of air and again turned in the round molder for 20 turns. Finally a forming by hand to form a roll was performed. This roll was put into a small loaf pan made of aluminum and weighed again (E2). After the homogenization a second fermentation period of 40 min followed.
Baking
Baking took place in the oven for 20 min at 230°C. Before and after putting the blank vapor was put into the closed oven, respectively (spraying and evaporating of 25 ml dist. H20).
Cooling/preparation
The baked bread was left standing for 60 min at room temperature and subsequently prepared for the sensory test. For testing the crust it was taken off with a knife, simultaneously shredded and ig each weighed into an airtight sensory vessel made of glass with ground joint and cover/lid. For preparing the crumb the bread that was totally freed from the crust was at first cut into 1.5 cm thick slices using a bread slicer and separated with an electronic knife into cuboids with a size of about 1.5 x 5.0 x 2.0 cm3 and a weight of 4.0 g. A cuboid each was put into an airtight sensory vessel made of glass with ground joint and cover/lid. Directly thereafter the sensory test took place.
Test
The process of the sensory test followed a simple triangle test with a test for differences based on DIN/ISO 4120 (Busch-Stockfisch, 2008). Bread crust and bread crumb of two charges of bread A and B were respectively tested in a triad of three filled sensory vessels from 18 panelists each orthonasal for a perceptible difference, wherein two vessels contained identical samples and the third was filled differently. All three samples were encoded with three-digit number codes. The following sample assemblies resulted: Crust:
B B A
(937) (482) (561)
and
A A B
(561) (208) (482)
Crumb:
A B A
(391) (2 6) (847)
and
B A B
(256) (391) (408)
Each panelist carried out two tests following each other, first for the sensory test of the crust, then for the crumb. After-tasting of the vessels within a test was allowed, a decision was forced (Forced-Choice-Principle). Following the test all singular results were brought together and evaluated statistically.
Result
In a basic protocol the results of the single protocols were brought together and evaluated statistically to test for a significance of the difference.
For this purpose the extent of the a-risk/ a-error was determined based on the relation of correct and wrong answers: the probability of the conclusion that a perceivable difference is present although this is not the case (also termed error of the first order/type, significance lever or probability of an erroneous rejection).
The a-risk was determined using suitable significance tables.
Valid is the following:
a < 0,05 (5 %) n. s. = not significant a = < 0,05 (5 %)
a = 0,05 (5 %) s = significant
a = 0,01 (1 %) h. s. = highly significant
a = 0,001 (0,1 %) s. h. s. = very highly significant
The test showed the following result of Table 18. Table 18: Significance level a in triangle test with test for difference
Test Number of Number of correct Significance level a Meaning
testers decisions
Crust 18 0,001 s. h. s.
Crumb 18 12 0,01 h. s.
The evaluation of both tests showed that most of the panelists could perceive a difference between the blind sample and bread. When checking the significance level an a -value of 1% resulted in the sensory test of the crumb with 12 correct answers for 18 panelists. This confirmed that the breads actually could be differentiated according to their smell and no difference that was not present was erroneously perceived. In the test for difference of the aroma of the crust an a -value of 0.1% was achieved with 13 correct answers for also 18 panelists, and thus a highly significant result (see Fig. 9, picture A5).
The application of geranyl glucoside as additive of bread in the described way and an appropriate dosing is thus suitable for producing an aromatized food. It could not be determined with the test if the fruity odor quality would be accepted by the consumer and, if yes, in which amounts. The results of the preference test clarified this.
Taste modulation
The glycosylated aroma agents also have taste-modulating properties. The glycosylation can reduce or prevent a bitter taste or function as taste enhancer. In addition, the enhanced stability of the glycosides is also advantageous in the application as taste modulators.
Example 6
The experiments of Example 5 were repeated using furaneol instead of geraniol with amounts of the aroma at a factor 2 to 5 increased. The results of Example 5 could be confirmed with these experiments.
