WO2016127052A1 - Cxcl11 and smica as predictive biomarkers for efficacy of anti-ctla4 immunotherapy - Google Patents
Cxcl11 and smica as predictive biomarkers for efficacy of anti-ctla4 immunotherapy Download PDFInfo
- Publication number
- WO2016127052A1 WO2016127052A1 PCT/US2016/016769 US2016016769W WO2016127052A1 WO 2016127052 A1 WO2016127052 A1 WO 2016127052A1 US 2016016769 W US2016016769 W US 2016016769W WO 2016127052 A1 WO2016127052 A1 WO 2016127052A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- smica
- ctla
- patient
- antibody
- immunotherapy
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/5759—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5751—Immunoassay; Biospecific binding assay; Materials therefor for cancer of the skin, e.g. melanoma
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/5758—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
- G01N33/57585—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds identifiable in body fluids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/55—Medicinal preparations containing antigens or antibodies characterised by the host/recipient, e.g. newborn with maternal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/52—Assays involving cytokines
- G01N2333/521—Chemokines
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
- G01N2333/70539—MHC-molecules, e.g. HLA-molecules
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/52—Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis
Definitions
- Ipilimumab is a human monoclonal antibody that specifically binds to cytotoxic T lymphocyte antigen-4 (CTLA-4).
- CTLA-4 is expressed on activated T cells, has structural similarities to the costimulatory molecule CD28, and binds to the same ligands as CD28, albeit with higher affinity. Binding of CTLA-4 to CD80/CD86 inhibits T cell activation by limiting interleukin-2 (IL-2) production and expression of the IL-2 receptor (CD25) (Wolchok et al., Annals of the New York Academy of Sciences 2013;1291: 1-13).
- IL-2 interleukin-2
- Ipilimumab prevents CTLA-4 from binding its ligands, thereby promoting activation of effector T cells via prolonged CD28 signaling (Rudd et al., Immunol Rev 2009;229: 12-26).
- anti-CTLA-4 antibodies can deplete intratumoral regulatory T cells, subverting yet another mechanism of
- Ipilimumab was approved in the United States for the treatment of metastatic melanoma in 2011. While a significant breakthrough in the treatment of metastatic melanoma, there is a need to increase the percentage of patients who achieve a response to treatment, such as prolonged overall survival.
- immuno therapeutics act primarily upon cells of the immune system.
- the requirement for the immune system as a third-party mediator of the drug's activity suggests the balance of positive and negative regulators of the immune response at the time of therapy may be a critical determinant of efficacy for any immunotherapy.
- Cytokines, chemokines, and soluble receptors regulate the survival, activity, and location of immune effector cells and thus represent potential players in determining drug efficacy.
- soluble factors involved in the recruitment and regulation of effector T cells representing the most readily measurable clinical biomarkers.
- a cancer patient e.g., a patient diagnosed with metastatic melanoma
- methods for optimizing treatment of a cancer patient include a) selecting a cancer patient for treatment with an anti-CTLA-4 immunotherapy, or b) predicting the responsiveness of a cancer patient for treatment with an anti-CTLA-4
- an anti-CTLA-4 immunotherapy e.g., a CTLA-4 antagonist
- the determination is based on measuring the level of CXCLl 1 and/or sMICA in a biological sample from the patient, and comparing the level with a threshold level, wherein levels of CXCLl 1 and/or sMICA below the threshold level is indicative that the patient is likely to respond to anti-CTLA-4 immunotherapy, and levels above the threshold level is indicative that the patient is unlikely to respond to anti-CTLA-4 immunotherapy. If the levels of CXCLl 1 and/or sMICA are below the threshold level, then the patient a) is selected for treatment with an anti-CTLA-4 immunotherapy, or b) predicted to be responsive to anti-CTLA-4 immunotherapy.
- the determination is based on measuring the level of CXCLl 1 and/or sMICA in a biological sample from the patient, and if the levels of CXCLl 1 and/or sMICA are below the threshold level, then the patient is administered a therapeutically effective amount of an anti-CTLA-4 immunotherapy.
- the determination is based on obtaining the levels of CXCLl 1 and/or sMICA in a biological sample from the patient, and if the levels of CXCLl 1 and/or sMICA are below a threshold level, then the patient is administered a therapeutically effective amount of an anti-CTLA4 immunotherapy, or administration of a therapeutically effective amount of an anti-CTLA4 immunotherapy is ordered.
- the patient is further administered a therapeutically effective amount of a CXCLl 1 antagonist and/or sMICA antagonist.
- administration of a therapeutically effective amount of a CXCLl 1 antagonist and/or sMICA antagonist is ordered.
- Administration of the CXCLl 1 antagonist and/or sMICA antagonist, or the order to administer the CXCLl 1 antagonist and/or sMICA antagonist can be concurrent with, or sequential to, administration of the anti-CTLA-4 immunotherapy.
- the CXCLl 1 antagonist and/or sMICA antagonist is a protein (e.g., an antibody or antigen-binding portion thereof), small molecule, or nucleic acid.
- the step of determining the level of CXCLl 1 and/or sMICA in a biological sample from the patient involves determining the level of CXCLl 1 and/or sMICA protein or gene expression.
- the level of CXCLl 1 or sMICA is determined by contacting the biological sample from the patient with an agent that binds to CXCLl 1 or sMICA, respectively (e.g., an anti-CXCLl l antibody or anti-sMICA antibody or antigen-binding portion thereof), and detecting the binding of the agent to CXCLl 1 or sMICA in the biological sample (e.g., serum).
- the threshold level for CXCLl 1 is about 35 pg/mL, as measured by bead assay, and/or the threshold level for sMICA is about 247 pg/mL, as measured by a bead- based immunoassay.
- the methods of the present invention can be applied to patients diagnosed with various types of cancer, e.g., melanoma, and/or wherein the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
- cancer e.g., melanoma
- the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
- the method includes administering one or more additional therapeutics and/or includes cancer patients that have previously failed at least one non-CTLA-4- based therapy, e.g., administration of IL-2, dacarbazine, or temozolomide.
- non-CTLA-4- based therapy e.g., administration of IL-2, dacarbazine, or temozolomide.
- the anti-CTLA-4 immunotherapy is an anti-CTLA-4 antibody, such as, ipilimumab or tremelimumab, which is administered to the patient at various dosages (e.g., at between 1 mg/kg to 10 mg/kg, at 3 mg/kg, or at 10 mg/kg) and intervals (e.g., every 1 to 4 weeks, every 3 weeks, 4 times, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times or more).
- various dosages e.g., at between 1 mg/kg to 10 mg/kg, at 3 mg/kg, or at 10 mg/kg
- intervals e.g., every 1 to 4 weeks, every 3 weeks, 4 times, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times or more.
- Figure 1 shows the results of the univariate analysis of biomarker effects on overall survival (OS) for patients from the phase 3 clinical trial.
- Hazard ratios (HRs) and confidence intervals (CIs) are shown for the association with overall survival of patients treated with ipilimumab (ipi) or gplOO.
- Cox proportional hazards regression was used for univariate analysis of biomarker effects on OS.
- HR is numerator vs. denominator.
- 13 were censored in the gplOO-treated group.
- Figures 5A-5D show Kaplan-Meier curves for OS according to pretreatment CXCL11 or sMICA status.
- Curves for OS obtained by applying selected cut-off points for CXCL11 (Figure 5A and Figure 5C) and sMICA (Figure 5B and Figure 5D) to the phase 3 trial cohort ( Figure 5A and Figure 5B) or the EACRI cohort ( Figure 5C and Figure 5D). Numbers of subjects at risk at each 10 month interval are listed below each graph. The difference in treatment effect
- Figures 6A-6F show Kaplan-Meier curves for overall survival over 40-50 months based on concentration of the specified biomarker in the phase 3 clinical trial.
- Figures 6A, 6C, and 6E represent the gplOO treated group.
- Figures 6B, 6D, and 6F correspond to the ipilimumab treated group.
- Figures 7A-7C are Kaplan-Meier plots depicting overall survival over 40 months based on concentration of the specified biomarker in the EACRI cohort.
- the present invention is based, at least in part, on the discovery that low baseline serum CXCL11 and sMICA levels are associated with improved overall survival in metastatic melanoma patients treated with a CTLA-4 antagonist, but not in patients treated with a "control" gplOO vaccine.
- the measurement of pretreatment serum CXCL11 and sMICA levels can thus identify patients most likely to benefit from (i.e., respond to) anti-CTLA-4 immunotherapy. Because certain melanoma patients fail to respond to anti-CTLA-4 immunotherapy, avoiding treatment of such refractory patients would reduce exposure to inefficient therapy, eliminate their risks for adverse effects, and lower overall costs of therapy.
- antibody as used to herein includes whole antibodies and any antigen binding fragments (i.e. , “antigen-binding portions") or single chains thereof.
- An “antibody” refers, in one embodiment, to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- VH heavy chain variable region
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- each light chain is comprised of a light chain variable region (abbreviated herein as V L ) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed
- CDR complementarity determining regions
- FR framework regions
- Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g. , effector cells) and the first component (Clq) of the classical complement system.
- Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (K D ) of 10 "5 to 10 "11 M or less. Any K D greater than about 10 "4 M is generally considered to indicate nonspecific binding.
- K D dissociation constant
- an antibody that "binds specifically" to an antigen refers to an antibody that binds to the antigen and substantially
- K assoc or "k a ", as used herein, is intended to refer to the association rate of a particular antibody- antigen interaction
- k ⁇ s or "k d ,” as used herein, is intended to refer to the dissociation rate of a particular antibody- antigen interaction
- K D is intended to refer to the dissociation constant, which is obtained from the ratio of k d to k a (i.e., k d /k a ) and is expressed as a molar concentration (M).
- KD values for antibodies can be determined using methods well established in the art. A preferred method for determining the K D of an antibody is by using surface plasmon resonance, preferably using a biosensor system such as a Biacore® system.
- An immunoglobulin may be from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM.
- the IgG isotype is divided in subclasses in certain species: IgGl, IgG2, IgG3 and IgG4 in humans, and IgGl, IgG2a, IgG2b and IgG3 in mice.
- Antibody includes, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human and nonhuman antibodies; wholly synthetic antibodies; and single chain antibodies.
- antigen-binding portion of an antibody refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen.
- fragments are, for example between about 8 and about 1500 amino acids in length, suitably between about 8 and about 745 amino acids in length, suitably about 8 to about 300, for example about 8 to about 200 amino acids, or about 10 to about 50 or 100 amino acids in length. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term "antigen- binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CHI domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., Nature 1989;341:544-6), which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker.
- CDR complementarity determining region
- the two domains of the Fv fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., Science 1988;242:423-6; and Huston et al., PNAS 1998;85:5879-83).
- single chain Fv single chain Fv
- Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
- Antigen- binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
- human monoclonal antibody refers to an antibody that displays a single binding specificity and affinity for a particular epitope or a composition of antibodies in which all antibodies display a single binding specificity and affinity for a particular epitope.
- human monoclonal antibody refers to an antibody or antibody composition that display(s) a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences.
- human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g. , a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g. , a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g. , from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e. , have at least 80% identity).
- a "human” antibody refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- the antibodies described herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
- a “humanized” antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen.
- a "humanized” antibody retains an antigenic specificity similar to that of the original antibody.
- a “chimeric antibody” refers to an antibody in which the variable regions are derived from one species (e.g., human variable regions) and the constant regions are derived from another species (e.g., mouse constant regions), such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody.
- Constant region sequences for various species are known in the art and could be readily obtained by the skilled artisan to generate chimeric antibodies.
- an “isolated antibody,” as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities.
- a “polypeptide” refers to a chain comprising at least two consecutively linked amino acid residues, with no upper limit on the length of the chain.
- One or more amino acid residues in the protein may contain a modification such as, but not limited to, glycosylation, phosphorylation or disulfide bond formation.
- a “protein” may comprise one or more polypeptides.
- cytotoxic T lymphocyte-associated antigen-4 As used herein, “cytotoxic T lymphocyte-associated antigen-4,” “CTLA-4,” “CTLA4,” “CTLA-4 antigen” and “CD152” are used interchangeably, and include variants, isoforms, species homologs of human CTLA-4, and analogs having at least one common epitope with CTLA-4 (see, e.g., Balzano, Int J Cancer Suppl 1992;7:28-32).
- CTLA-4 protein is intended to encompass full-length CTLA-4 protein, CTLA-4 protein fragments, CTLA-4 protein variants, and CTLA-4 fusion proteins (e.g., CTLA- 4/Fc fusion protein), which an anti-CTLA-4 antibody (e.g., ipilimumab) can bind.
- CTLA-4 antibody e.g., ipilimumab
- Ipilimumab refers to a fully human IgGl anti-CTLA-4 antibody that blocks the binding of CTLA-4 to CD38 and CD86 expressed on antigen presenting cells, thereby blocking the negative down-regulation of the immune responses elicited by the interaction between these molecules.
- Ipilimumab comprises the following heavy and light chain variable region sequences. ipilimumab VH
- Ipilimumab can also be referred to by its CAS Registry No. 477202-00-9, and is disclosed as antibody 10D1 in PCT Publication No. WO 01/14424, the content of which is herein incorporated by reference. As used herein, ipilimumab also is intended to encompass antibodies comprising the variable region or CDR sequences of ipilimumab.
- CXCLl 1 also known as interferon-inducible T cell a chemoattractant (I-TAC), H174, b-Rl, interferon- ⁇ inducible protein 9 (IP-9), small inducible cytokine B l l (SCYB 11), and SCYB9B, is a 94 amino acid polypeptide with the nucleotide and amino acid sequences (human) set forth in Genbank Accession No.
- CXCLl 1 is intended to encompass full-length CXCLl 1 protein, CXCLl 1 protein fragments, CXCLl 1 protein variants, and CXCLl 1 fusion proteins.
- CXCLl 1 is known to bind to two alternative receptors, CXCR3 and CXCR7 (Colvin et al., JBC 2004;279:30219-27; Burns et al., J Exp Med 2006;203:2201-13).
- CXCL11 High levels of CXCL11 are protective in patients with renal cell carcinoma (Kondo et al., Cancer Sci 2006;97:780-6), and low levels of CXCLl 1 are associated with poor prognosis in patients with gastric carcinoma (Pasini et al., Gastroenterol 2014;49: 1453-66). These reports suggest that low levels of CXCLl 1 may be detrimental in cancer patients and associated with poor prognosis.
- MICA immunoreceptor natural killer group 2, member D
- NVG2D immunoreceptor natural killer group 2D
- MICA is intended to encompass full-length MICA protein, MICA protein fragments (e.g., soluble MICA), MICA protein variants, various MICA alleles, and MICA fusion proteins.
- sMICA High levels of sMICA are found in many cancers, including hematopoietic malignancies, epithelial cancers, colorectal cancer, liver cancer, prostate cancer, and melanoma (Champsaur and Lanier, Immunological Reviews 2010;235:267-85). sMICA is generated through various mechanisms, such as shedding due to the activities of
- ADAM family of proteases e.g., ADAM10 and ADAM17
- thiol disulphide isomerases e.g., ERp5
- antagonist refers to any molecule that partially or fully inhibits or neutralizes a biological activity of a polypeptide, such as CXCLl 1 or soluble MICA (sMICA), or that partially or fully inhibits the transcription or translation of a nucleic acid encoding the polypeptide.
- exemplary antagonist molecules include, but are not limited to, antibodies, polypeptide fragments, oligopeptides, organic molecules (including small molecules), and nucleic acids (e.g., anti-sense nucleic acids).
- CXCLl 1 antagonist refers to an agent that inhibits CXCLl 1 activity, e.g., an agent that disrupts CXCLl 1 binding to its receptors CXCR3 and/or CXCR7, or an agent that reduces the protein or mRNA levels of CXCL11.
- the CXCL11 antagonist is an antibody.