Repellent
Example 7
Glycosides that can be activated for application as repellent with long-term effect
A skin cream with e.g. citronellol glucoside can be e.g. used as repellent for mosquitoes
(subfamilies Anophelinae and Culicinae). Therein the free citronellol is released by enzymes of skin bacteria from the citronellol glucoside over a prolonged period of time and enables a long- lasting mosquito protection. A similar effect can be achieved by taking up the citronellol glucoside in a candy orally and releasing the citronellol during digestion, which then is released in the whole body. This application is e.g. to be applied preferably during stays in the tropics to effectively repel mosquitoes that transfer sicknesses.
Construction materials
Example 8
Glycosides that can be activated for use in controlling mold
Construction materials, e.g. modern stones for building walls or insulation mats, etc., are added with the glycosides. Due to the fungicidal effect which only is activated enzymatically the mold can be controlled effectively. Only when mold wants to form and thus releases enzymes itself it kills itself this way.
Electronics
Example 9
Glycosides that can be activated for odor TV
The fragrances that can be activated can be stored in an inactive state for a very long time in contrast to the free fragrances. This predestines them for the application in odor TV (4D TV), wherein they can then be selectively released by electric heating.
Example 10
Glycosides used for an electronic sensor system
The fragrances that can be activated can be used for an electronic sensor system. After activation by a trigger such as enzymes, temperature, or pH the volatile flavors / odors or the released sugars of the glycosides act as a signal for an electronic sensor system and can be measured with an electronic sensor.
Household products
Example 11
Artificial flowers and plants
One further example is the use of inactivated fragrance precursors in an artificial flower. This consists of decorative artificial flower petals which surround a surface, e.g. a circle, or ball consisting of an absorbent material functioning as depot (see Fig. 10). This depot contains a dry mixture of a fragrance precursor, a glycoside, and a glycosidase, e.g. a glucosidase, in sufficient quantity. This artificial flower head is on top of a stem/stalk of water-conducting material, which, in turn can contain decorative leaves. This entity together forms an artificial flower.
When this artificial flower is put into a water container, e.g. a vase, water is lead through the absorbent material of the stem to the depot, in which the water enables the glycosidase, e.g. glucosidase to cleave the sugar of the fragrance precursor. The fragrance molecule thus formed is volatile and thus gets into the air, so that the artificial flower smells.
An experimental setup (proof-of-principle) was carried out as follows:
Solutions of different amounts of geranyl glucoside in ethanol were put on carrier materials with each a size of 2 cm2, respectively, and dried. Afterwards 5 to 10 mg of glucosidase were added and pasted over with a carrier material. In a setup the amounts described in Table 19 were used.
Table 19: Experimental setup of example 11
Figure imgf000039_0001
The loaded carrier materials were then wetted with 1 ml_ water. With a usage of 5 mg geranyl glucoside a distinctly perceptible odor could be smelled. With 2 mg, a weak odor could be achieved, and without either glucosidase or geranyl glucoside or water no odor could be noticed, as expected. A follow-up experiment was to rewet already used carrier materials after drying again. Also here again a volatile odor was perceived. The developed aromatic flowers thus can be used repeatedly and are not disposable articles.
In a further example an artificial flower was recreated, which can be seen in Fig. 10. Again the proof-of-principle was repeated, but this time with an absorbent stem that transports water to the carrier material after the flower is put into a glass of water. The results of the first experiment were confirmed therewith. Further embodiments of the embodiment are:
The flower petals have colors that can be activated and that only become colored by water.
The depot should be ball-shaped (full sphere or coated semi-sphere) so that bigger amounts of the fragrance that can be activated and the enzyme can be included. This way whole room can be scented.
Using smart paper a spatial change can be accomplished through feeding water and e.g. the opening of a closed flower can be mimicked.
Also origami-components are possible.
Floating water lilies would not need the stem.
Glycoside mixtures should be used so that the resulting fragrance can be smelled by as many people as possible.
In addition, the principle of artificial flowers can be transferred to other articles, e.g. scented balls which only release the fragrance after introduction into water, coated colored waterfalls for "fountain fragrance fireworks" ("Brunnenduftfeuerwerke"), self-adhering stripes that are furnished with an absorbent layer and can be adhered everywhere as fragrance dispensers after wetting, e.g. on promotional items.
Further applications
This list of examples is not exhaustive. From Table 4 further applications can be derived. The basis is always the activation with subsequent effect, like e.g. aromatic, smelling, fungicidal, bactericidal or repelling for mosquitoes.
New glycosyltransferases and glycosides
Example 12
Biotechnological production of furanon glycosides using glycosyltransferases
Glycosylated natural substances are important components of foods, pharmaceutical and cosmetic products due to their manifold physiological activities. For example, glycosylated diterpenes, steroids and flavonoids are used as sweeteners (steviosides, glycyrrhizin, neohesperidin) in the food industry, while steroid and antibiotic glycosides are used as medicines and glycoside extracts as cosmetic agents. Chemical-synthetic glycosylation reactions of the take place in the presence of heavy-metal containing catalysts, so that therefore recently biocatalysts are sought which can catalyze this reaction alternatively. Products obtained via biocatalysts correspond to the natural substances, are free of heavy metal residues and can therefore be declared as "natural" according to present law, which is a direct advantage for the consumer and for industry an indirect advantage in marketing. In nature, regio- and enantioselective sugar transfers are catalyzed by nucleoside diphosphate carbohydrate (e.g. UDP glucose) depending glycosyltransferases (UGTs). Glycosyltransferases that convert low molecular substrates transfer sugar on a plurality of acceptors like hormones and secondary metabolites as well as biotic and abiotic chemicals and toxins. The enzymes are coded in the different organisms by a big multigene family and can be identified by a common motif in their primary sequence (PSPG Box, Plant Secondary Product Glycosyltransferase). The transfer of a carbohydrate residue to a mostly lipophilic acceptor changes its chemical properties and its bioactivity and can facilitate the access to cellular membrane transporter systems. In vitro studies show that a singular UGT protein can glycosylate several substrates of different origin, but also that several UGTs can glycosylate the same substrate, which makes the identification of substrate specificity difficult to predict and thus impedes it.
Due to the sequencing of genomes of different organisms on a huge scale now continually many new UGT sequences are being published. During sampling of the UGT gene family of plant species which are particularly known for the production of glycosides sequences could be isolated now which code for UGT enzymes which catalyze the glycosylation of aromas / aroma agents very efficiently.
Own technical solution
In the search for efficient biocatalysts which can be particularly used for the production of aroma glycosides the UGT gene family of plant species V/'t/s vinifera (grape vine) and Fragaria x ananassa (strawberry) was examined. For this at first the gene sequences were searched that are strongly expressed in the fruits of the plant species. These were subsequently isolated, expressed in the host organism Escherichia coli, and the enzymatic activity toward different potential substrates was determined. At least three of the coding nucleic acid sequences (FaGTsi-5, FaGTsi-13 und VvdGTi3, see appended sequences) catalyze the formation of aroma glycosides very efficiently.
The essential new
During the transfer of the plant gene sequence to E.co/i unexpectedly an additional sequence was obtained. The corresponding protein sequence shows at positions 222 and 323 in place of histidine and aspartic acid the amino acids tyrosine and glutamic acid. This sequence was termed by us FaGTsi-13 and included in further experiments. A result thereof was that this new sequence has a 30% increased activity - in relation to molar conversion - compared to sequence FaGTsi-5 (see Fig. 11 A).