- sMICA antagonists refers to an agent that inhibits sMICA activity, e.g., an agent that inhibits (partially or completely) sMICA binding to NKG2D, an agent that leads to reduced shedding of sMICA from MICA, an agent that inhibits MICA-induced NGKD downregulation and diminished NK cell cytotoxicity, or an agent that reduces the levels of sMICA.
- the sMICA antagonist is an antibody that binds to MICA (e.g., sMICA), such as an antibody described in WO2014/144791, the contents of which are herein incorporated by reference.
- the antibody binds to the alpha 3 domain of MICA, and thus does not block NKG2D receptor binding.
- small molecule refers to an agent with a molecular weight less than about 6 kDa, for example, less than about 2.5 kDa. Small molecules can be obtained from small chemical libraries, peptide libraries, or collections of natural products.
- immune response refers to a biological response within a vertebrate against foreign agents, which response protects the organism against these agents and diseases caused by them.
- An immune response is mediated by the action of a cell of the immune system (for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from the vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
- An immune reaction includes, e.g., activation or inhibition of a T cell, e.g., an effector T cell or a Th cell, such as a CD4+ or CD8+
- immunomodulator or “immunoregulator” refers to an agent, e.g., a component of a signaling pathway, that may be involved in modulating, regulating, or modifying an immune response.
- Modulating,” “regulating,” or “modifying” an immune response refers to any alteration in a cell of the immune system or in the activity of such cell (e.g., an effector T cell).
- modulation includes stimulation or suppression of the immune system which may be manifested by an increase or decrease in the number of various cell types, an increase or decrease in the activity of these cells, or any other changes which can occur within the immune system.
- Both inhibitory and stimulatory immunomodulators have been identified, some of which may have enhanced function in a tumor microenvironment.
- the immunomodulator is located on the surface of a T cell.
- An "immunomodulatory target” or “immunoregulatory target” is an immunomodulator that is targeted for binding by, and whose activity is altered by the binding of, a substance, agent, moiety, compound or molecule.
- Immunomodulatory targets include, for example, receptors on the surface of a cell
- immunomodulatory receptors and receptor ligands
- immunomodulatory ligands receptor ligands
- immunotherapy refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response.
- anti- CTLA-4 immunotherapy refers to the treatment of a subject afflicted with, or at risk of developing or suffering a recurrence of, a disease (e.g., cancer) by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response by administering an agent (e.g., an anti-CTLA-4 antibody such as ipilimumab) that modulates CTLA-4 signaling and results in, e.g., the induction and/or enhancement of T cell activation (e.g., increase in IL-2 and/or IFN- ⁇ production by T cells and/or increase in proliferation of T cells), depletion of regulatory T cells, etc.
- an agent e.g., an anti-CTLA-4 antibody such as ipilimumab
- T cell activation e.g., increase in IL-2 and/or IFN- ⁇ production by T cells and/or increase in proliferation of T cells
- depletion of regulatory T cells etc.
- potentiating an endogenous immune response means increasing the effectiveness or potency of an existing immune response in a subject. This increase in effectiveness and potency may be achieved, for example, by overcoming mechanisms that suppress the endogenous host immune response or by stimulating mechanisms that enhance the endogenous host immune response.
- cancer refers a broad group of diseases characterized by the
- Unregulated growth of abnormal cells in the body Unregulated cell division may result in the formation of malignant tumors or cells that invade neighboring tissues and may metastasize to distant parts of the body through the lymphatic system or bloodstream.
- lymphoma includes a lymphoma, leukemia, myeloma or a lymphoid malignancy, as well as a cancer of the spleen and the lymph nodes.
- exemplary lymphomas include both B cell lymphomas and T cell lymphomas.
- B-cell lymphomas include both Hodgkin's lymphomas and most non-Hodgkin's lymphomas.
- Non-limiting examples of B cell lymphomas include diffuse large B-cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma, small cell lymphocytic lymphoma (overlaps with chronic lymphocytic leukemia), mantle cell lymphoma (MCL), Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenstrom macroglobulinemia, nodal marginal zone B cell lymphoma, splenic marginal zone lymphoma, intravascular large B-cell lymphoma, primary effusion lymphoma, lymphomatoid granulomatosis.
- T cell lymphomas include extranodal T cell lymphoma, cutaneous T cell lymphomas, anaplastic large cell lymphoma, and angioimmunoblastic T cell lymphoma.
- Hematological malignancies also include leukemia, such as, but not limited to, secondary leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, and acute lymphoblastic leukemia.
- Hematological malignancies further include myelomas, such as, but not limited to, multiple myeloma and smoldering multiple myeloma.
- Other hematological and/or B cell- or T-cell-associated cancers are encompassed by the term hematological malignancy.
- Tumor refers to an abnormal mass of tissue resulting from excessive cell division that is uncontrolled and progressive. Tumors can be benign or malignant.
- patient includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- the term "subject” includes any human or non-human animal.
- the methods and compositions described herein can be used to treat a subject having cancer.
- non-human animal includes all vertebrates, e.g., mammals and non- mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc. Various aspects described herein are described in further detail in the following subsections.
- biological sample refers to cells (e.g., tumor cells, T cells, B cells or other), tissues (e.g., tumor), fluids (e.g., serum or plasma), and/or combination thereof isolated from a subject.
- cells e.g., tumor cells, T cells, B cells or other
- tissues e.g., tumor
- fluids e.g., serum or plasma
- control sample or “reference sample” as used herein refers to any clinically relevant control or reference sample, including, e.g., a sample from a healthy subject or a population of healthy subjects, or a sample from a patient treated with an agent that is different from the agent of interest.
- an intervention group comprises cancer patients treated with ipilimumab
- the control group comprises cancer patients treated with a gplOO vaccine.
- "normal,” when used in the context of the term “subject” or “patient,” refers to an individual or group of individuals who do not have a particular disease or condition (e.g., cancer), and is not suspected of having or being at risk for developing the disease or condition.
- biomarker refers to a distinctive biological or biologically derived indicator of a process, event or conditions.
- the biomarker is a gene or gene product (i.e., a polypeptide).
- predictive biomarker refers to a biomarker that can be used in advance of therapy to estimate the likelihood or predictability of response to a given therapeutic agent or class of therapeutic agents.
- the therapeutic agent is an anti-CTLA-4 immunotherapy, for example, an anti-CTLA-4 antibody.
- the predictive biomarker is CXCLl 1. In other embodiments, the predictive biomarker is sMICA.
- threshold level refers to a level of biomarker expression, above which a patient is predicted to respond to anti-CTLA-4 immunotherapy and below which a patient is predicted to be unresponsive to anti-CTLA-4 immunotherapy.
- the threshold level may be based on one or more compilations of data from patient samples that have received anti-CTLA-4 immunotherapy and determined to be responsive or unresponsive.
- the term "obtaining,” when used in reference to levels of CTLA-4 and/or sMICA, refers to the direct or indirect procurement of the levels of CTLA-4 and/or sMICA.
- the levels of CTLA-4 and/or sMICA can be directly measured by laboratory personnel.
- the levels of CTLA-4 and/or sMICA measured by laboratory personnel can be made available to at least one other party, such as a medical practitioner, as data in written or electronic format.
- a second party "obtains" the levels of CTLA-4 and/or sMICA by consulting the data.
- treat refers to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease.
- Prophylaxis refers to administration to a subject who does not have a disease, to prevent the disease from occurring or minimize its effects if it does.
- administering refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art.
- Preferred routes of administration for antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation.
- an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
- an effective dose or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve a desired effect.
- a “therapeutically effective amount” or “therapeutically effective dosage” of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- a “prophylactically effective amount” or a “prophylactically effective dosage” of a drug is an amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease.
- the ability of a therapeutic or prophylactic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
- a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
- a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects.
- a therapeutically effective amount or dosage of the drug completely inhibits cell growth or tumor growth, i.e., preferably inhibits cell growth or tumor growth by 100%.
- tumor regression may be observed and may continue for a period of at least about 20 days, more preferably at least about 40 days, or even more preferably at least about 60 days.
- a "refractory cancer” also known as a “resistant” cancer
- a “non-responder” is a subject who does not respond to treatment.
- a “responder” is a subject who responds to treatment (e.g.,
- a or “an” entity refers to one or more of that entity; for example, “a polynucleotide”, is understood to represent one or more polynucleotides.
- the terms “a” (or “an”), “one or more”, and “at least one” can be used interchangeably herein.
- kits for treating cancer patients comprising:
- methods for predicting the responsiveness of a cancer patient to anti-CTLA-4 immunotherapy comprising:
- the level of either CXCLl 1 or sMICA is used to select a cancer patient for anti-CTLA-4 immunotherapy or predict the responsiveness of a patient to anti-CTLA- 4 immunotherapy. In other embodiments, the levels of both CXCLl 1 and sMICA are used to determine whether a cancer patient will benefit from anti-CTLA-4 immunotherapy or predict the responsiveness of a patient to anti-CTLA-4 immunotherapy.
- elevated levels of CXCLl 1 and/or sMICA in a biological sample obtained from a cancer patient indicates the cancer patient is unlikely to respond to anti-CTLA-4 immunotherapy.
- a reduction in the level of CXCLl 1 and/or sMICA in a biological sample from a cancer patient, relative to the level of CXCLl 1 and/or sMICA in a normal control sample indicates the cancer patient is likely to respond to (i.e., is a candidate for) anti-CTLA-4 immunotherapy.
- a CXCLl 1 protein level less than about 35 pg/mL, and/or a sMICA protein level less than about 247 pg/mL is associated with response to anti-CTLA-4 immunotherapy.
- a method for selecting a patient for anti- CTLA-4 immunotherapy wherein, if the patient has a CXCLl 1 protein level less than about 35 pg/mL, and/or an sMICA protein level less than about 247 pg/mL, the patient is considered likely to respond to anti-CTLA-4 immunotherapy, and is thus selected for anti-CTLA-4 immunotherapy (e.g., treatment with ipilimumab or tremelimumab).
- the protein levels of CXCLl 1 and/or sMICA are measured in patient serum.
- the protein levels of CXCLl 1 and/or sMICA are determined using a bead-based assay.
- the threshold level of sMICA is between about 0 pg/mL to about 250 pg/mL, between about 25 pg/mL to about 250 pg/mL, between about 50 pg/mL to about 250 pg/mL, between about 75 pg/mL to about 250 pg/mL between about 100 pg/mL to about 250 pg/mL, between about 125 pg/mL to about 250 pg/mL between about 150 pg/mL to about 250 pg/mL, between about 175 pg/mL to about 250 pg/mL, between about 200 pg/mL to about 250 pg/mL, or between about 225 pg/mL to about 250 pg/mL, is selected for anti-CTLA-4 immunotherapy, or is predicted to be responsive to anti-CTLA-4 immunotherapy.
- control sample is obtained from an individual who does not have cancer, and is not suspected of being at risk of developing cancer.
- control sample can be pooled from at least one, such as at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least 10 healthy individuals or individuals who do not have or are not suspected of being at risk of developing cancer.
- methods of ordering the treatment of a cancer in a patient comprising:
- the measured values of CXCLl 1 and/or sMICA are recorded in writing or on a computer readable medium.
- the method may also involve communicating the measured value of CXCLl 1 and/or sMICA to the patient and/or medical practitioner who cares for the patient.
- a medical practitioner receives information regarding the levels of CXCLl 1 and/or sMICA from a first practitioner in order to make a determination of whether the patient is likely to be responsive to anti-CTLA-4 immunotherapy.
- the subject has a cancer selected from the group consisting of squamous cell carcinoma, small-cell lung cancer, non-small cell lung cancer, squamous non- small cell lung cancer (NSCLC), non squamous NSCLC, glioma, gastrointestinal cancer, renal cancer (e.g. clear cell carcinoma), ovarian cancer, liver cancer, colorectal cancer, endometrial cancer, kidney cancer (e.g., renal cell carcinoma (RCC)), prostate cancer (e.g.
- a cancer selected from the group consisting of squamous cell carcinoma, small-cell lung cancer, non-small cell lung cancer, squamous non- small cell lung cancer (NSCLC), non squamous NSCLC, glioma, gastrointestinal cancer, renal cancer (e.g. clear cell carcinoma), ovarian cancer, liver cancer, colorectal cancer, endometrial cancer, kidney cancer (e.g., renal cell carcinoma (RCC)), prostate cancer (e.g.
- prostate adenocarcinoma thyroid cancer
- neuroblastoma pancreatic cancer
- glioblastoma glioblastoma multiforme
- cervical cancer stomach cancer
- bladder cancer hepatoma
- breast cancer colon carcinoma
- head and neck cancer gastric cancer
- gastric cancer germ cell tumor
- pediatric sarcoma sinonasal natural killer
- melanoma e.g., metastatic malignant melanoma, such as cutaneous or intraocular malignant melanoma
- bone cancer skin cancer, uterine cancer, cancer of the anal region, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra
- lymphomas such as Hodgkin's lymphoma (HL), non-Hodgkin's lymphoma (NHL), B cell hematologic malignancy, e.g., B-cell lymphomas, T-cell lymphomas, lymphoplasmacytoid lymphoma, monocytoid B-cell lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, anaplastic (e.g., Ki 1+) large-cell lymphoma, adult T-cell lymphoma/leukemia, mantle cell lymphoma, angioimmunoblastic T-cell lymphoma, angiocentric lymphoma, intestinal T-cell lymphoma, primary mediastinal B-cell lymphoma, precursor T-lymphoblastic lymphoma, T- lymphoblastic; and lymphoma
- lymphomas such as Hodgkin's lymphoma (HL), non-Hodgkin's lymphoma
- the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
- the levels (protein or RNA) of CXCLl 1 and/or sMICA in a biological sample can be determined (measured) using any suitable method known in the art (see, e.g., Harlow and Lane (1988) Antibodies: A Laboratory Manual," Cold Spring Harbor Laboratory: Cold Spring Harbor, NY). In general, protein levels are determined by contacting a biological sample with an agent that binds to CXCLl 1 or sMICA, detecting the levels of CXCLl 1 or sMICA in the sample, and comparing the levels of CXCLl 1 or sMICA in the sample with the levels of CXCLl 1 or sMICA in a control sample.
- Non-limiting examples of binding agents that are suitable for determining the levels of CXCLl 1 or sMICA are monoclonal and polyclonal antibodies specific for CXCLl 1 or sMICA, as well as antigen-binding fragments thereof (Fab fragments, scFvs, etc).
- Antibodies can be from commercial sources. If unavailable from commercial sources, art-recognized methods can be used to generate monoclonal antibodies, polyclonal antibodies, and fragments thereof.
- Binding agents can be directly or indirectly labeled with a detectable moiety. Such moieties can facilitate the detection of CXCLl 1 and/or sMICA by allowing visualization of the complex formed between the binding agent and CXCLl 1 and/or sMICA in a biological sample. In some embodiments, the signal produced by the detectable moiety is measured and its intensity is proportional to the amount of CXCL11 and/or sMICA present in the sample being analyzed.
- Exemplary detectable moieties include luminescent labels, fluorescent labels, radiolabels (e.g., "Tc, 45 Ti, 112 In, m In, 3 H, 121 I, 125 I, 131 I, 14 C, 18 F, 36 C1, 55 Co, 58 Co, 51 Cr, 67 Cu, "Cu, 66 Ga, 68 Ga, 76 Br, 89 Zr, 35 S, 32 P, 90 Y, 13 N, 15 0, 211 At, 186 Re, 188 Re, 75 Se), enzymatic labels (e.g., horseradish peroxidase, alkaline phosphatase, glucose oxidase, urease, acetylchoiinetraiisferase, luciferase, and beta-galactosidase), epitope tags, chromophore labels, phosphorescent labels, photoaffinity molecules, ECL labels, dyes, biotin, haptens, and the like. Such labels are well known in the
- Attachment of the detectable label does not interfere with binding of the agent to CXCL11 and/or sMICA.
- the detection means is determined by the chosen label. Appearance of the label or its reaction products can be achieved using the naked eye, in the case where the label is particulate and accumulates at appropriate levels, or using instruments such as a
- spectrophotometer a luminometer, a fluorimeter, and the like, all in accordance with standard practice.
- methods of conjugating the labels result in linkages which are substantially (or nearly) non-immunogenic, e.g., peptide- (i.e. amide-), sulfide-, (sterically hindered), disulfide-, hydrazone-, and ether linkages.
- linkages are nearly non-immunogenic and show reasonable stability within serum (see e.g. Senter et al., Curr Opin Chem Biol 2009; 13 235- 44; WO 2009/059278; WO 95/17886).
- the binding agent e.g., antibody
- different conjugation strategies can be employed.
- the moiety is naturally occurring or recombinant of between 50 to 500 amino acids, there are standard procedures in text books describing the chemistry for synthesis of protein conjugates, which can be easily followed by the skilled artisan (see e.g. hackenberger et al., Angew Chem Int Ed Engl 2008;47: 10030-74).
- the reaction of a maleinimido moiety with a cysteine residue within the antibody or the moiety is used. This is an especially suited coupling chemistry in case e.g. a Fab or Fab'-fragment of an antibody is used.
- coupling to the C- terminal end of the antibody or moiety is performed.
- C-terminal modification of a protein e.g. of a Fab-fragment can e.g. be performed as described (Sunbul et al., Org Biomol Chem
- site specific reaction and covalent coupling is based on transforming a natural amino acid into an amino acid with a reactivity which is orthogonal to the reactivity of the other functional groups present.
- a specific cysteine within a rare sequence context can be enzymatically converted in an aldehyde (see Frese et al. ChemBioChem 2009;10:425-7).
- It is also possible to obtain a desired amino acid modification by utilizing the specific enzymatic reactivity of certain enzymes with a natural amino acid in a given sequence context see, e.g., Taki et al., Prot Eng Des Sel 2004;17: 119-26; Gautier et al. Chem Biol 2008;15: 128-36; Bordusa et al., Bioorganic Chemistry (2004) 389-403).
- Site specific reaction and covalent coupling can also be achieved by the selective reaction of terminal amino acids with appropriate modifying reagents.
- EP 1 074 563 describes a conjugation method which is based on the faster reaction of a cysteine within a stretch of negatively charged amino acids with a cysteine located in a stretch of positively charged amino acids.
- the moiety may also be a synthetic peptide or peptide mimic.
- a polypeptide is chemically synthesized, amino acids with orthogonal chemical reactivity can be incorporated during such synthesis (see, e.g., de Graaf et al., Bioconjug Chem 2009;20: 1281-95). Since a great variety of orthogonal functional groups is at stake and can be introduced into a synthetic peptide, conjugation of such peptide to a linker is standard chemistry.
- the detectable label is indirectly conjugated to the antibody.
- the antibody can be conjugated to biotin, and the label can be conjugated to avidin using methods well known in the art.
- an unlabeled antibody is detected using a labeled antibody which binds to the unlabeled antibody.
- the labeled antibody that is used for detection is labeled with any of the labels set forth above.
- binding agents can be immobilized on a support or carrier, such as beads, latex particles, magnetic particles, microtiter plate well, cuvette, and the like).
- a support or carrier such as beads, latex particles, magnetic particles, microtiter plate well, cuvette, and the like.
- exemplary carrier or support materials include agarose, cellulose, nitrocellulose, dextran, Sephadex, Sepharose, liposomes, carboxymethyl cellulose, polyacrylamides, polystyrene, gabbros, filter paper, magnetite, ion-exchange resin, plastic film, plastic tube, glass, polyamine-methyl vinyl- ether-maleic acid copolymer, amino acid copolymer, nylon, silk, and the like.
- the methods used to determine CXCL11 and/or sMICA levels (protein or mRNA) in a biological sample can be qualitative, semi-quantitative, or quantitative.
- Art-recognized antibody-based methods for detecting protein levels in biological samples include, but are not limited to, enzyme-linked immunosorbent assay (ELISA), radioimmunoassays,
- ECL electrochemiluninescence
- Methods for determining CXCL11 and/or sMICA levels in a biological sample may include control samples (negative and positive controls).
- a negative control sample may be a sample containing no CXCL11 and/or sMICA protein
- a positive controls sample is a sample containing CXCL11 and/or sMICA protein.
- a bead-based immunoassay is used to measure CXCL11 and/or sMICA protein levels. Bead-based immunoassays allow for the quantification of multiple proteins simultaneously.
- a bead-based immunoassays involves the addition of color-coded beads that are precoated with an analyte-specific capture antibody for the target of interest (e.g., CXCL11 and/or sMICA) to a biological sample. This is followed by the addition of biotinylated detection antibody specific for the target of interest, thereby forming an antibody- antigen sandwich.
- an analyte-specific capture antibody for the target of interest e.g., CXCL11 and/or sMICA
- Phycoerythrin-conjugated streptavidin is then added and the beads are read on a dual-laser flow-based detection instrument (e.g., Luminex 200TM or Bio-Rad ® Bio-Plex ® analyzer).
- a dual-laser flow-based detection instrument e.g., Luminex 200TM or Bio-Rad ® Bio-Plex ® analyzer.
- rndsystems.com resources/technical/luminex-bead-based-assay-principle.
- Bead-based immunoassays are commercially available from, e.g., R&D Systems (Luminex ® Bead-based Multiplex Assay) and BD Biosciences (BD Cytometric Bead Array).
- Methods for detecting and measuring protein expression can be performed in formats that allow for rapid preparation, processing, and analysis of multiple samples, e.g., through the use of multi-well assay plates or arrays.
- the biological sample is whole blood. In other embodiments, the biological sample is serum. Additional non-limiting examples of biological samples are saliva, sputum, cerebrospinal fluid, urine, tears, or mucus. Biological samples for use in the methods described herein can be fresh or frozen. In some embodiments, CXCL11 and/or sMICA levels are determined from a combination of two or more, such as three, four, five, or six, different types of biological samples.
- Bio samples can be obtained using any method known in the art, for example, blood collection followed by serum or plasma preparation, lavage, fine needle aspiration, swab, and phlebotomy.
- biological samples are obtained from bone marrow.
- the patient is treated with an anti-CTLA-4 immunotherapy, e.g., a therapeutic anti-CTLA-4 antibody.
- an anti-CTLA-4 immunotherapy e.g., a therapeutic anti-CTLA-4 antibody.
- the patient has failed at least one prior therapy (e.g., a therapy other than an anti-CTLA4 immunotherapy).
- a therapy other than an anti-CTLA4 immunotherapy e.g., IL-2 therapy.
- the patient has failed dacarbazine therapy.
- the patient has failed temozolomide therapy.
- an anti-CTLA-4 immunotherapy e.g., a CTLA-4 antagonist that increases IL-2, increases IFN- ⁇ production by T cells, and/or increases the proliferation of T cells and/or depletion of regulatory T cells.
- the anti-CTLA-4 immunotherapy comprises administering an anti- CTLA-4 antibody, or an antigen-binding portion thereof.
- the anti-CTLA-4 antibody is ipilimumab. In another embodiment, the anti-CTLA-4 antibody is tremelimumab.
- Also provided herein are methods for treating cancer in a patient comprising:
- the patient has metastatic melanoma, and is treated with ipilimumab or tremelimumab.
- the cancer patient is administered a CXCLl 1 and/or sMICA antagonist if the level of CXCLl 1 is above about 35 pg/mL and/or the level of sMICA is above about 247 pg/mL.
- the CXCLl 1 antagonist and/or sMICA antagonist inhibits the activity of CXCLl 1 and/or sMICA. In other embodiments, the CXCLl 1 antagonist and/or sMICA antagonist reduces the levels of CXCLl 1 and/or sMICA.
- a cancer patient determined to have levels of CXCLl 1 and/or sMICA that are increased relative to a healthy individual (or population of healthy individuals) is administered a CXCLl 1 antagonist and/or sMICA antagonist, and further administered an anti- CTLA-4 immunotherapy (e.g., ipilimumab or tremelimumab).
- a CXCLl 1 antagonist and/or sMICA antagonist e.g., ipilimumab or tremelimumab.
- the cancer patient is administered an anti-CTLA-4
- the CXCLl 1 antagonist and/or sMICA antagonist is administered concurrently with the anti-CTLA-4 immunotherapy. In other embodiments, the CXCLl 1 antagonist and/or sMICA antagonist is administered separately (e.g., sequentially) with the anti- CTLA-4 immunotherapy.
- Antagonists of CXCLl 1 and sMICA include, but are not limited to, small molecules, nucleic acids or nucleic acid analogs, proteins, peptides, oligopeptides, peptidomimetics, or a macromolecule that is not a nucleic acid or protein.
- Such molecules include, for example, peptide nucleic acid inhibitors, locked nucleic acid inhibitors, small interfering RNA, double stranded RNA, antisense compounds, L-RNA aptamers, Spiegelmers, RNA aptamers, organic molecules, proteins, protein fragments, oligopeptides, antibodies, and non-antibody scaffold proteins (e.g., transferrin, human tenth fibronectin type III domain, Z domain of S.
- non-antibody scaffold proteins e.g., transferrin, human tenth fibronectin type III domain, Z domain of S.
- the CXCL11 antagonist partially or completely blocks the interaction between CXCL11 and CXCR3 and/or CXCR7.
- the CXCL11 antagonist is an antibody that specifically binds to CXCL11 and partially or completely blocks the interaction between CXCL11 and CXCR3 and/or CXCR7.
- the antibody binds to CXCL 11 with a K D of 5xl0 -8 M or less, for example, lxlO -8 M or less, lxlO -9 M or less, lxlO _10 M or less, or lxlO -11 M or less.
- the CXCL11 antagonist partially or completely blocks the CXCL11 -mediated internalization of CXCR3 and/or CXCR7. Exemplary CXCL11 antagonists are described in, e.g., WO2003/106488 and WO2008/077945.
- the sMICA antagonist is an agent that reduces the level of sMICA. In other embodiments, the sMICA antagonist partially or completely blocks the interaction between sMICA and NKG2D. In one embodiment, the sMICA antagonist is an antibody that specifically binds to MICA (e.g., sMICA) and partially or completely blocks the interaction between sMICA and NKG2D. In certain embodiments, the antibody binds to MICA (e.g., sMICA) with a K D of 5xl0 ⁇ 8 M or less, for example, lxlO "8 M or less, lxlO "9 M or less, lxlO "10 M or less, or lxlO -11 M or less.
- MICA e.g., sMICA
- the sMICA antagonist partially or completely blocks the sMICA-mediated NKG2D internalization. In another embodiment, the sMICA antagonist partially or completely prevents shedding of sMICA from MICA. In a further embodiment, the antibody binds to the alpha 3 domain of MICA, and thus does not block
- MICA MICA
- sMICA sMICA
- any of the anti- CTLA-4 antibodies disclosed in WO2013/173223 may also be used.
- the anti-CTLA-4 antibody binds to human CTLA-4 with a —8
- K D of 5x10 M or less, for example, lxl0 "8 M or less, lxlO "9 M or less, lxl0 "10 M or less, or lxlO "11 M or less.
- methods for screening agents that bind to CXCL11 or sMICA For example, chemical libraries, peptide libraries, and or collections of natural products can be screened, using methods well-known in the art, for agents that bind to CXCL11 or sMICA.
- rational drug design is conducted based on the use of crystal or solution structural information on CXCL11 or sMICA.
- CXCL11 or sMICA antagonists can be prepared by any known procedure in the art, including recombinant DNA-related technologies, and chemical synthesis technologies.
- Agents identified to bind to CXCL11 or sMICA can be further tested for antagonist activity using art-recognized methods. Such methods include assays to determine whether the candidate CXCL11 or sMICA antagonist blocks the binding of CXCL11 to CXCR3 and/or CXCR7, or sMICA to NKG2D.
- a candidate CXCL11 antagonist is tested for its ability to reduce CXCR3 internalization and/or chemotaxis, as described in, e.g., Sauty et al., J Imunol 2001;167:7084-93; Colvin et al., JBC 204;279:30219-27).
- a candidate sMICA antagonist is tested for its ability to reduce NKG2D internalization and/or NK cytotoxicity using the methods described in, e.g., Groh et al., Nature 2002;419:734-8 and Ashiru et al., Cancer Res 2010:70:481-9).
- combination therapies for treating a cancer patient determined to have levels of CXCL11 and/or sMICA that are above the levels measured in healthy individuals (e.g., those without cancer and those who are not suspected as being at risk of developing cancer).
- the level of CXCL11 in the cancer patient e.g., in patient serum
- the level of sMICA is above about 247 pg/mL, as assessed, e.g., using a bead-based immunoassay.
- the patient is administered an anti-CTLA-4 immunotherapy (e.g., ipilimumab or tremelimumab) and a CXCL11 antagonist and/or sMICA antagonist.
- an anti-CTLA-4 immunotherapy e.g., ipilimumab or tremelimumab
- CXCL11 antagonist and/or sMICA antagonist e.g., ipilimumab or tremelimumab
- the patient is administered a CXCL11 antagonist and/or sMICA antagonist.
- either of the above combination therapies includes administration of one or more additional therapeutic agents (e.g., simultaneous, separate, or sequential administration). Exemplary therapeutic agents administered in these combinations are described below.
- the therapeutic agent is one or more of the following agents:
- An antagonist (inhibitor or blocking agent) of a protein that inhibits T cell activation e.g., immune checkpoint inhibitors
- a protein that inhibits T cell activation e.g., immune checkpoint inhibitors
- CTLA-4, PD-1, PD- Ll, PD-L2, and LAG-3 as described above, and any of the following proteins: TIM-3, Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, CD 113, GPR56, VISTA, B7-H3, B7-H4, 2B4, CD48, GARP, PD1H, LAIR1, TIM-1, and TIM-4; and/or
- An agonist of a protein that stimulates T cell activation such as B7-1, B7-2,
- CD28 4-1BB (CD137), 4-1BBL, GITR, ICOS, ICOS-L, OX40, OX40L, CD70, CD27, CD40, DR3 and CD28H.
- agents that modulate one of the above proteins include: YervoyTM
- Suitable anti-CTLA4 antibodies for use in combination therapies include an anti-CTLA-4 antibody described in any of the following publications: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156; Hurwitz et al., PNAS 1998;95: 10067-71; Camacho et al., Clin Oncology 2004;22:Abstract No. 2505 (antibody CP-675206); WO2013/173223, US2014/0105914, and Mokyr et al., Cancer Res 1998;58:5301-4.
- Suitable PD-1 antagonists for use in combination therapies include, for example, a PD-1- Fc fusion protein, such as AMP-244.
- the PD-1 antagonist is an anti-PD-1 or anti-PD-Ll antibody.
- An exemplary anti-PD-1 antibody is nivolumab (BMS-936558) or an antibody that comprises the CDRs or variable regions of one of antibodies 17D8, 2D3, 4H1, 5C4, 7D3, 5F4 and 4A11 described in WO 2006/121168.
- an anti-PDl antibody is MK-3475 (Lambrolizumab) described in WO2012/145493; and AMP-514 described in WO 2012/145493.
- PD-1 antibodies and other PD-1 inhibitors include those described in WO 2009/014708, WO 03/099196, WO 2009/114335, WO 2011/066389, WO 2011/161699, WO 2012/145493, U.S. Patent Nos. 7,635,757 and 8,217,149, and U.S. Patent Publication No. 2009/0317368. Any of the anti-PD-1 antibodies disclosed in WO2013/173223 may also be used. An anti-PD-1 antibody that competes for binding with, and/or binds to the same epitope on PD-1 as, as one of these antibodies may also be used in combination treatments.
- Another approach to target the PD-1 receptor is the recombinant protein composed of the extracellular domain of PD-L2 (B7-DC) fused to the Fc portion of IgGl, called AMP-224.
- Exemplary PD-L1 antagonists suitable for use in combination therapies described herein include the anti-PD-Ll antibody BMS-936559 (referred to as 12A4 in WO 2007/005874 and US Patent No. 7,943,743), or an antibody that comprises the CDRs or variable regions of 3G10, 12A4, 10A5, 5F8, 10H10, IB 12, 7H1, 11E6, 12B7 and 13G4, which are described in PCT Publication WO 07/005874 and US Patent No. 7,943,743.