In Fig. 11 the determination of the enzyme activity of FaGTsi-5 and FaGTsi-13 is shown. Fig. 11A shows the relative activities of FaGTsi-5 and FaGTsi-13 f°r homofuraneol, and Fig. 11 B shows the relative activities of FaGTsi-13 with different substrates, i.e. furnaeol and homofuraneol, wherein the highest values were normalized to 1.
Unexpectedly, the biocatalysts FaGTsi-5 and FaGTsi-13 produced the glucosides of homofuraneol (Fig. 11 B) and norfuraneol apart from the glucosides of furaneol, both of which are not present in the examined plant species. The homofuraneol-B-D-glucoside, which for the first time can be produced using the biocatalysts FaGTsi-5 and FaGTsi-13, was not described previously. Surprisingly homofuraneol is converted 3 times more effectively than furaneol (Fig. 11B).
The components for the enzymatic reaction are shown in Table 20.
Table 20: Pipetting scheme for the in vitro assay
Tris buffer (o.,i M, pH 7.5) 100 μΙ
Substrate (60 m ) 2 μΙ
UDP-glucose (12C) o.2 mM 49.9 μΙ
UDP-glucose (14C) 0.3 mM 0.1 μΙ
Enzyme 2 μg
-►Ad 200 μΙ with H2O
-►1 h at 30 °C incubation
The reaction was started by adding UDP-glucose and stopped after incubation with 1 ml n- butanol. After vortexing for at least 15 s the reaction mixture was centrifuged 2 min at 12 000 xg for separation of the phases, and 800 μΙ of the upper organic phase containing the product were now transferred to 2 ml scintillation cocktail (Ultima-Flo AF, PerkinElmer). Non-converted UDP glucose remains in the aqueous phase and thus does not contribute to the radioactivity intensity in the sample (organic phase).
In whole cell fermentations wherein "resting cells" were incubated in M9 minimal medium (22 mM KH2PO4, 47.8 mM Na2HP04.2H20, 19 mM NH4CI, 8.6 mM NaCI, 0.1 mM CaCl2, 2 mM MgSG , 1 % glucose, pH 7.0) with the furanones more than 1 g/l furanon glycosides could be biotechnologically produced without any optimization until now. The simple production of biocatalysts in big amounts, the in vivo production of the co-substrate UDP-glucose in the cells and the abundant product amounts facilitate now the possibility to produce the target substances in an economical scale for industrial applications.
The products described herein enable for the first time the appropriate, biologically, physically and pH chemically controlled activation of flavorings and fragrances instead of the physical- chemical release of flavorings and fragrances used until now.
The glycosyltransferase method described herein is highly innovative. It is based on a natural principle, uses modern methods of biotechnology and is already very efficient on a laboratory scale. It is possible to produce the required amounts of flavoring and fragrance glycosides with it. It is unparalleled and in an unique position.
All references cited in this specification are herewith incorporated by reference in their entirety. The present method has been described in detail with reference to certain embodiments and specified by examples. However, a skilled person will acknowledge that also other modifications, changes, or similar alterations can be made to the present invention without deviating from the spirit of the invention.
Sequence protocol
SEQ-ID1: FaGTsi-5
ATGAAGAAAGCAGAGCTAGTGTTCATCCCTGCACCAGGAGCCGGCCACCTTGTGTCAGCCTTGCAATTCGG
AAAGCGTCTGCTTCAGCGAGATGATCGAATTTCAATCACAGTTCTTGCCATCAAATCAGCAGCCCCTTCATC
TTTAGGTTCATACACAGAAGCCCTTGTAGCTTCCGAGTCCCGTCTCCAACTCATTGACGTCCCTCAAGCTGA
GCTCCCTCCATTAGAGTTTGCAAAGTCACCAGCTAAGTTTTTCATTCTAAACATTGAGAACCATGTTCCTAA
TGTCAGAGAGGCCCTCACTAACTATGTCTCATCTAAGCAAGACTCGGTTCCAATTGTTGGAGTGGTTCTTGA
TTTCTTCTGTGTCTCCATGATTGATGTGGTCAATGAATTCAATCTCCCTTCTTATCTATTCATGACAAGCAAT
GCAGGGTATCTTTCTTTCAAGTTCCACTTTCCGGCGCAGGATAGCCGGACCGGTCGGCCGCCTAAAGACTCC
GATCCTGATTGGTTAGTCCCCGGTATTGTCCCCCCTGTTCCTACCAAAGTTTTGCCTGTGTCTTTAACTGATG
GTAGCTACTATAATTATCTTGGGGTTGCTTCGAGATTTAGAGAGGCCAAAGGTATCATAGCAAATACATGT
GTTGAGCTAGAGACACATGCGTTCAACTCTTTTGCTGAAGATCAAACTACGCCTCCGGTGTACCCAGTTGGA
CCGGTGCTTGATCTCAACGATGGTCAGGCTCGGTCCAATTTAAACCAGGCGCAGCGTGACAAGATCATCAG
CTGGCTTGATGATCAGCCTGAAGAGTCTGTTGTGTTCTTATGCTTTGGAAGCATGGGGAGCTTTACTGAAGC
ACAAGTGAAGGAGATAGCTCTGGGCCTTGAGCAGAGTGGGCAGAGGTTCTTGTGGTCTTTGCGTTTGACAC
CACCAAAGGGGAGTAAAAGTTTGAGTCCTGTGGACTGCTCGAACCTTGAGGAAGTATTGCCGGATGGATTC
TTGGAGAGGACTAGAGAAAAGGGACTGATATGCGGGTGGGCGCCGCAGGTGGACGTCTTGTCACACAAGG
CAACCGGAGGCTTTGTGTCGCATTGTGGGTGGAACTCGATCTTGGAGAGCTTGTGGCATGGCGTGCCGATT
GTGACATGGCCTATGTATGCTGAGCAACAGCTGAATGCGTTTCGATTGGTGAAGGAGATGGGGTTGGGATT
GGAGATGAGGTTGGATTACAAGCGAGGTGGTGATGAGGTTGTGAAGGCAGATGAGATTGGGAAGGCTGT