- an anti-PD-Ll antibody is MEDI4736 (also known as Anti-B7-Hl), MPDL3280A (also known as RG7446), MSB0010718C (WO2013/79174), or rHigM12B7. Any of the anti-PD-Ll antibodies disclosed in WO2013/173223, WO2011/066389, WO2012/145493, U.S. Patent Nos. 7,635,757 and
- Anti-PD-Ll antibodies that compete with and/or bind to the same epitope as that of any of these antibodies may also be used in combination treatments.
- anti-LAG3 antibodies suitable for use in combination therapies include antibodies comprising the CDRs or variable regions of antibodies 25F7, 26H10, 25E3, 8B7, 11F2 or 17E5, which are described in U.S. Patent Publication No. US2011/0150892,
- an anti-LAG-3 antibody is BMS- 986016.
- Other art recognized anti-LAG-3 antibodies that can be used include IMP731 and IMP- 321, described in US 2011/007023, WO08/132601, and WO09/44273.
- Exemplary anti-OX40 antibodies suitable for use in combination therapies include, e.g., MEDI-6383, MEDI-6469 or MOXR0916 (RG7888; WO06/029879).
- Exemplary anti-CD137 (4-1BB) antibodies suitable for use in combination therapies include urelumab or PF-05082566 (WO 12/32433).
- Suitable CD40 agonists that can be used in combination therapies include, for example, lucatumumab (HCD122), dacetuzumab (SGN-40), CP-870,893 or Chi Lob 7/4.
- Suitable anti-GITR antibodies that can be used in combination therapies include, e.g., an antibody having the CDR sequences of 6C8, e.g., a humanized antibody having the CDRs of 6C8, as described, e.g., in WO2006/ 105021; an antibody comprising the CDRs of an anti-GITR antibody described in WO2011/028683; an antibody comprising the CDRs of an anti-GITR antibody described in JP2008278814, or an antibody comprising the CDRs of an anti-GITR antibody described in WO2015/031667.
- an antibody having the CDR sequences of 6C8 e.g., a humanized antibody having the CDRs of 6C8, as described, e.g., in WO2006/ 105021
- an antibody comprising the CDRs of an anti-GITR antibody described in WO2011/028683 an antibody comprising the CDRs of an anti-GITR antibody described in JP2008278814, or an antibody comprising the
- Other therapeutic agents include antagonists of inhibitory receptors on NK cells or agonists of activating receptors on NK cells (e.g., antagonists of KIR such as lirilumab).
- the therapeutic agent is an (i) antagonist (or inhibitor or blocking agent) of a protein of the IgSF family or B7 family or the TNF family that inhibit T cell activation or an antagonist of a cytokine that inhibits T cell activation (e.g., IL-6, IL-10, TGF- ⁇ , VEGF; "immunosuppressive cytokines”) and/or (ii) agonist of stimulatory receptors of the IgSF family, B7 family or the TNF family or of cytokines that stimulate T cell activation, for stimulating an immune response, e.g., for treating proliferative diseases, such as cancer.
- a cytokine that inhibits T cell activation
- a cytokine that inhibits T cell activation e.g., IL-6, IL-10, TGF- ⁇ , VEGF; "immunosuppressive cytokines”
- a cytokine that inhibits T cell activation
- agents suitable for use in combination therapies include agents that inhibit or deplete macrophages or monocytes, including but not limited to CSF-IR antagonists such as CSF-IR antagonist antibodies including RG7155 (WOl l/70024, WOl l/107553, WOl l/131407, W013/87699, W013/119716, WO13/132044) or FPA-008 (WOl 1/140249; W013169264;
- Additional therapeutic agents include those that inhibit TGF- ⁇ signaling, such as GC1008, LY2157299, TEW7197, or IMC-TR1.
- TLR2/4 agonist e.g., Bacillus Calmette-Guerin
- TLR7 agonist e.g., Hiltonol or Imiquimod
- TLR7/8 agonist e.g., Resiquimod
- TLR9 agonist e.g., CpG7909
- Additional agents are those that enhance tumor antigen presentation, e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).
- therapies that may be used in combination therapies include those that deplete or block Treg cells, e.g., an agent that specifically binds to CD25.
- Another agent for use in combination therapy is an agent that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase.
- IDO indoleamine dioxigenase
- dioxigenase dioxigenase
- arginase arginase
- nitric oxide synthetase nitric oxide synthetase
- Another class of agents for use in combination therapy includes agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor.
- Yet another agent for use in combination therapy includes an IDO antagonist, such as INCB-024360 (WO2006/122150, WO07/75598, WO08/36653, WO08/36642), indoximod, NLG-919 (WO09/73620, WO09/1156652, WOl 1/56652, W012/142237) or F001287.
- IDO antagonist such as INCB-024360 (WO2006/122150, WO07/75598, WO08/36653, WO08/36642), indoximod, NLG-919 (WO09/73620, WO09/1156652, WOl 1/56652, W012/142237) or F001287.
- therapies for use in combination include those that reverse/prevent T cell anergy or exhaustion and therapies that trigger an innate immune activation and/or inflammation at a tumor site.
- the combination therapies disclosed herein may include one or more immuno-oncology agents, and may be, e.g., combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: a therapy that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); a therapy that inhibits negative immune regulation e.g., by inhibiting CTLA-4 and/or PD1/PD-L1/PD-L2 pathway and/or depleting or blocking Tregs or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD- 137, OX-40, and/or GITR pathway and/or stimulate T cell effector function; a therapy that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits Tregs, such as Tregs in the tumor, e.g.
- Further therapeutic agents which can be included in the combination therapies described herein include one or more of agonistic agents that ligate positive costimulatory receptors, blocking agents that attenuate signaling through inhibitory receptors, antagonists, and one or more agents that increase systemically the frequency of anti-tumor T cells, agents that overcome distinct immune suppressive pathways within the tumor microenvironment (e.g., block inhibitory receptor engagement (e.g., PD-Ll/PD-1 interactions), deplete or inhibit Tregs (e.g., using an anti-CD25 monoclonal antibody (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion), inhibit metabolic enzymes such as IDO, or reverse/prevent T cell anergy or exhaustion) and agents that trigger innate immune activation and/or inflammation at tumor sites.
- agonistic agents that ligate positive costimulatory receptors e.g., blocking agents that attenuate signaling through inhibitory receptors, antagonists, and one or more
- the combination therapies disclosed herein can be used with irradiation, chemotherapy (e.g., using camptothecin (CPT-11), 5-fluorouracil (5-FU), cisplatin, doxorubicin, irinotecan, paclitaxel, gemcitabine, cisplatin, paclitaxel, carboplatin-paclitaxel (Taxol), doxorubicin, 5-fu, or camptothecin + apo21/TRAIL (a 6X combo)), one or more proteasome inhibitors (e.g., bortezomib or MG132), one or more Bcl-2 inhibitors (e.g., BH3I-2' (bcl-xl inhibitor), indoleamine dioxygenase-1 inhibitor (e.g., INCB24360, indoximod, NLG-919, or F001287), AT-101 (R-(-)-gossypol derivative), ABT-2
- chemotherapy
- c-FLIP cellular FLICE-inhibitory protein modulators
- PPARy peroxisome proliferator-activated receptor ⁇
- 5809354 or 5569100 kinase inhibitors
- Sorafenib kinase inhibitors
- Trastuzumab Cetuximab
- Temsirolimus mTOR inhibitors such as rapamycin and temsirolimus, Bortezomib
- JAK2 inhibitors HSP90 inhibitors
- PI3K- AKT inhibitors Lenalildomide
- GSK3P inhibitors IAP inhibitors and/or genotoxic drugs.
- one or more anti-proliferative cytotoxic agents can be used in the combination therapies.
- Classes of compounds that may be used as anti-proliferative cytotoxic agents include, but are not limited to, the following: Alkylating agents (including, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): Uracil mustard, Chlormethine,
- Cyclophosphamide (CYTOXANTM) fosfamide, Melphalan, Chlorambucil, Pipobroman,
- Triethylenemelamine Triethylenethiophosphoramine, Busulfan, Carmustine, Lomustine,
- Antimetabolites including, without limitation, folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors: Methotrexate, 5-Fluorouracil, Floxuridine, Cytarabine, 6-Mercaptopurine, 6-Thioguanine, Fludarabine phosphate, Pentostatine, and
- Anti-proliferative agents suitable for use in the combination therapies include, without limitation, taxanes, paclitaxel (paclitaxel is commercially available as TAXOLTM), docetaxel, discodermolide (DDM), dictyostatin (DCT), Peloruside A, epothilones, epothilone A, epothilone B, epothilone C, epothilone D, epothilone E, epothilone F, furanoepothilone D, desoxyepothilone Bl, [17]-dehydrodesoxyepothilone B, [18]dehydrodesoxyepothilones B, C12,13-cyclopropyl- epothilone A, C6-C8 bridged epothilone A, trans-9,10-dehydroepothilone D, cis-9,10- dehydroepothilone D, 16-desmethylepoth
- hormones and steroids include synthetic analogs, such as 17a-Ethinylestradiol, Diethylstilbestrol, Testosterone, Prednisone, Fluoxymesterone, Dromostanolone propionate, Testolactone,
- Megestrolacetate Methylprednisolone, Methyl-testosterone, Prednisolone, Triamcinolone, Chlorotrianisene, Hydroxyprogesterone, Aminoglutethimide, Estramustine,
- Medroxyprogesteroneacetate, Leuprolide, Flutamide, Toremifene, ZOLADEXTM can also be administered to the patient.
- other agents used in the modulation of tumor growth or metastasis in a clinical setting such as antimimetics, can also be administered as desired.
- chemotherapeutic agents are known to those skilled in the art. In addition, their administration is described in the standard literature. For example, the administration of many of the chemotherapeutic agents is described in the Physicians' Desk Reference (PDR), e.g., 1996 edition (Medical Economics Company, Montvale, N.J. 07645-1742, USA); the disclosure of which is incorporated herein by reference.
- PDR Physicians' Desk Reference
- the chemotherapeutic agent(s) and/or radiation therapy can be administered according to therapeutic protocols well known in the art. It will be apparent to those skilled in the art that the administration of the chemotherapeutic agent(s) and/or radiation therapy can be varied depending on the disease being treated and the known effects of the chemotherapeutic agent(s) and/or radiation therapy on that disease. Also, in accordance with the knowledge of the skilled clinician, the therapeutic protocols (e.g., dosage amounts and times of administration) can be varied in view of the observed effects of the administered therapeutic agents on the patient, and in view of the observed responses of the disease to the administered therapeutic agents.
- the therapeutic protocols e.g., dosage amounts and times of administration
- compositions provided herein include one or more therapeutic agents selected from a anti-CTLA-4 immunotherapeutic (e.g., antibody), a CXCL11 antagonist, and/or a sMICA antagonist, optionally formulated together with a pharmaceutically acceptable carrier.
- a anti-CTLA-4 immunotherapeutic e.g., antibody
- CXCL11 antagonist e.g., CXCL11 antagonist
- a sMICA antagonist e.g., sMICA antagonist
- compositions may include additional therapeutic agents, as discussed above.
- the composition can include an CXCL11 antagonist, sMICA antagonist, and/or anti- CTLA-4 immunotherapy, combined with at least one other anti-cancer and/or T-cell stimulating (e.g., activating) agent.
- compositions includes other compounds, drugs, and/or agents used for the treatment of cancer.
- compounds, drugs, and/or agents can include, for example, chemotherapy drugs, small molecule drugs, or antibodies that stimulate the immune response to a given cancer.
- pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the carrier is suitable for oral, intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g. , by injection or infusion).
- the active compound may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
- compositions described herein may include one or more
- a "pharmaceutically acceptable salt” refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g. , Berge, S.M., et al. (1977) J. Pharm. Sci. 66: 1-19).
- compositions also may include a pharmaceutically acceptable antioxidant, such as a water soluble antioxidant, oil- soluble antioxidant, or metal chelating agent.
- a pharmaceutically acceptable antioxidant such as a water soluble antioxidant, oil- soluble antioxidant, or metal chelating agent.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions may also contain an effective amount of an adjuvant, preservative, wetting agent, emulsifying agent, and/or dispersing agent.
- an "effective amount" of a preservative refers to an amount sufficient to prevent the active ingredient from degrading, relative to the active ingredient in the absence of a preservative, for a certain duration (e.g., at least 2 weeks, such as at least 3 weeks, at least 1 month, at least 2 months, at least 4 months, at least 6 months, at least 1 year, or at least 2 years).
- Prevention of presence of microorganisms may be ensured both by sterilization procedures, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like.
- isotonic agents such as sugars, sodium chloride, and the like, are included in the compositions.
- prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions described herein is contemplated.
- composition may comprise a preservative or may be devoid of a preservative.
- Supplementary active compounds can be incorporated into the compositions.
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated herein.
- the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration.
- the amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred per cent, this amount will range from about 0.01 per cent to about ninety-nine percent of active ingredient, preferably from about 0.1 per cent to about 70 per cent, most preferably from about 1 per cent to about 30 per cent of active ingredient in combination with a pharmaceutically acceptable carrier.
- Dosage regimens are adjusted to provide the optimum desired response (e.g. , a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms described herein are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
- the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 or 10 mg/kg, of the host body weight.
- dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1- 10 mg/kg.
- An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months.
- the CXCL11 antagonist, sMICA antagonist, and/or anti-CTLA-4 immunotherapy may be administered at a flat dose (flat dose regimen).
- the antagonist is an antibody
- two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated.
- Antibodies are typically administered on multiple occasions. Intervals between single dosages can be, for example, weekly, monthly, every three months or yearly. Intervals can also be irregular as indicated by measuring blood levels of antibody to the target antigen in the patient.
- the dosage is adjusted to achieve a plasma antibody concentration of about 1- 1000 ⁇ g/ml, and in particular embodiments, about 25-300 ⁇ g/ml.
- the CXCL11 antagonist, sMICA antagonist, and/or anti-CTLA-4 immunotherapy is administered as a sustained release formulation, in which case less frequent administration is required.
- Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies.
- the dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
- compositions may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of
- a "therapeutically effective dosage" of a CXCL11 antagonist, sMICA antagonist, and/or anti-CTLA-4 immunotherapy preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction.
- a therapeutically effective dose preferably results in increased survival (e.g., increased overall survival), and/or prevention of further deterioration of physical symptoms associated with cancer.
- Symptoms of cancer are well-known in the art and include, for example, unusual mole features, a change in the appearance of a mole, including asymmetry, border, color and/or diameter, a newly pigmented skin area, an abnormal mole, darkened area under nail, breast lumps, nipple changes, breast cysts, breast pain, death, weight loss, weakness, excessive fatigue, difficulty eating, loss of appetite, chronic cough, worsening breathlessness, coughing up blood, blood in the urine, blood in stool, nausea, vomiting, liver metastases, lung metastases, bone metastases, abdominal fullness, bloating, fluid in peritoneal cavity, vaginal bleeding, constipation, abdominal distension, perforation of colon, acute peritonitis (infection, fever, pain), pain, vomiting blood, heavy sweating, fever, high blood pressure, anemia, diarrhea, jaundice, dizziness, chills, muscle spasms, colon metastases, lung metastases, bladder metastases, liver metastases, bone metasta
- a therapeutically effective dose may prevent or delay onset of cancer, such as may be desired when early or preliminary signs of the disease are present.
- Laboratory tests utilized in the diagnosis of cancer include chemistries, hematology, serology, and radiology. Accordingly, any clinical or biochemical assay that monitors any of the foregoing may be used to determine whether a particular treatment is a therapeutically effective dose for treating cancer.
- One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
- composition described herein can be administered via one or more routes of
- routes and/or mode of administration will vary depending upon the desired results.
- Preferred routes of administration for antibodies described herein include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- parenteral administration means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- the active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
- Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen,
- compositions can be administered with medical devices known in the art.
- a therapeutic composition described herein can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Patent Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or
- Examples of well-known implants and modules include: U.S. Patent No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Patent No. 4,486,194, which discloses a therapeutic device for administering medicants through the skin; U.S. Patent No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Patent No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery;
- kits which include one or more agents for detecting and/or determining levels of CXCL1 and/or sMICA, optionally in combination with one or more therapeutic agents (e.g., anti-CTLA-4 immunotherapies and/or CXCL11 antagonists and/or sMICA antagonists), and instructions for use.
- the kit comprises agents that bind to and detect CXCL11 and/or bind to and detect sMICA.
- the binding agent is an antibody, or antigen-binding portion thereof.
- kits may comprise at least one additional reagent.
- the kits may comprise buffers, stabilizers, substrates, detection reagents, and/or cofactors required for the assay.
- the binding agent and, optionally the reagents are suitably aliquoted.
- the kit comprises a means for obtaining the biological sample from a cancer patient.
- Such means can comprise, for example, reagents that can be used to obtain fluid or tissue sample from the cancer patient.
- pretreatment sera from treatment (ipilimumab) and "active control" (gplOO vaccine) patients from the phase 3 clinical trial of ipilimumab were analyzed for a variety of factors and their levels were correlated with OS.
- Candidate biomarkers were selected and each analyte was assessed in univariate and multivariate models for correlation with OS.
- Correlative biomarkers identified in the initial screen were further validated by testing sera from an independent cohort of ipilimumab-treated patients.
- ipilimumab Detailed information regarding the phase 3 clinical trial of ipilimumab (NCT00094653) can be found in Hodi et al., NEJM 2010;363:711-23.
- Patients with metastatic melanoma having failed at least one prior therapy that may have included interleukin-2 (IL-2), dacarbazine, and/or temozolomide were enrolled, excluding those with ocular melanoma. All patients were HLA- A*0201 + as the restricting element for the gplOO peptides employed. All ipilimumab-treated patients received ipilimumab alone at 3 mg/kg every 3 weeks for 4 treatments.
- IL-2 interleukin-2
- dacarbazine dacarbazine
- temozolomide temozolomide
- gplOO group patients received two peptides (lmg each), injected subcutaneously as an emulsion with incomplete Freund's adjuvant (Montanide ISA-51). Peptide injections were given immediately after a 90-minute intravenous infusion of placebo. Tumor burden was assessed by the treating physician.
- Serum samples were also obtained from patients treated on an expanded access program at the Earle A. Chiles Research Institute (EACRI cohort). Detailed information regarding this Compassionate Use Trial for Unresectable Melanoma with Ipilimumab is available at
- ClinicalTrials.gov under the identifier NCT00495066. All patients received ipilimumab alone (3 mg/kg or 10 mg/kg every 3 weeks for 4 treatments), with no exclusions for ocular primary melanomas or HLA type.
- C-C motif ligand 2 CCL2
- CCL3 CCL4, CCL8, CCL18, CCL26
- chemokine (C-X-C motif) ligand 9 CXCL9
- CXCL10 CXCL11, CXCL13
- VEGF vascular endothelial growth factor
- sULBP serum-based immunoassays
- Bead-based immunoassays were analyzed using the Luminex-based Bio- Plex system (BIO-RAD, Hercules, CA).
- Soluble CD25 (sCD25) and soluble lymphocyte- activation gene 3 (sLAG-3) were measured by ELISA (R&D Systems).
- Serum sHLA-G was measured by ELISA (Exbio Vestec, Czech Republic). Only serum cytokines having statistical significance in univariate analyses of overall survival (OS) were reported.
- Example 1 Patient Characteristics of Phase 3 Study
- Baseline CXCL11 concentrations were comparable between ipilimumab (median 38, range 2- 1027 pg/mL) and gplOO (median 39, range 2-911 pg/mL) groups.
- baseline levels of sMICA were consistent between ipilimumab (median 115, range 13-1573 pg/mL) and gplOO (median 121, range 13-2074 pg/mL) groups.
- ECOG Eastern Cooperative Oncology Group performance status
- ULN upper limit of normal
- LDH Lactate dehydrogenase
- IL-2 interleukin-2.
- ECOG 1-2 vs O Including IL-2 Median survival times calculated from Kaplan- Meier estimates.
- Elevated VEGF was also associated with decreased survival in both groups, though marginally so for the ipilimumab-treated group (Fig. 1). Higher numbers of lymphocytes (ALC) at baseline were associated with better OS in both treatment groups (Fig. 1). These univariate analyses suggest that CXCLl 1 and sMICA are potential predictors of overall survival in ipilimumab treated melanoma patients, while sMICB, sCD25, VEGF, LDH, tumor burden, and ALC represent putative prognostic biomarkers.
- Multivariate analyses were also conducted with a focus on CXCLl 1 and sMICA, as these two biomarkers were identified in the univariate analysis as correlating with ipilimumab but not gplOO treatment.
- Models were used to test the independent effects of CXCLl 1 and sMICA after adjusting for each other and the covariates LDH, ALC, tumor burden, age, sex, and ECOG status.
- LDH LDH
- ALC tumor burden
- age, sex ECOG status
- ECOG score were associated with OS (logio CXCL11 HR, 1.88; 95% CI; 1.14 to 3.12; P
- CXCL11 and sMICA are potential predictive biomarkers of overall survival in ipilimumab-treated melanoma patients, whereas LDH represents a prognostic biomarker for melanoma patients irrespective of treatment.
- Example 3 CXCL11 and sMICA in an independent ipilimumab-treated cohort
- EACRI cohort included more patients with advanced disease and poorer prognosis. This discrepancy may account for shorter median survival of the EACRI cohort (8.6 months) relative to that of ipilimumab-treated phase 3 trial cohort (10.1 months). In the EACRI cohort, median follow up was 39 months (range, 0.8-40 months).
- Elevated VEGF was associated with decreased survival and sMICB and ALC were not associated with survival.
- sMICA may be associated with OS in this cohort (loglO sMICA quadratic effect P
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Biochemistry (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Cell Biology (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Epidemiology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Provided herein are methods for selecting a cancer patient for anti-CTLA-4 immunotherapy, or predicting whether a cancer patient will respond to anti-CTLA4 immunotherapy, based on measured levels of CXCLl 1 and/or sMICA. Such methods are useful for determining whether an anti-CTLA-4 immunotherapy is likely to improve overall survival of a cancer patient. Also provided herein are methods of treating a cancer patient with an anti- CTLA-4 immunotherapy, wherein the patient is first tested for levels of CXCLl 1 and/or sMICA. Also provided are methods for treating a cancer patient with a CXCLl 1 antagonist or sMICA antagonist alone, or in combination with each other and/or with additional anti-cancer agents, such as a CTLA-4 antagonist.
Description
CXCL1 1 AND SMICA AS PREDICTIVE BIOMARKERS FOR EFFICACY OF
ANTI-CTLA4 IMMUNOTHERAPY
REFERENCE TO RELATED APPLICATIONS
This application claims priority to United States Provisional Application No. 62/112,359, entitled "Soluble Immunoregulatory Proteins as Predictors of Overall Survival of Advanced Melanoma Patient", filed on February 5, 2015, and United States Provisional Application No. 62/220,726, entitled "CXCL11 and SMICA as Predictive Biomarkers for Efficacy of Anti- CTLA4 Immunotherapy", filed September 18, 2015, the contents of which are hereby incorporated by reference.
BACKGROUND
Ipilimumab is a human monoclonal antibody that specifically binds to cytotoxic T lymphocyte antigen-4 (CTLA-4). CTLA-4 is expressed on activated T cells, has structural similarities to the costimulatory molecule CD28, and binds to the same ligands as CD28, albeit with higher affinity. Binding of CTLA-4 to CD80/CD86 inhibits T cell activation by limiting interleukin-2 (IL-2) production and expression of the IL-2 receptor (CD25) (Wolchok et al., Annals of the New York Academy of Sciences 2013;1291: 1-13). Ipilimumab prevents CTLA-4 from binding its ligands, thereby promoting activation of effector T cells via prolonged CD28 signaling (Rudd et al., Immunol Rev 2009;229: 12-26). In addition, anti-CTLA-4 antibodies can deplete intratumoral regulatory T cells, subverting yet another mechanism of
immunosuppression (Simpson et al., J Exp Med 2013;210: 1695-1710).
Ipilimumab was approved in the United States for the treatment of metastatic melanoma in 2011. While a significant breakthrough in the treatment of metastatic melanoma, there is a need to increase the percentage of patients who achieve a response to treatment, such as prolonged overall survival.
Unlike traditional cancer therapies, immuno therapeutics act primarily upon cells of the immune system. The requirement for the immune system as a third-party mediator of the drug's activity suggests the balance of positive and negative regulators of the immune response at the time of therapy may be a critical determinant of efficacy for any immunotherapy. Cytokines, chemokines, and soluble receptors regulate the survival, activity, and location of immune
effector cells and thus represent potential players in determining drug efficacy. Of particular interest are soluble factors involved in the recruitment and regulation of effector T cells representing the most readily measurable clinical biomarkers. With an increasing number of treatment options available and increased use of targeted therapies, predictive biomarkers that identify those patients most likely to benefit from a specific treatment would be highly beneficial.
SUMMARY
Provided herein are methods for optimizing treatment of a cancer patient (e.g., a patient diagnosed with metastatic melanoma) with an anti-CTLA-4 immunotherapy. These methods include a) selecting a cancer patient for treatment with an anti-CTLA-4 immunotherapy, or b) predicting the responsiveness of a cancer patient for treatment with an anti-CTLA-4
immunotherapy, or c) treating a cancer patient with anti-CTLA-4 immunotherapy, by
determining whether the patient is likely to benefit from treatment with an anti-CTLA-4 immunotherapy (e.g., a CTLA-4 antagonist).
In one embodiment, the determination is based on measuring the level of CXCLl 1 and/or sMICA in a biological sample from the patient, and comparing the level with a threshold level, wherein levels of CXCLl 1 and/or sMICA below the threshold level is indicative that the patient is likely to respond to anti-CTLA-4 immunotherapy, and levels above the threshold level is indicative that the patient is unlikely to respond to anti-CTLA-4 immunotherapy. If the levels of CXCLl 1 and/or sMICA are below the threshold level, then the patient a) is selected for treatment with an anti-CTLA-4 immunotherapy, or b) predicted to be responsive to anti-CTLA-4 immunotherapy.
In another embodiment, the determination is based on measuring the level of CXCLl 1 and/or sMICA in a biological sample from the patient, and if the levels of CXCLl 1 and/or sMICA are below the threshold level, then the patient is administered a therapeutically effective amount of an anti-CTLA-4 immunotherapy. Alternatively, the determination is based on obtaining the levels of CXCLl 1 and/or sMICA in a biological sample from the patient, and if the levels of CXCLl 1 and/or sMICA are below a threshold level, then the patient is administered a therapeutically effective amount of an anti-CTLA4 immunotherapy, or administration of a therapeutically effective amount of an anti-CTLA4 immunotherapy is ordered.
In another embodiment, the patient is further administered a therapeutically effective amount of a CXCLl 1 antagonist and/or sMICA antagonist. Alternatively, administration of a therapeutically effective amount of a CXCLl 1 antagonist and/or sMICA antagonist is ordered. Administration of the CXCLl 1 antagonist and/or sMICA antagonist, or the order to administer the CXCLl 1 antagonist and/or sMICA antagonist, can be concurrent with, or sequential to, administration of the anti-CTLA-4 immunotherapy.
In another embodiment, the CXCLl 1 antagonist and/or sMICA antagonist is a protein (e.g., an antibody or antigen-binding portion thereof), small molecule, or nucleic acid.
In another embodiment, the step of determining the level of CXCLl 1 and/or sMICA in a biological sample from the patient involves determining the level of CXCLl 1 and/or sMICA protein or gene expression. For example, the level of CXCLl 1 or sMICA is determined by contacting the biological sample from the patient with an agent that binds to CXCLl 1 or sMICA, respectively (e.g., an anti-CXCLl l antibody or anti-sMICA antibody or antigen-binding portion thereof), and detecting the binding of the agent to CXCLl 1 or sMICA in the biological sample (e.g., serum).
In another embodiment, the threshold level for CXCLl 1 is about 35 pg/mL, as measured by bead assay, and/or the threshold level for sMICA is about 247 pg/mL, as measured by a bead- based immunoassay.
The methods of the present invention can be applied to patients diagnosed with various types of cancer, e.g., melanoma, and/or wherein the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
In another embodiment, the method includes administering one or more additional therapeutics and/or includes cancer patients that have previously failed at least one non-CTLA-4- based therapy, e.g., administration of IL-2, dacarbazine, or temozolomide.
In another embodiment, the anti-CTLA-4 immunotherapy is an anti-CTLA-4 antibody, such as, ipilimumab or tremelimumab, which is administered to the patient at various dosages (e.g., at between 1 mg/kg to 10 mg/kg, at 3 mg/kg, or at 10 mg/kg) and intervals (e.g., every 1 to 4 weeks, every 3 weeks, 4 times, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times or more).
Other features and advantages of the instant disclosure will be apparent from the following detailed description and examples, which should not be construed as limiting.
BRIEF DESCRIPTION OF THE FIGURES
Figure 1 shows the results of the univariate analysis of biomarker effects on overall survival (OS) for patients from the phase 3 clinical trial. Hazard ratios (HRs) and confidence intervals (CIs) are shown for the association with overall survival of patients treated with ipilimumab (ipi) or gplOO. Cox proportional hazards regression was used for univariate analysis of biomarker effects on OS. HR is numerator vs. denominator. Among 124 patients analyzed, 35 were censored in the ipilimumab-treated group. Among 123 patients analyzed, 13 were censored in the gplOO-treated group. CXCL11, sCD25, VEGF - 5 missing in the gplOO group and 11 missing in the ipilimumab group. *In quadratic effects model of the ipilimumab group, (logio sMICA)2 P<.0001; in gplOO group, (logio VEGF)2 P = .0002.
Figures 2A and 2B show the results of the multivariate analysis of biomarker effects on OS for patients from the phase 3 clinical trial. HRs and CIs are shown for the association of potential biomarkers with OS of patients treated with ipilimumab (Figure 2 A) or gplOO (Figure 2B). Cox proportional hazards regression was used for multivariate analysis of biomarker effects on OS. Among the 113 total patients analyzed, 34 were censored in ipilimumab-treated group. Among total 115 patients analyzed, 13 were censored in gplOO-treated group. * In quadratic effects model of ipilimumab group, (logio sMICA) P = .0659.
Figure 3 shows the results of the univariate analysis of the ipilimumab-treated EACRI cohort. HRs and CIs are shown for the association of potential biomarkers with OS of patients treated with ipilimumab. Cox proportional hazards regression was used for univariate analysis of biomarker effects on OS. HR is numerator vs denominator. Among 48 total patients analyzed, 8 were censored. * In quadratic effects model, (logio sMICA)2 P = .0244. § (logio VEGF)2 P = .0200.
Figure 4 shows the results of the multivariate analysis of the ipilimumab-treated EACRI cohort. HRs and CIs for the association of potential biomarkers with OS of patients treated with ipilimumab. Cox proportional hazards regression was used for multivariate analysis of biomarker effects on OS. HR is numerator vs denominator. Among 47 total patients analyzed, 8 were censored. * In quadratic effects model, (logio sMICA) P = .1589.
Figures 5A-5D show Kaplan-Meier curves for OS according to pretreatment CXCL11 or sMICA status. Curves for OS obtained by applying selected cut-off points for CXCL11 (Figure 5A and Figure 5C) and sMICA (Figure 5B and Figure 5D) to the phase 3 trial cohort (Figure 5A and Figure 5B) or the EACRI cohort (Figure 5C and Figure 5D). Numbers of subjects at risk at each 10 month interval are listed below each graph. The difference in treatment effect
(ipilimumab (ipi) or gplOO) according to CXCL11 or sMICA concentration is represented in the upper right of each graph (logrank).