AGCTAGTGTGATGGAGAACAGTGAGGTGAGGAAGAAAGTGAAAGAAATTGGGGTGGTGTGCAGAAAAGC
TGTAGAGGATGGAGGGTCTTCTTCTGTTTCACTTGGAAGGTTCATTGAAGATGTGATGAGGAATCATTTTGG
TTCTGAGTAA
SEQ-ID2: FaGTsi-13
ATGAAGAAAGCAGAGCTAGTGTTCATCCCTGCACCAGGAGCCGGCCACCTTGTGTCAGCCTTGCAATTCGG
AAAGCGTCTGCTTCAGCGAGATGATCGAATTTCAATCACAGTTCTTGCCATCAAATCAGCAGCCCCTTCATC
TTTAGGTTCATACACAGAAGCCCTTGTAGCTTCCGAGTCCCGTCTCCAACTCATCGACGTCCCTCAAGCTGA
GCTCCCTCCATTAGAGTTTGCAAAGTCACCAGCTAAGTTTTTCATTCTAAACATTGAGAACCATGTTCCTAA
TGTCAGAGAGGCCCTCACTAACTATGTCTCATCTAAGCAAGACTCGGTTCCAATTGTTGGAGTGGTTCTTGA
TTTCTTCTGTGTCTCCATGATTGATGTGGTCAATGAATTCAATCTCCCTTCTTATCTATTCATGACAAGCAAT
GCAGGGTATCTTTCTTTCAAGTTCCACTTTCCGGCGCAGGATAGCCGGACCGGTCGGCCGCCTAAAGACTCC GATCCTGATTGGTTAGTCCCCGGTATTGTCCCCCCTGTTCCTACCAAAGTTTTGCCTGTGTCTTTAACTGATG
GTAGCTACTATAATTATCTTGGGGTTGCTTCGAGATTTAGAGAGGCCAAAGGTATCATAGCAAATACATGT
GTTGAGCTAGAGACATATGCGTTCAACTCTTTTGCTGAAGATCAAACTACGCCTCCGGTGTACCCAGTTGGA
CCGGTGCTTGATCTCAACGATGGTCAGGCTCGGTCCAATTTAAACCAGGCGCAGCGTGACAAGATCATTAG
CTGGCTTGATGATCAGCCTGAAGAGTCTGTTGTGTTCTTATGCTTTGGAAGCATGGGGAGCTTTACTGAAGC
ACAAGTGAAGGAGATAGCTCTGGGCCTTGAGCAGAGTGGGCAGAGGTTCTTGTGGTCTTTGCGTTTGACAC
CACCAAAGGGGAGTAAAAGTTTGAGTCCTGTGGAATGCTCGAACCTTGAGGAAGTATTGCCGGATGGATTC
TTGGAGAGGACTAGAGAAAAGGGACTGATATGCGGGTGGGCGCCGCAGGTGGACGTCTTGTCACACAAGG
CAACCGGAGGCTTTGTGTCGCATTGTGGGTGGAACTCGATCTTGGAGAGCTTGTGGCATGGCGTGCCGATT
GTGACATGGCCTATGTATGCTGAGCAACAGCTGAATGCGTTTCGATTGGTGAAGGAGATGGGGTTGGGATT
GGAGATGAGGTTGGATTACAAGCGAGGTGGTGATGAGGTTGTGAAGGCAGATGAGATTGGGAAGGCTGT
AGCTAGTGTGATGGAGAACAGTGAGGTGAGGAAGAAAGTGAAAGAAATTGGGGTGGTGTGCAGAAAAGC
TGTAGAGGATGGAGGGTCTTCTTCTGTTTCACTTGGAAGGTTCATTGAAGATGTGATGAGGAATCATTTTGG
TTCTGAGTAA
SEQ-ID3: VvdGTi3
ATGGCTGAAAAACCTCCCCACATAGCCATTCTCCCGACCCCTGGCATGGGTCACCTCATCCCTCTCATTGAA
CTAGCCAAACGCCTCGTCACCCACCATGGATTCACAGTCACTTTCATCATCCCCAACGATAATTCTTCTCTCA
AAGCCCAGAAGGCCGTGCTCCAGAGCCTCCCTCCCAGCATAGACTCCATTTTTCTTCCTCCGGTTAGTTTTG
ATGACTTGCCGGCGGAGACGAAGATCGAGACTATGATTTCTCTCACTGTGGTTCGGTCACTTTCCCATCTCC
GGAGCTCGCTGGAGTTGCTGGTTTCGAAGACCCGAGTGGCGGCGCTCGTCGTCGATCTCTTCGGAACCGAC
GCGTTCGACGTCGCGGCGGAGTTCGGGGTGGCGCCGTACATTTTCTTCCCGTCGACGGCGATGGCTCTCTCG
CTGTTTCTGTTCCTTCCGAAGCTGGATGAGATGGTGGCGTGCGAATTTCGGGACATGAATGAACCGGTGGC
GATTCCTGGTTGCGTGCCGGTCCACGGCTCGCAGCTGCTCGACCCGGTTCAGGATAGGAGGAACGACGCTT
ACAAGTGGGTTCTACACCACACCAAGAGATATCGACTGGCTGAAGGGATAATGGTGAATAGCTTCATGGA
GTTGGAGCCTGGACCGCTCAAGGCTCTGCAGACACCCGAACCGGGTAAACCGCCGGTCTACCCGGTCGGAC
CGCTGATAAAGAGGGAGTCGGAGATGGGATCCGGTGAGAACGAGTGTTTGAAGTGGCTGGACGACCAGCC
ACTTGGCTCCGTCCTATTCGTCGCTTTCGGGAGCGGTGGGACCCTCCCCAGTGAGCAATTAGATGAGCTGGC
CTTGGGCTTAGAGATGAGTGAGCAAAGATTTTTGTGGGTAGTGAGGAGCCCTAGTCGTGTGGCTGATTCCT
CATTCTTCAGTGTCCATTCTCAAAATGACCCTTTCTCTTTCTTACCTCAAGGGTTTGTAGATAGAACCAAAGG
GCGGGGCCTCTTGGTGTCATCCTGGGCACCACAGGCTCAAATTATTAGCCACGCATCCACCGGAGGGTTCTT
GTCTCATTGCGGGTGGAACTCCACTCTCGAGAGCGTTGCCTGCGGTGTCCCCATGATCGCTTGGCCGCTCTA
CGCCGAGCAAAAAATGAACGCAATAACATTAACCGACGACTTAAAAGTGGCATTGAGGCCAAAAGTTAAC GAAAATGGTCTAATCGATCGTAATGAAATTGCTCGAATTGTTAAGGGTCTGATGGAAGGGGAAGAAGGAA AGGGTGTACGCAGTCGAATGAAGGACCTTAAGGACGCCTCCGCAAAAGTTTTGAGCCATGATGGGTCTTCT ACAAAGGCACTCTCAACCGTGGCTCAAAAATGGAAGGCTCACAAGAATTATTAG
SEQ-ID4:
MKKAELVFIPAPGAGHLVSALQFGKRLLQRDDRISITVLAI KSAAPSSLGSYTEALVASESRLQLIDVPQAELPP
LEFAKSPAKFFILNIENHVPNVREALTNYVSSKQDSVPIVGVVLDFFCVS IDVVNEFNLPSYLF TSNAGYLS
FKFHFPAQDSRTGRPPKDSDPDWLVPGIVPPVPTKVLPVSLTDGSYYNYLGVASRFREAKGIIANTCVELETH
AFNSFAEDQTTPPVYPVGPVLDLNDGQARSNLNQAQRDKIISWLDDQPEESVVFLCFGS GSFTEAQVKEIA
LGLEQSGQRFLWSLRLTPPKGSKSLSPVDCSNLEEVLPDGFLERTREKGLICGWAPQVDVLSHKATGGFVSH
CGWNSILESLWHGVPIVTWP YAEQQLNAFRLVKE GLGLE RLDYKRGGDEWKADEIGKAVASVMEN
SEVRKKVKEIGVVCRKAVEDGGSSSVSLGRFIEDV RNHFGSE
SEQ-ID5:
MKKAELVFIPAPGAGHLVSALQFGKRLLQRDDRISITVLAI KSAAPSSLGSYTEALVASESRLQLIDVPQAELPP
LEFAKSPAKFFILNIENHVPNVREALTNYVSSKQDSVPIVGVVLDFFCVS IDVVNEFNLPSYLF TSNAGYLS
FKFHFPAQDSRTGRPPKDSDPDWLVPGIVPPVPTKVLPVSLTDGSYYNYLGVASRFREAKGIIANTCVELETY
AFNSFAEDQTTPPVYPVGPVLDLNDGQARSNLNQAQRDKIISWLDDQPEESVVFLCFGS GSFTEAQVKEIA
LGLEQSGQRFLWSLRLTPPKGSKSLSPVECSNLEEVLPDGFLERTREKGLICGWAPQVDVLSHKATGGFVSHC
GWNSILESLWHGVPIVTWP YAEQQLNAFRLVKEMGLGLE RLDYKRGGDEWKADEIGKAVASV ENSE
VRKKVKEIGWCRKAVEDGGSSSVS LGRFIEDV RNHFGSE
SEQ-ID6:
MAEKPPHIAILPTPGMGHLIPLIELAKRLVTHHGFTVTFIIPNDNSSLKAQKAVLQSLPPSIDSIFLPPVSFDDLP
AETKIET ISLTWRSLSHLRSSLELLVSKTRVAALWDLFGTDAFDVAAEFGVAPYIFFPSTA ALSLFLFLPKL
DEMVACEFRDMNEPVAIPGCVPVHGSQLLDPVQDRRNDAYKVWLHHTKRYRLAEGI VNSF ELEPGPLK
ALQTPEPGKPPVYPVGPLIKRESE GSGENECLKWLDDQPLGSVLFVAFGSGGTLPSEQLDELALGLEMSEQ
RFLWWRSPSRVADSSFFSVHSQNDPFSFLPQGFVDRTKGRGLLVSSWAPQAQIISHASTGGFLSHCGWNST
LESVACGVP IAWPLYAEQK NAITLTDDLKVALRPKVNENGLIDRNEIARIVKGL EGEEGKGVRSR KD
LKDASAKVLSHDGSSTKALSTVAQKWKAHKNY