Figures 6A-6F show Kaplan-Meier curves for overall survival over 40-50 months based on concentration of the specified biomarker in the phase 3 clinical trial. Figures 6A, 6C, and 6E represent the gplOO treated group. Figures 6B, 6D, and 6F correspond to the ipilimumab treated group.
Figures 7A-7C are Kaplan-Meier plots depicting overall survival over 40 months based on concentration of the specified biomarker in the EACRI cohort.
DETAILED DESCRIPTION
Overview
The present invention is based, at least in part, on the discovery that low baseline serum CXCL11 and sMICA levels are associated with improved overall survival in metastatic melanoma patients treated with a CTLA-4 antagonist, but not in patients treated with a "control" gplOO vaccine. The measurement of pretreatment serum CXCL11 and sMICA levels can thus identify patients most likely to benefit from (i.e., respond to) anti-CTLA-4 immunotherapy. Because certain melanoma patients fail to respond to anti-CTLA-4 immunotherapy, avoiding treatment of such refractory patients would reduce exposure to inefficient therapy, eliminate their risks for adverse effects, and lower overall costs of therapy.
Definitions
In order that the present description may be more readily understood, certain terms are first defined. Additional definitions are set forth throughout the detailed description.
The term "antibody" as used to herein includes whole antibodies and any antigen binding fragments (i.e. , "antigen-binding portions") or single chains thereof. An "antibody" refers, in one embodiment, to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region. In certain naturally occurring antibodies, the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3. In certain naturally occurring antibodies, each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region. The light chain constant region is comprised of one domain, CL. The VH and VL regions can be further subdivided into regions of hypervariability, termed
complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain a binding domain that interacts with an antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g. , effector cells) and the first component (Clq) of the classical complement system.
Antibodies typically bind specifically to their cognate antigen with high affinity, reflected by a dissociation constant (KD) of 10"5 to 10"11 M or less. Any KD greater than about 10"4 M is generally considered to indicate nonspecific binding. As used herein, an antibody that "binds specifically" to an antigen refers to an antibody that binds to the antigen and substantially
-7 -8 identical antigens with high affinity, which means having a KD of 10" M or less, preferably 10" M or less, even more preferably 5 x 10"9 M or less, and most preferably between 10 s M and 10"10 M or less, but does not bind with high affinity to unrelated antigens.
The term "kassoc" or "ka", as used herein, is intended to refer to the association rate of a particular antibody- antigen interaction, whereas the term "k^s" or "kd," as used herein, is intended to refer to the dissociation rate of a particular antibody- antigen interaction. The term "KD", as used herein, is intended to refer to the dissociation constant, which is obtained from the ratio of kd to ka (i.e., kd/ka) and is expressed as a molar concentration (M). KD values for antibodies can be determined using methods well established in the art. A preferred method for
determining the KD of an antibody is by using surface plasmon resonance, preferably using a biosensor system such as a Biacore® system.
An immunoglobulin may be from any of the commonly known isotypes, including but not limited to IgA, secretory IgA, IgG and IgM. The IgG isotype is divided in subclasses in certain species: IgGl, IgG2, IgG3 and IgG4 in humans, and IgGl, IgG2a, IgG2b and IgG3 in mice. "Antibody" includes, by way of example, both naturally occurring and non-naturally occurring antibodies; monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human and nonhuman antibodies; wholly synthetic antibodies; and single chain antibodies.
The term "antigen-binding portion" of an antibody, as used herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen. Such
"fragments" are, for example between about 8 and about 1500 amino acids in length, suitably between about 8 and about 745 amino acids in length, suitably about 8 to about 300, for example about 8 to about 200 amino acids, or about 10 to about 50 or 100 amino acids in length. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term "antigen- binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., Nature 1989;341:544-6), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR) or (vii) a combination of two or more isolated CDRs which may optionally be joined by a synthetic linker. Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al., Science 1988;242:423-6; and Huston et al., PNAS 1998;85:5879-83). Such single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody. These antibody fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies. Antigen-
binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
The term "monoclonal antibody," as used herein, refers to an antibody that displays a single binding specificity and affinity for a particular epitope or a composition of antibodies in which all antibodies display a single binding specificity and affinity for a particular epitope. Accordingly, the term "human monoclonal antibody" refers to an antibody or antibody composition that display(s) a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences. In one embodiment, human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g. , a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
The term "recombinant human antibody," as used herein, includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g. , a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g. , from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies comprise variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation. As known in the art (see, e.g. , Lonberg, Nature Biotech 2005;23: 1117-25), the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen. In addition to rearrangement, the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen. The constant region will change in further response to an antigen (i.e., isotype switch). Therefore, the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar (i.e. , have at least 80% identity).
A "human" antibody (HuMAb) refers to an antibody having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences. The antibodies described herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo). However, the term "human antibody", as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences. The terms "human" antibodies and "fully human" antibodies and are used synonymously.
A "humanized" antibody refers to an antibody in which some, most or all of the amino acids outside the CDR domains of a non-human antibody are replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of a humanized form of an antibody, some, most or all of the amino acids outside the CDR domains have been replaced with amino acids from human immunoglobulins, whereas some, most or all amino acids within one or more CDR regions are unchanged. Small additions, deletions, insertions, substitutions or modifications of amino acids are permissible as long as they do not abrogate the ability of the antibody to bind to a particular antigen. A "humanized" antibody retains an antigenic specificity similar to that of the original antibody.
A "chimeric antibody" refers to an antibody in which the variable regions are derived from one species (e.g., human variable regions) and the constant regions are derived from another species (e.g., mouse constant regions), such as an antibody in which the variable regions are derived from a mouse antibody and the constant regions are derived from a human antibody. Constant region sequences for various species are known in the art and could be readily obtained by the skilled artisan to generate chimeric antibodies.
An "isolated antibody," as used herein, is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities.
A "polypeptide" refers to a chain comprising at least two consecutively linked amino acid residues, with no upper limit on the length of the chain. One or more amino acid residues in the protein may contain a modification such as, but not limited to, glycosylation, phosphorylation or disulfide bond formation. A "protein" may comprise one or more polypeptides.
As used herein, "cytotoxic T lymphocyte-associated antigen-4," "CTLA-4," "CTLA4," "CTLA-4 antigen" and "CD152" (see, e.g., Murata, Am J Pathol 1999;155:453-60) are used interchangeably, and include variants, isoforms, species homologs of human CTLA-4, and analogs having at least one common epitope with CTLA-4 (see, e.g., Balzano, Int J Cancer Suppl 1992;7:28-32). "CTLA-4 protein" is intended to encompass full-length CTLA-4 protein, CTLA-4 protein fragments, CTLA-4 protein variants, and CTLA-4 fusion proteins (e.g., CTLA- 4/Fc fusion protein), which an anti-CTLA-4 antibody (e.g., ipilimumab) can bind.
"Ipilimumab" (also referred to as MDX-010, MDX-101, 10D1, and Yervoy®) refers to a fully human IgGl anti-CTLA-4 antibody that blocks the binding of CTLA-4 to CD38 and CD86 expressed on antigen presenting cells, thereby blocking the negative down-regulation of the immune responses elicited by the interaction between these molecules. Ipilimumab comprises the following heavy and light chain variable region sequences. ipilimumab VH
QVQLVESGGGWQPGRSLRLSCAASGFTFSSYTMHRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDNSK NTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSS ( SEQ ID NO: 1) ipilimumab VL
EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTL TISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIK (SEQ ID NO: 2)
Ipilimumab can also be referred to by its CAS Registry No. 477202-00-9, and is disclosed as antibody 10D1 in PCT Publication No. WO 01/14424, the content of which is herein incorporated by reference. As used herein, ipilimumab also is intended to encompass antibodies comprising the variable region or CDR sequences of ipilimumab.
Initial studies in patients with melanoma showed that ipilimumab could cause objective durable tumor regressions (Phan et al, PNAS 2003;100:8372-7). Also, reductions of serum tumor markers were seen for some patients with ovarian or prostate cancer (Hodi et al., PNAS
2003;100:4712-7). Iipilimumab also has antitumor activity in patients with advanced melanoma (Weber et al, Clin Oncol 2008;26:5950-6; Weber, Cancer Immunol Immunother 2009;58:823- 30).
"CXCLl 1," also known as interferon-inducible T cell a chemoattractant (I-TAC), H174, b-Rl, interferon-γ inducible protein 9 (IP-9), small inducible cytokine B l l (SCYB 11), and SCYB9B,, is a 94 amino acid polypeptide with the nucleotide and amino acid sequences (human) set forth in Genbank Accession No. NM005409 and Genbank Accession No. NP005400, respectively. CXCLl 1 is intended to encompass full-length CXCLl 1 protein, CXCLl 1 protein fragments, CXCLl 1 protein variants, and CXCLl 1 fusion proteins. CXCLl 1 is known to bind to two alternative receptors, CXCR3 and CXCR7 (Colvin et al., JBC 2004;279:30219-27; Burns et al., J Exp Med 2006;203:2201-13). High levels of CXCL11 are protective in patients with renal cell carcinoma (Kondo et al., Cancer Sci 2006;97:780-6), and low levels of CXCLl 1 are associated with poor prognosis in patients with gastric carcinoma (Pasini et al., Gastroenterol 2014;49: 1453-66). These reports suggest that low levels of CXCLl 1 may be detrimental in cancer patients and associated with poor prognosis.
As used herein, "MICA," also known as MIC- A and PERB 11.1, is a ligand for the immunoreceptor natural killer group 2, member D (NKG2D). The nucleotide and amino acid sequences of human MICA are set forth in Genbank Accession No. NM000238 and Genbank Accession No. NP000238, respectively. MICA is intended to encompass full-length MICA protein, MICA protein fragments (e.g., soluble MICA), MICA protein variants, various MICA alleles, and MICA fusion proteins. High levels of sMICA are found in many cancers, including hematopoietic malignancies, epithelial cancers, colorectal cancer, liver cancer, prostate cancer, and melanoma (Champsaur and Lanier, Immunological Reviews 2010;235:267-85). sMICA is generated through various mechanisms, such as shedding due to the activities of
metalloproteases, ADAM family of proteases (e.g., ADAM10 and ADAM17), and thiol disulphide isomerases (e.g., ERp5) (Champsauer and Lanier, supra).
As used herein, "antagonist" refers to any molecule that partially or fully inhibits or neutralizes a biological activity of a polypeptide, such as CXCLl 1 or soluble MICA (sMICA), or that partially or fully inhibits the transcription or translation of a nucleic acid encoding the polypeptide. Exemplary antagonist molecules include, but are not limited to, antibodies, polypeptide fragments, oligopeptides, organic molecules (including small molecules), and nucleic acids (e.g., anti-sense nucleic acids).
As used herein, "CXCLl 1 antagonist" refers to an agent that inhibits CXCLl 1 activity, e.g., an agent that disrupts CXCLl 1 binding to its receptors CXCR3 and/or CXCR7, or an agent
that reduces the protein or mRNA levels of CXCL11. In certain embodiments, the CXCL11 antagonist is an antibody.
As used herein, "sMICA antagonists" refers to an agent that inhibits sMICA activity, e.g., an agent that inhibits (partially or completely) sMICA binding to NKG2D, an agent that leads to reduced shedding of sMICA from MICA, an agent that inhibits MICA-induced NGKD downregulation and diminished NK cell cytotoxicity, or an agent that reduces the levels of sMICA. In certain embodiments, the sMICA antagonist is an antibody that binds to MICA (e.g., sMICA), such as an antibody described in WO2014/144791, the contents of which are herein incorporated by reference. In a further embodiment, the antibody binds to the alpha 3 domain of MICA, and thus does not block NKG2D receptor binding.
As used herein, a "small molecule" refers to an agent with a molecular weight less than about 6 kDa, for example, less than about 2.5 kDa. Small molecules can be obtained from small chemical libraries, peptide libraries, or collections of natural products.
As used herein, "immune response" refers to a biological response within a vertebrate against foreign agents, which response protects the organism against these agents and diseases caused by them. An immune response is mediated by the action of a cell of the immune system (for example, a T lymphocyte, B lymphocyte, natural killer (NK) cell, macrophage, eosinophil, mast cell, dendritic cell or neutrophil) and soluble macromolecules produced by any of these cells or the liver (including antibodies, cytokines, and complement) that results in selective targeting, binding to, damage to, destruction of, and/or elimination from the vertebrate's body of invading pathogens, cells or tissues infected with pathogens, cancerous or other abnormal cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues. An immune reaction includes, e.g., activation or inhibition of a T cell, e.g., an effector T cell or a Th cell, such as a CD4+ or CD8+ T cell, or the inhibition of a Treg cell.
As used herein, "immunomodulator" or "immunoregulator" refers to an agent, e.g., a component of a signaling pathway, that may be involved in modulating, regulating, or modifying an immune response. "Modulating," "regulating," or "modifying" an immune response refers to any alteration in a cell of the immune system or in the activity of such cell (e.g., an effector T cell). Such modulation includes stimulation or suppression of the immune system which may be manifested by an increase or decrease in the number of various cell types, an increase or decrease in the activity of these cells, or any other changes which can occur within the immune
system. Both inhibitory and stimulatory immunomodulators have been identified, some of which may have enhanced function in a tumor microenvironment. In preferred embodiments, the immunomodulator is located on the surface of a T cell. An "immunomodulatory target" or "immunoregulatory target" is an immunomodulator that is targeted for binding by, and whose activity is altered by the binding of, a substance, agent, moiety, compound or molecule.
Immunomodulatory targets include, for example, receptors on the surface of a cell
("immunomodulatory receptors") and receptor ligands ("immunomodulatory ligands").
As used herein, "immunotherapy" refers to the treatment of a subject afflicted with, or at risk of contracting or suffering a recurrence of, a disease by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response. In this context, "anti- CTLA-4 immunotherapy" refers to the treatment of a subject afflicted with, or at risk of developing or suffering a recurrence of, a disease (e.g., cancer) by a method comprising inducing, enhancing, suppressing or otherwise modifying an immune response by administering an agent (e.g., an anti-CTLA-4 antibody such as ipilimumab) that modulates CTLA-4 signaling and results in, e.g., the induction and/or enhancement of T cell activation (e.g., increase in IL-2 and/or IFN-γ production by T cells and/or increase in proliferation of T cells), depletion of regulatory T cells, etc.
As used herein, "potentiating an endogenous immune response" means increasing the effectiveness or potency of an existing immune response in a subject. This increase in effectiveness and potency may be achieved, for example, by overcoming mechanisms that suppress the endogenous host immune response or by stimulating mechanisms that enhance the endogenous host immune response.
As used herein, "cancer" refers a broad group of diseases characterized by the
uncontrolled growth of abnormal cells in the body. Unregulated cell division may result in the formation of malignant tumors or cells that invade neighboring tissues and may metastasize to distant parts of the body through the lymphatic system or bloodstream.
As used herein, "hematological malignancy" includes a lymphoma, leukemia, myeloma or a lymphoid malignancy, as well as a cancer of the spleen and the lymph nodes. Exemplary lymphomas include both B cell lymphomas and T cell lymphomas. B-cell lymphomas include both Hodgkin's lymphomas and most non-Hodgkin's lymphomas. Non-limiting examples of B cell lymphomas include diffuse large B-cell lymphoma, follicular lymphoma, mucosa-associated
lymphatic tissue lymphoma, small cell lymphocytic lymphoma (overlaps with chronic lymphocytic leukemia), mantle cell lymphoma (MCL), Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenstrom macroglobulinemia, nodal marginal zone B cell lymphoma, splenic marginal zone lymphoma, intravascular large B-cell lymphoma, primary effusion lymphoma, lymphomatoid granulomatosis. Non-limiting examples of T cell lymphomas include extranodal T cell lymphoma, cutaneous T cell lymphomas, anaplastic large cell lymphoma, and angioimmunoblastic T cell lymphoma. Hematological malignancies also include leukemia, such as, but not limited to, secondary leukemia, chronic lymphocytic leukemia, acute myelogenous leukemia, chronic myelogenous leukemia, and acute lymphoblastic leukemia. Hematological malignancies further include myelomas, such as, but not limited to, multiple myeloma and smoldering multiple myeloma. Other hematological and/or B cell- or T-cell-associated cancers are encompassed by the term hematological malignancy.
As used herein, a "tumor" refers to an abnormal mass of tissue resulting from excessive cell division that is uncontrolled and progressive. Tumors can be benign or malignant.
As used herein, "patient" includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
As used herein, the term "subject" includes any human or non-human animal. For example, the methods and compositions described herein can be used to treat a subject having cancer. The term "non-human animal" includes all vertebrates, e.g., mammals and non- mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc. Various aspects described herein are described in further detail in the following subsections.
As used herein, "biological sample" refers to cells (e.g., tumor cells, T cells, B cells or other), tissues (e.g., tumor), fluids (e.g., serum or plasma), and/or combination thereof isolated from a subject.
As used herein, "control sample" or "reference sample" as used herein refers to any clinically relevant control or reference sample, including, e.g., a sample from a healthy subject or a population of healthy subjects, or a sample from a patient treated with an agent that is different from the agent of interest. For example, in some embodiments, an intervention group comprises cancer patients treated with ipilimumab, and the control group comprises cancer patients treated with a gplOO vaccine.
As used herein, "normal," when used in the context of the term "subject" or "patient," refers to an individual or group of individuals who do not have a particular disease or condition (e.g., cancer), and is not suspected of having or being at risk for developing the disease or condition.
As used herein, "biomarker" refers to a distinctive biological or biologically derived indicator of a process, event or conditions. In certain embodiments, the biomarker is a gene or gene product (i.e., a polypeptide).
As used herein, "predictive biomarker" as used herein refers to a biomarker that can be used in advance of therapy to estimate the likelihood or predictability of response to a given therapeutic agent or class of therapeutic agents. In certain embodiments, the therapeutic agent is an anti-CTLA-4 immunotherapy, for example, an anti-CTLA-4 antibody. In some embodiments, the predictive biomarker is CXCLl 1. In other embodiments, the predictive biomarker is sMICA.
As used herein, "threshold level" refers to a level of biomarker expression, above which a patient is predicted to respond to anti-CTLA-4 immunotherapy and below which a patient is predicted to be unresponsive to anti-CTLA-4 immunotherapy. The threshold level may be based on one or more compilations of data from patient samples that have received anti-CTLA-4 immunotherapy and determined to be responsive or unresponsive.
As used herein, the term "obtaining," when used in reference to levels of CTLA-4 and/or sMICA, refers to the direct or indirect procurement of the levels of CTLA-4 and/or sMICA. The levels of CTLA-4 and/or sMICA can be directly measured by laboratory personnel. In some embodiments, the levels of CTLA-4 and/or sMICA measured by laboratory personnel can be made available to at least one other party, such as a medical practitioner, as data in written or electronic format. In this context, a second party "obtains" the levels of CTLA-4 and/or sMICA by consulting the data.
As used herein, "treat," "treating," and "treatment," refer to any type of intervention or process performed on, or administering an active agent to, the subject with the objective of reversing, alleviating, ameliorating, inhibiting, or slowing down or preventing the progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease. Prophylaxis refers to administration to a subject who does not have a disease, to prevent the disease from occurring or minimize its effects if it does.
As used herein, "administering" refers to the physical introduction of a composition comprising a therapeutic agent to a subject, using any of the various methods and delivery systems known to those skilled in the art. Preferred routes of administration for antibodies described herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase "parenteral administration" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, intralymphatic, intralesional, intracapsular, intraorbital, intracardiac, intradermal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion, as well as in vivo electroporation. Alternatively, an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically. Administering can also be performed, for example, once, a plurality of times, and/or over one or more extended periods.
As used herein, "effective dose" or "effective dosage" is defined as an amount sufficient to achieve or at least partially achieve a desired effect. A "therapeutically effective amount" or "therapeutically effective dosage" of a drug or therapeutic agent is any amount of the drug that, when used alone or in combination with another therapeutic agent, promotes disease regression evidenced by a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. A "prophylactically effective amount" or a "prophylactically effective dosage" of a drug is an amount of the drug that, when administered alone or in combination with another therapeutic agent to a subject at risk of developing a disease or of suffering a recurrence of disease, inhibits the development or recurrence of the disease. The ability of a therapeutic or prophylactic agent to promote disease regression or inhibit the development or recurrence of the disease can be evaluated using a variety of methods known to the skilled practitioner, such as in human subjects during clinical trials, in animal model systems predictive of efficacy in humans, or by assaying the activity of the agent in in vitro assays.
By way of example for the treatment of tumors, a therapeutically effective amount or dosage of the drug preferably inhibits cell growth or tumor growth by at least about 20%, more
preferably by at least about 40%, even more preferably by at least about 60%, and still more preferably by at least about 80% relative to untreated subjects. In the most preferred
embodiments, a therapeutically effective amount or dosage of the drug completely inhibits cell growth or tumor growth, i.e., preferably inhibits cell growth or tumor growth by 100%. In other preferred embodiments described herein, tumor regression may be observed and may continue for a period of at least about 20 days, more preferably at least about 40 days, or even more preferably at least about 60 days.
As used herein, a "refractory cancer" (also known as a "resistant" cancer) is a cancer that does not respond to treatment (e.g., the cancer may be resistant at the beginning of treatment or it becomes resistant during treatment). As used herein, a "non-responder" is a subject who does not respond to treatment. A "responder" is a subject who responds to treatment (e.g.,
demonstrates some beneficial effect in response to treatment, such as amelioration of at least one symptom of a disease or disorder).
It is to be noted that the term "a" or "an" entity refers to one or more of that entity; for example, "a polynucleotide", is understood to represent one or more polynucleotides. As such, the terms "a" (or "an"), "one or more", and "at least one" can be used interchangeably herein.
The term "about" as used herein when referring to a measurable value such as an amount, temporal duration, and the like, encompasses variations of up to +10% from the specified value. Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, scores in an art-recognized scoring system, etc., used herein are understood as being modified by the term "about."
Various aspects described herein are described in further detail in the following subsections.
I. Patient population
Provided herein are methods for selecting a cancer patient for anti-CTLA-4
immunotherapy. In particular, selection of the cancer patient is based on the levels of CXCL11 and/or sMICA in the patient. As demonstrated in the Examples, low CXCL11 and sMICA protein levels are associated with response to anti-CTLA-4 immunotherapy and improved overall survival of cancer patients.
Accordingly, in one aspect, provided herein are methods of selecting a cancer patient for treatment with an anti-CTLA-4 immunotherapy comprising:
(a) determining the level of CXCLl 1 and/or sMICA in a biological sample from the patient;
(b) comparing the level with a threshold level, wherein levels of CXCLl 1 and/or sMICA below the threshold level is indicative that the patient is likely to respond to anti-CTLA-4 immunotherapy, and levels above the threshold level is indicative that the patient is unlikely to respond to anti-CTLA-4 immunotherapy,
(c) if the levels of CXCLl 1 and/or sMICA are below the threshold level, then selecting the patient for treatment with an anti-CTLA-4 immunotherapy.
In another aspect, provided herein are methods for predicting the responsiveness of a cancer patient to anti-CTLA-4 immunotherapy comprising:
(a) determining the level of CXCLl 1 and/or sMICA in a biological sample from the patient;
(b) comparing the level with a threshold level, wherein levels of CXCLl 1 and/or sMICA below the threshold level is indicative that the patient is likely to respond to anti-CTLA-4 immunotherapy and levels above the threshold level is indicative that the patient is unlikely to respond to anti-CTLA-4 immunotherapy,
(c) if the levels of CXCLl 1 and/or sMICA are below the threshold level, then predicting the patient will be responsive to anti-CTLA-4 immunotherapy.
In some embodiments, the level of either CXCLl 1 or sMICA is used to select a cancer patient for anti-CTLA-4 immunotherapy or predict the responsiveness of a patient to anti-CTLA- 4 immunotherapy. In other embodiments, the levels of both CXCLl 1 and sMICA are used to determine whether a cancer patient will benefit from anti-CTLA-4 immunotherapy or predict the responsiveness of a patient to anti-CTLA-4 immunotherapy.
In some embodiments, elevated levels of CXCLl 1 and/or sMICA in a biological sample obtained from a cancer patient, relative to the level of CXCLl 1 and/or sMICA in a normal control sample (e.g., a healthy individual or population of healthy individuals), indicates the cancer patient is unlikely to respond to anti-CTLA-4 immunotherapy.
In other embodiments, a reduction in the level of CXCLl 1 and/or sMICA in a biological sample from a cancer patient, relative to the level of CXCLl 1 and/or sMICA in a normal control
sample (e.g., a healthy individual or population of healthy individuals), indicates the cancer patient is likely to respond to (i.e., is a candidate for) anti-CTLA-4 immunotherapy.
As shown in the Examples, a CXCLl 1 protein level less than about 35 pg/mL, and/or a sMICA protein level less than about 247 pg/mL, is associated with response to anti-CTLA-4 immunotherapy. Accordingly, provided herein is a method for selecting a patient for anti- CTLA-4 immunotherapy, wherein, if the patient has a CXCLl 1 protein level less than about 35 pg/mL, and/or an sMICA protein level less than about 247 pg/mL, the patient is considered likely to respond to anti-CTLA-4 immunotherapy, and is thus selected for anti-CTLA-4 immunotherapy (e.g., treatment with ipilimumab or tremelimumab). In certain embodiments, the protein levels of CXCLl 1 and/or sMICA are measured in patient serum. In one embodiment, the protein levels of CXCLl 1 and/or sMICA are determined using a bead-based assay.
In particular embodiments, a cancer patient having a protein level of CXCLl 1 between about 0 pg/mL to about 40 pg/mL, between about 5 pg/mL to about 40 pg/mL, between about 10 pg/mL to about 40 pg/mL, between about 15 pg/mL to about 40 pg/mL between about 20 pg/mL to about 40 pg/mL, between about 25 pg/mL to about 40 pg/mL between about 30 pg/mL to about 40 pg/mL, or between about 35 pg/mL to about 40 pg/mL, is selected for anti-CTLA-4 immunotherapy, or is predicted to be responsive to anti-CTLA-4 immunotherapy.
In further embodiments, the threshold level of sMICA is between about 0 pg/mL to about 250 pg/mL, between about 25 pg/mL to about 250 pg/mL, between about 50 pg/mL to about 250 pg/mL, between about 75 pg/mL to about 250 pg/mL between about 100 pg/mL to about 250 pg/mL, between about 125 pg/mL to about 250 pg/mL between about 150 pg/mL to about 250 pg/mL, between about 175 pg/mL to about 250 pg/mL, between about 200 pg/mL to about 250 pg/mL, or between about 225 pg/mL to about 250 pg/mL, is selected for anti-CTLA-4 immunotherapy, or is predicted to be responsive to anti-CTLA-4 immunotherapy.
In some embodiments, the control sample is obtained from an individual who does not have cancer, and is not suspected of being at risk of developing cancer. In other embodiments, the control sample can be pooled from at least one, such as at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least 10 healthy individuals or individuals who do not have or are not suspected of being at risk of developing cancer.
In another aspect, provided herein are methods of ordering the treatment of a cancer in a patient comprising:
(a) obtaining the level of CXCLl 1 and/or sMICA measured in a biological sample from a patient, and
(b) if the level of CXCLl 1 is less than about 35 pg/mL and/or the level of sMICA is less than about 247 pg/mL, then ordering the administration of a therapeutically effective amount of an anti-CTLA-4 immunotherapy to the patient.
In some embodiments, the measured values of CXCLl 1 and/or sMICA are recorded in writing or on a computer readable medium. The method may also involve communicating the measured value of CXCLl 1 and/or sMICA to the patient and/or medical practitioner who cares for the patient.
In other embodiments, a medical practitioner receives information regarding the levels of CXCLl 1 and/or sMICA from a first practitioner in order to make a determination of whether the patient is likely to be responsive to anti-CTLA-4 immunotherapy.
In some embodiments, the subject has a cancer selected from the group consisting of squamous cell carcinoma, small-cell lung cancer, non-small cell lung cancer, squamous non- small cell lung cancer (NSCLC), non squamous NSCLC, glioma, gastrointestinal cancer, renal cancer (e.g. clear cell carcinoma), ovarian cancer, liver cancer, colorectal cancer, endometrial cancer, kidney cancer (e.g., renal cell carcinoma (RCC)), prostate cancer (e.g. hormone refractory prostate adenocarcinoma), thyroid cancer, neuroblastoma, pancreatic cancer, glioblastoma (glioblastoma multiforme), cervical cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer (or carcinoma), gastric cancer, germ cell tumor, pediatric sarcoma, sinonasal natural killer, melanoma (e.g., metastatic malignant melanoma, such as cutaneous or intraocular malignant melanoma), bone cancer, skin cancer, uterine cancer, cancer of the anal region, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, solid tumors of childhood, cancer of the ureter, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain cancer, brain stem glioma, pituitary
adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma, environmentally-induced cancers including those induced by asbestos, virus-related cancers or cancers of viral origin (e.g., human papilloma virus (HPV-related or -originating tumors)), and hematologic malignancies derived from either of the two major blood cell lineages, i.e., the myeloid cell line (which produces granulocytes, erythrocytes, thrombocytes, macrophages and mast cells) or lymphoid cell line (which produces B, T, NK and plasma cells), such as all types of leukemias, lymphomas, and myelomas, e.g., acute, chronic, lymphocytic and/or myelogenous leukemias, such as acute leukemia (ALL), acute myelogenous leukemia (AML), chronic lymphocytic leukemia (CLL), and chronic myelogenous leukemia (CML), undifferentiated AML (MO), myeloblasts leukemia (Ml), myeloblasts leukemia (M2; with cell maturation), promyelocytic leukemia (M3 or M3 variant [M3V]), myelomonocytic leukemia (M4 or M4 variant with eosinophilia [M4E]), monocytic leukemia (M5), erythroleukemia (M6),
megakaryoblastic leukemia (M7), isolated granulocytic sarcoma, and chloroma; lymphomas, such as Hodgkin's lymphoma (HL), non-Hodgkin's lymphoma (NHL), B cell hematologic malignancy, e.g., B-cell lymphomas, T-cell lymphomas, lymphoplasmacytoid lymphoma, monocytoid B-cell lymphoma, mucosa-associated lymphoid tissue (MALT) lymphoma, anaplastic (e.g., Ki 1+) large-cell lymphoma, adult T-cell lymphoma/leukemia, mantle cell lymphoma, angioimmunoblastic T-cell lymphoma, angiocentric lymphoma, intestinal T-cell lymphoma, primary mediastinal B-cell lymphoma, precursor T-lymphoblastic lymphoma, T- lymphoblastic; and lymphoma/leukaemia (T-Lbly/T-ALL), peripheral T- cell lymphoma, lymphoblastic lymphoma, post-transplantation lymphoproliferative disorder, true histiocytic lymphoma, primary central nervous system lymphoma, primary effusion lymphoma, B cell lymphoma, lymphoblastic lymphoma (LBL), hematopoietic tumors of lymphoid lineage, acute lymphoblastic leukemia, diffuse large B-cell lymphoma, Burkitt's lymphoma, follicular lymphoma, diffuse histiocytic lymphoma (DHL), immunoblastic large cell lymphoma, precursor B -lymphoblastic lymphoma, cutaneous T-cell lymphoma (CTLC) (also called mycosis fungoides or Sezary syndrome), and lymphoplasmacytoid lymphoma (LPL) with Waldenstrom's macro globulinemia; myelomas, such as IgG myeloma, light chain myeloma, nonsecretory myeloma, smoldering myeloma (also called indolent myeloma), solitary plasmocytoma, and multiple myelomas, chronic lymphocytic leukemia (CLL), hairy cell lymphoma; hematopoietic tumors of myeloid lineage, tumors of mesenchymal origin, including fibrosarcoma and
rhabdomyoscarcoma; seminoma, teratocarcinoma, tumors of the central and peripheral nervous, including astrocytoma, schwannomas; tumors of mesenchymal origin, including fibrosarcoma, rhabdomyoscaroma, and osteosarcoma; and other tumors, including melanoma, xeroderma pigmentosum, keratoacanthoma, seminoma, thyroid follicular cancer and teratocarcinoma, hematopoietic tumors of lymphoid lineage, for example T-cell and B-cell tumors, including but not limited to T-cell disorders such as T-prolymphocytic leukemia (T-PLL), including of the small cell and cerebriform cell type; large granular lymphocyte leukemia (LGL) preferably of the T-cell type; a/d T-NHL hepatosplenic lymphoma; peripheral/post-thymic T cell lymphoma (pleomorphic and immunoblastic subtypes); angiocentric (nasal) T-cell lymphoma; cancer of the head or neck, renal cancer, rectal cancer, cancer of the thyroid gland; acute myeloid lymphoma, as well as any combinations of said cancers. In a particular embodiment, the patient has melanoma.