Claims

Patent Claims
1. Product or composition comprising at least one aroma glycoside comprising an aglycone component and at least one sugar component, wherein the concentration of the at least one aroma glycoside is higher than its concentration in natural products or compositions.
2. Product or composition according to claim 1, wherein the aroma is at least one selected from the list of compounds consisting of eugenol, citronellol, thymol, carvacrol, furaneol, 1- hexanol, homofuraneol, norfuraneol, menthol, raspberry ketone, maltol, ethylmaltol, 2- furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, i-octen-3-ol, sotolon, 4-mercapto-4- methylpentan-2-on, (3-methylthio)-i-propanol, and phenylethanol, preferably from thymol, carvacrol, furaneol, homofuraneol, norfuraneol, raspberry ketone, maltol, ethylmaltol, 2- furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, sotolon, 4-mercapto-4-methylpentan- 2-on, and (3-methylthio)-i-propanol, more preferably from carvacrol, norfuraneol, raspberry ketone, 2-furfurylthiol, 2-methyl-3-furanthiol, 3-mercapto-2-pentanon, sotolon, 4-mercapto-4- methylpentan-2-on, and (3-methylthio)-i-propanol.
3. Product or composition according to claim 1 or 2, wherein the concentration of the at least one aroma glycoside is 1 - 10000 ppm, preferably 10 - 1000 ppm, further preferably 20 - 200 ppm, particularly preferably about 100 ppm.
4. Product or composition according to any one of claims 1 to 3, wherein the aroma glycoside comprises an aglycone precursor selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures.
5. Product or composition according to any one of claims 1 to 4, further comprising at least one inactive hydrolase, preferably a glycosidase, particularly a β-glucosidase, and at least one further inactive enzyme, particularly when the aglycone is an alcohol and/or a thiol, preferably an oxidase when the aglycone is an alcohol.
6. Product or composition according to any one of claims 1 to 5, further comprising at least one selected from the group consisting of odorous substances, flavoring agents, essences, perfume oils, perfumes, aromatic substance compositions, and fragrance mixtures.
7. Glycosyltransferase for producing an aroma glycoside as used in any of claims 1 to 6 coded by a nucleic acid sequence that
a) comprises the sequence of SEQ-IDi, SEQ-I D2, or SEQ-ID3; or
b) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to SEQ-ID1, SEQ-ID2, or SEQ-ID3; or
c) comprises a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length; or
d) comprises a sequence that is at least 90%, preferably at least 95%, more preferably at least 98%, identical to a part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-ID3, wherein said part of the sequence of SEQ-ID1, SEQ-ID2, or SEQ-I D3 codes at least 50, preferably at least 80, more preferably at least 100, more preferably at least 200, amino acids in length.
8. The glycosyltransferase according to claim 7, wherein the glycosyltransferase is capable of catalyzing formation of a glycoside in which a sugar is linked to an aglycone through a β-D- glycosyl linkage.
9. A nucleic acid molecule encoding a glycosyltransferase as defined in claim 7 or 8, wherein said nucleic acid molecule is a DNA molecule, particularly a cDNA molecule.
10. A vector comprising a DNA sequence encoding a glycosyltransferase as defined in claim 7 or 8.
11. A host cell containing or transfected with the nucleic acid molecule according to claim 9 or the vector according to claim 10.
12. A transgenic plant comprising a nucleic acid molecule as defined in claim 9 or a vector as defined in claim 10.
13. A method of forming at least one aroma glycoside, wherein an aglycone is covalently linked to a sugar donor comprising contacting the aglycone with the sugar donor and a glycosyltransferase as defined in any of claims 7 or 8 under conditions appropriate for the transfer of the sugar group of said sugar donor, or said method comprising the steps of:
culturing or growing a host cell as defined in claim 11 or a transgenic plant as defined in claim 12; and
collecting from said host cell or transgenic plant said aroma glycoside.
14. Product produced by the method according to claim 13.
15. Use of an aroma glycoside in a concentration higher than its concentration in natural products or compositions, preferably in an artificial product or composition from the group consisting of cosmetic products, e.g. deodorants, shower gels, body lotions, skin creams, shampoos, lipsticks, skin whitenings, and tooth pastes; hygienic products, e.g. diapers, sanitary pads, shoe soles, litter bins, cat toilets, and pet beds; food products, e.g.. bakery products, frozen foods, tea, coffee, beverages, chewing gum, sweets, pills against bad breath, deodorant candies, flavor enhancers, blocking/inhibitors of negative flavors, blocking bitter tastes / bitter taste inhibitors, and taste modulators; pharmaceutical products; fragrances; clothing and textiles and products related thereto, e.g. fabric softeners, and impregnations; household products, e.g. scented candles and cards, cigarettes, air fresheners, artificial flowers and plants, and adhesive strips; products in the construction sector, e.g. wood preservatives, wallpapers, mold-fightings /mold control, and odor colors; insect repellents, e.g. skin creams (topical), candies (orally), and candles; and products for electronic devices, e.g. odor TVs / 4D TVs, and smartphone gadgets.
PCT/EP2016/054760 2015-03-06 2016-03-07 Glycosylated aroma- and fragrance precursors and fragrance products that can be activated Ceased WO2016142329A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP16708170.2A EP3264906B1 (en) 2015-03-06 2016-03-07 Glycosyltransferase, transgenic plant and method for forming aroma glycosides
US15/556,209 US20180127681A1 (en) 2015-03-06 2016-03-07 Glycosylated aroma- and fragrance precursors and fragrance products that can be activated