In certain embodiments, the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
II. Methods of measuring biomarkers
The levels (protein or RNA) of CXCLl 1 and/or sMICA in a biological sample can be determined (measured) using any suitable method known in the art (see, e.g., Harlow and Lane (1988) Antibodies: A Laboratory Manual," Cold Spring Harbor Laboratory: Cold Spring Harbor, NY). In general, protein levels are determined by contacting a biological sample with an agent that binds to CXCLl 1 or sMICA, detecting the levels of CXCLl 1 or sMICA in the sample, and comparing the levels of CXCLl 1 or sMICA in the sample with the levels of CXCLl 1 or sMICA in a control sample.
Non-limiting examples of binding agents that are suitable for determining the levels of CXCLl 1 or sMICA are monoclonal and polyclonal antibodies specific for CXCLl 1 or sMICA, as well as antigen-binding fragments thereof (Fab fragments, scFvs, etc). Antibodies can be from commercial sources. If unavailable from commercial sources, art-recognized methods can be used to generate monoclonal antibodies, polyclonal antibodies, and fragments thereof.
Binding agents can be directly or indirectly labeled with a detectable moiety. Such moieties can facilitate the detection of CXCLl 1 and/or sMICA by allowing visualization of the complex formed between the binding agent and CXCLl 1 and/or sMICA in a biological sample.
In some embodiments, the signal produced by the detectable moiety is measured and its intensity is proportional to the amount of CXCL11 and/or sMICA present in the sample being analyzed.
Exemplary detectable moieties include luminescent labels, fluorescent labels, radiolabels (e.g., "Tc, 45Ti, 112In, mIn, 3H, 121I, 125I, 131I, 14C, 18F, 36C1, 55Co, 58Co, 51Cr, 67Cu, "Cu, 66Ga, 68Ga, 76Br, 89Zr, 35S, 32P, 90Y, 13N, 150, 211At, 186Re, 188Re, 75Se), enzymatic labels (e.g., horseradish peroxidase, alkaline phosphatase, glucose oxidase, urease, acetylchoiinetraiisferase, luciferase, and beta-galactosidase), epitope tags, chromophore labels, phosphorescent labels, photoaffinity molecules, ECL labels, dyes, biotin, haptens, and the like. Such labels are well known in the art and can be attached to the binding agents using art-recognized methods.
Attachment of the detectable label does not interfere with binding of the agent to CXCL11 and/or sMICA. The detection means is determined by the chosen label. Appearance of the label or its reaction products can be achieved using the naked eye, in the case where the label is particulate and accumulates at appropriate levels, or using instruments such as a
spectrophotometer, a luminometer, a fluorimeter, and the like, all in accordance with standard practice.
Preferably, methods of conjugating the labels result in linkages which are substantially (or nearly) non-immunogenic, e.g., peptide- (i.e. amide-), sulfide-, (sterically hindered), disulfide-, hydrazone-, and ether linkages. These linkages are nearly non-immunogenic and show reasonable stability within serum (see e.g. Senter et al., Curr Opin Chem Biol 2009; 13 235- 44; WO 2009/059278; WO 95/17886).
Depending on the biochemical nature of the moiety and the binding agent (e.g., antibody), different conjugation strategies can be employed. In case the moiety is naturally occurring or recombinant of between 50 to 500 amino acids, there are standard procedures in text books describing the chemistry for synthesis of protein conjugates, which can be easily followed by the skilled artisan (see e.g. Hackenberger et al., Angew Chem Int Ed Engl 2008;47: 10030-74). In one embodiment the reaction of a maleinimido moiety with a cysteine residue within the antibody or the moiety is used. This is an especially suited coupling chemistry in case e.g. a Fab or Fab'-fragment of an antibody is used. Alternatively in one embodiment coupling to the C- terminal end of the antibody or moiety is performed. C-terminal modification of a protein, e.g. of a Fab-fragment can e.g. be performed as described (Sunbul et al., Org Biomol Chem
2009;7:3361-71.
In general, site specific reaction and covalent coupling is based on transforming a natural amino acid into an amino acid with a reactivity which is orthogonal to the reactivity of the other functional groups present. For example, a specific cysteine within a rare sequence context can be enzymatically converted in an aldehyde (see Frese et al. ChemBioChem 2009;10:425-7). It is also possible to obtain a desired amino acid modification by utilizing the specific enzymatic reactivity of certain enzymes with a natural amino acid in a given sequence context (see, e.g., Taki et al., Prot Eng Des Sel 2004;17: 119-26; Gautier et al. Chem Biol 2008;15: 128-36; Bordusa et al., Bioorganic Chemistry (2004) 389-403).
Site specific reaction and covalent coupling can also be achieved by the selective reaction of terminal amino acids with appropriate modifying reagents.
The reactivity of an N-terminal cysteine with benzonitrils (see Ren et al., Angew Chem Int Ed Engl 2009;48:9658-62) can be used to achieve a site-specific covalent coupling.
Native chemical ligation can also rely on C-terminal cysteine residues (Taylor et al., Nucleic Acids and Molecular Biology 2009;22:65-96). EP 1 074 563 describes a conjugation method which is based on the faster reaction of a cysteine within a stretch of negatively charged amino acids with a cysteine located in a stretch of positively charged amino acids.
The moiety may also be a synthetic peptide or peptide mimic. In case a polypeptide is chemically synthesized, amino acids with orthogonal chemical reactivity can be incorporated during such synthesis (see, e.g., de Graaf et al., Bioconjug Chem 2009;20: 1281-95). Since a great variety of orthogonal functional groups is at stake and can be introduced into a synthetic peptide, conjugation of such peptide to a linker is standard chemistry.
In some embodiments, the detectable label is indirectly conjugated to the antibody. For example, the antibody can be conjugated to biotin, and the label can be conjugated to avidin using methods well known in the art. In another embodiment, an unlabeled antibody is detected using a labeled antibody which binds to the unlabeled antibody. In certain embodiments, the labeled antibody that is used for detection is labeled with any of the labels set forth above.
In some embodiments, binding agents can be immobilized on a support or carrier, such as beads, latex particles, magnetic particles, microtiter plate well, cuvette, and the like). Exemplary carrier or support materials include agarose, cellulose, nitrocellulose, dextran, Sephadex, Sepharose, liposomes, carboxymethyl cellulose, polyacrylamides, polystyrene, gabbros, filter
paper, magnetite, ion-exchange resin, plastic film, plastic tube, glass, polyamine-methyl vinyl- ether-maleic acid copolymer, amino acid copolymer, nylon, silk, and the like.
The methods used to determine CXCL11 and/or sMICA levels (protein or mRNA) in a biological sample can be qualitative, semi-quantitative, or quantitative. Art-recognized antibody-based methods for detecting protein levels in biological samples include, but are not limited to, enzyme-linked immunosorbent assay (ELISA), radioimmunoassays,
electrochemiluninescence (ECL) assays, surface plasmon resonance, Western blot,
immunoprecipitation, fluorescence-activated cell sorting (FACS), immunofluorescence, immunohistochemistry, latex agglutination, hemagglutination, mass spectrometry, bead assays, RT-PCR, quantitative PCR, and the like. Methods for determining CXCL11 and/or sMICA levels in a biological sample may include control samples (negative and positive controls). For example, a negative control sample may be a sample containing no CXCL11 and/or sMICA protein, and a positive controls sample is a sample containing CXCL11 and/or sMICA protein.
In a particular embodiment, a bead-based immunoassay is used to measure CXCL11 and/or sMICA protein levels. Bead-based immunoassays allow for the quantification of multiple proteins simultaneously. In one embodiment, a bead-based immunoassays involves the addition of color-coded beads that are precoated with an analyte-specific capture antibody for the target of interest (e.g., CXCL11 and/or sMICA) to a biological sample. This is followed by the addition of biotinylated detection antibody specific for the target of interest, thereby forming an antibody- antigen sandwich. Phycoerythrin-conjugated streptavidin is then added and the beads are read on a dual-laser flow-based detection instrument (e.g., Luminex 200™ or Bio-Rad® Bio-Plex® analyzer). See, e.g., rndsystems.com/resources/technical/luminex-bead-based-assay-principle. Bead-based immunoassays are commercially available from, e.g., R&D Systems (Luminex® Bead-based Multiplex Assay) and BD Biosciences (BD Cytometric Bead Array).
Methods for detecting and measuring protein expression can be performed in formats that allow for rapid preparation, processing, and analysis of multiple samples, e.g., through the use of multi-well assay plates or arrays.
In certain embodiments, the biological sample is whole blood. In other embodiments, the biological sample is serum. Additional non-limiting examples of biological samples are saliva, sputum, cerebrospinal fluid, urine, tears, or mucus. Biological samples for use in the methods described herein can be fresh or frozen. In some embodiments, CXCL11 and/or sMICA levels
are determined from a combination of two or more, such as three, four, five, or six, different types of biological samples.
Biological samples can be obtained using any method known in the art, for example, blood collection followed by serum or plasma preparation, lavage, fine needle aspiration, swab, and phlebotomy. In some embodiments, biological samples are obtained from bone marrow.
III. Methods of treatment
Once a cancer patient has been selected for anti-CTLA-4 immunotherapy using the methods described herein, the patient is treated with an anti-CTLA-4 immunotherapy, e.g., a therapeutic anti-CTLA-4 antibody. In some embodiments, the patient has failed at least one prior therapy (e.g., a therapy other than an anti-CTLA4 immunotherapy). For example, in one embodiment, the patient has failed IL-2 therapy. In another embodiment, the patient has failed dacarbazine therapy. In yet another embodiment, the patient has failed temozolomide therapy.
Accordingly, provided herein are methods of treating a cancer patient who has been selected for anti-CTLA-4 immunotherapy (according to the methods described herein) comprising administering to the patient a therapeutically-effective amount of an anti-CTLA-4 immunotherapy, e.g., a CTLA-4 antagonist that increases IL-2, increases IFN-γ production by T cells, and/or increases the proliferation of T cells and/or depletion of regulatory T cells. In a particular embodiment, the anti-CTLA-4 immunotherapy comprises administering an anti- CTLA-4 antibody, or an antigen-binding portion thereof. In one embodiment, the anti-CTLA-4 antibody is ipilimumab. In another embodiment, the anti-CTLA-4 antibody is tremelimumab.
Also provided herein are methods for treating cancer in a patient comprising:
(a) determining or obtaining the level of CXCL11 and/or sMICA measured in a biological sample from the patient, and
(b) if the level of CXCL11 is below a threshold (e.g., less than about 35 pg/mL) and/or the level of sMICA is below a threshold (e.g., less than about 247 pg/mL), then administering to the patient a therapeutically effective amount of an anti-CTLA-4
immunotherapy.
In a particular embodiment, the patient has metastatic melanoma, and is treated with ipilimumab or tremelimumab.
Also provided herein are methods of treating a cancer patient who has been determined to have levels of CXCLl 1 and/or sMICA that are increased relative to a healthy individual (or population of healthy individuals). Such methods comprise administering a therapeutically effective amount of a CXCLl 1 and/or sMICA antagonist to the patient, regardless of whether the patient also receives anti-CTLA-4 immunotherapy. In some embodiments, the cancer patient is administered a CXCLl 1 and/or sMICA antagonist if the level of CXCLl 1 is above about 35 pg/mL and/or the level of sMICA is above about 247 pg/mL.
In some embodiments, the CXCLl 1 antagonist and/or sMICA antagonist inhibits the activity of CXCLl 1 and/or sMICA. In other embodiments, the CXCLl 1 antagonist and/or sMICA antagonist reduces the levels of CXCLl 1 and/or sMICA.
In some embodiments, a cancer patient determined to have levels of CXCLl 1 and/or sMICA that are increased relative to a healthy individual (or population of healthy individuals) is administered a CXCLl 1 antagonist and/or sMICA antagonist, and further administered an anti- CTLA-4 immunotherapy (e.g., ipilimumab or tremelimumab).
In further embodiments, the cancer patient is administered an anti-CTLA-4
immunotherapy and a CXCLl 1 and/or sMICA antagonist if the patient has levels of CXCLl 1 above about 35 pg/mL and/or levels of sMICA above about 247 pg/mL (e.g., in patient serum). In certain embodiments, the CXCLl 1 antagonist and/or sMICA antagonist is administered concurrently with the anti-CTLA-4 immunotherapy. In other embodiments, the CXCLl 1 antagonist and/or sMICA antagonist is administered separately (e.g., sequentially) with the anti- CTLA-4 immunotherapy.
Antagonists of CXCLl 1 and sMICA include, but are not limited to, small molecules, nucleic acids or nucleic acid analogs, proteins, peptides, oligopeptides, peptidomimetics, or a macromolecule that is not a nucleic acid or protein. Such molecules include, for example, peptide nucleic acid inhibitors, locked nucleic acid inhibitors, small interfering RNA, double stranded RNA, antisense compounds, L-RNA aptamers, Spiegelmers, RNA aptamers, organic molecules, proteins, protein fragments, oligopeptides, antibodies, and non-antibody scaffold proteins (e.g., transferrin, human tenth fibronectin type III domain, Z domain of S. aureus protein A, kunitz domain of a human trypsin inhibitor, ankyrin repeat protein, human lipocalcin, human crystalin, human ubiquitin, trypsin inhibitor from E. elaterium).
In some embodiments, the CXCL11 antagonist partially or completely blocks the interaction between CXCL11 and CXCR3 and/or CXCR7. In one embodiment, the CXCL11 antagonist is an antibody that specifically binds to CXCL11 and partially or completely blocks the interaction between CXCL11 and CXCR3 and/or CXCR7. In certain embodiments, the antibody binds to CXCL 11 with a KD of 5xl0-8 M or less, for example, lxlO-8 M or less, lxlO-9 M or less, lxlO_10 M or less, or lxlO-11 M or less. In some embodiments, the CXCL11 antagonist partially or completely blocks the CXCL11 -mediated internalization of CXCR3 and/or CXCR7. Exemplary CXCL11 antagonists are described in, e.g., WO2003/106488 and WO2008/077945.
In some embodiments, the sMICA antagonist is an agent that reduces the level of sMICA. In other embodiments, the sMICA antagonist partially or completely blocks the interaction between sMICA and NKG2D. In one embodiment, the sMICA antagonist is an antibody that specifically binds to MICA (e.g., sMICA) and partially or completely blocks the interaction between sMICA and NKG2D. In certain embodiments, the antibody binds to MICA (e.g., sMICA) with a KD of 5xl0~8 M or less, for example, lxlO"8 M or less, lxlO"9 M or less, lxlO"10 M or less, or lxlO-11 M or less. In some embodiments, the sMICA antagonist partially or completely blocks the sMICA-mediated NKG2D internalization. In another embodiment, the sMICA antagonist partially or completely prevents shedding of sMICA from MICA. In