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
EP15158057 2015-03-06
EP15158057.8 2015-03-06
EP15160115 2015-03-20
EP15160115.0 2015-03-20
EP15164326.9 2015-04-20
EP15164326.9A EP3064069A1 (en) 2015-03-06 2015-04-20 Glycosylated aroma- and fragrance precursors and fragrance products that can be activated

Publications (1)

Publication Number Publication Date
WO2016142329A1 true WO2016142329A1 (en) 2016-09-15

Family

ID=52997911

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2016/054760 Ceased WO2016142329A1 (en) 2015-03-06 2016-03-07 Glycosylated aroma- and fragrance precursors and fragrance products that can be activated

Country Status (3)

Country Link
US (1) US20180127681A1 (en)
EP (2) EP3064069A1 (en)
WO (1) WO2016142329A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10758476B1 (en) 2017-09-18 2020-09-01 Type A Brands, Llc Deodorant with sweat-activated technology
EP4123006A1 (en) 2021-07-19 2023-01-25 The Procter & Gamble Company Composition comprising spores and pro-perfume materials

Families Citing this family (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2019113092A1 (en) * 2017-12-04 2019-06-13 Cybele Microbiome, Inc. Methods and compositions for identification and modulation of microbiome biochemical pathways to alter phenotype
CN110564504A (en) * 2019-08-30 2019-12-13 重庆中烟工业有限责任公司 Tobacco essence containing yellow bark extract, preparation method and application
KR20240034190A (en) * 2021-07-20 2024-03-13 제이티 인터내셔널 소시에떼 아노님 Vaporizable materials for use in aerosol generating devices
WO2023090764A1 (en) * 2021-11-18 2023-05-25 주식회사 케이티앤지 Wallpaper composition and wallpaper from which flavor ingredient is released by heat
TWI836728B (en) 2021-11-18 2024-03-21 南韓商韓國煙草人參股份有限公司 Wallpaper composition and wallpaper releasing flavorant component by heat

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006087370A1 (en) * 2005-02-18 2006-08-24 Poalis A/S Use of aroma glycosides as flavor or fragrance ingredient

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7846697B2 (en) * 2003-06-19 2010-12-07 BLMaps Method of producing a low molecular weight organic compound in a cell

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006087370A1 (en) * 2005-02-18 2006-08-24 Poalis A/S Use of aroma glycosides as flavor or fragrance ingredient

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
DATABASE EMBL [online] 19 February 2010 (2010-02-19), "Pyrus communis clone UGT71K2 glycosyltransferase mRNA, complete cds.", retrieved from EBI accession no. EM_STD:FJ854495 Database accession no. FJ854495 *
GOSCH C ET AL: "Cloning and heterologous expression of glycosyltransferases from Malus x domestica and Pyrus communis, which convert phloretin to phloretin 2@?-O-glucoside (phloridzin)", PLANT SCIENCE, ELSEVIER IRELAND LTD, IE, vol. 178, no. 3, 1 March 2010 (2010-03-01), pages 299 - 306, XP026932497, ISSN: 0168-9452, [retrieved on 20100108], DOI: 10.1016/J.PLANTSCI.2009.12.009 *
JUAN JOSÉ RODRÍGUEZ-BENCOMO ET AL: "Application of glycosidic aroma precursors to enhance the aroma and sensory profile of dealcoholised wines", FOOD RESEARCH INTERNATIONAL., vol. 51, no. 2, 1 May 2013 (2013-05-01), GB, pages 450 - 457, XP055247707, ISSN: 0963-9969, DOI: 10.1016/j.foodres.2012.12.057 *
KOEDUKA TAKAO ET AL: "Enhancement of production of eugenol and its glycosides in transgenic aspen plantsviagenetic engineering", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ACADEMIC PRESS INC. ORLANDO, FL, US, vol. 436, no. 1, 23 May 2013 (2013-05-23), pages 73 - 78, XP028570477, ISSN: 0006-291X, DOI: 10.1016/J.BBRC.2013.05.060 *
THOMAS LOUVEAU ET AL: "Predicting the substrate specificity of a glycosyltransferase implicated in the production of phenolic volatiles in tomato fruit", FEBS JOURNAL, vol. 278, no. 2, 17 January 2011 (2011-01-17), GB, pages 390 - 400, XP055247672, ISSN: 1742-464X, DOI: 10.1111/j.1742-4658.2010.07962.x *
Y. M. TIKUNOV ET AL: "NON-SMOKY GLYCOSYLTRANSFERASE1 Prevents the Release of Smoky Aroma from Tomato Fruit", THE PLANT CELL, vol. 25, no. 8, 1 August 2013 (2013-08-01), US, pages 3067 - 3078, XP055247660, ISSN: 1040-4651, DOI: 10.1105/tpc.113.114231 *

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10758476B1 (en) 2017-09-18 2020-09-01 Type A Brands, Llc Deodorant with sweat-activated technology
EP4123006A1 (en) 2021-07-19 2023-01-25 The Procter & Gamble Company Composition comprising spores and pro-perfume materials
JP2024525840A (en) * 2021-07-19 2024-07-12 ザ プロクター アンド ギャンブル カンパニー Compositions Comprising Spores and Pro-Flavor Materials
JP7729973B2 (en) 2021-07-19 2025-08-26 ザ プロクター アンド ギャンブル カンパニー Compositions Comprising Spores and Pro-Flavoring Materials

Also Published As

Publication number Publication date
EP3264906B1 (en) 2020-05-06
EP3264906A1 (en) 2018-01-10
US20180127681A1 (en) 2018-05-10
EP3064069A1 (en) 2016-09-07

Similar Documents

Publication Publication Date Title
EP3264906B1 (en) Glycosyltransferase, transgenic plant and method for forming aroma glycosides
Xiao et al. Generation of acetoin and its derivatives in foods
DE69534385T2 (en) PERFECT RELEASE PERFUME AND METHOD FOR DETECTING MICROORGANISMS THROUGH THIS PERFUME
Kelanne et al. Phenolic compound profiles in alcoholic black currant beverages produced by fermentation with Saccharomyces and non-Saccharomyces yeasts
Krist et al. Volatile compound analysis of SPME headspace and extract samples from roasted Italian chestnuts (Castanea sativa Mill.) using GC-MS
Shi et al. Characterization of key aroma compounds in tartary buckwheat (Fagopyrum tataricum Gaertn.) by means of sensory-directed flavor analysis
JP2005520505A (en) Low-fat cocoa extract
JP4633226B2 (en) Antibacterial and deodorant
Özdemir et al. The effect of lactic acid bacteria and yeast usage on aroma development during tarhana fermentation
Dach et al. Characterization of the key aroma compounds in a freshly prepared oat (Avena sativa L.) pastry by application of the sensomics approach
Schlüter et al. Comparison of the aroma composition and sensory properties of dark chocolates made with moist incubated and fermented cocoa beans
Schlüter et al. Novel time-and location-independent postharvest treatment of cocoa beans: investigations on the aroma formation during “moist incubation” of unfermented and dried cocoa nibs and comparison to traditional fermentation
JP2005080543A (en) Method for producing cyclodextrin clathrate material comprising fat-soluble ginger component
JP4422819B2 (en) Deodorant, food and drink containing the same, composition for oral cavity and toiletry product
Ho et al. Nutrition, functional and sensory properties of foods
KR20140092230A (en) Method for utilizing monoterpene glycosyltransferase
Samakradhamrongthai The overview
CN105431509B (en) Method for stabilizing odor ingredients, fragrance composition and deodorant composition
JP5129471B2 (en) Fragrance composition
JP2012500859A (en) Equilibrated dynamic mixture containing stabilized hemiacetals for controlled release of active alcohols
JPH09111285A (en) Natural vanilla flavor and method for producing the same
KR102557706B1 (en) Composition for skin-protective comprising saponarin and Ganoderma lucidum extract
CN113166034B (en) Diester compounds as pro-fragrances
JPWO2009048128A1 (en) Weight gain inhibitor
JP2010279414A (en) Deodorant containing ω-methylthioalkyl isothiocyanate

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16708170

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2016708170

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 15556209

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE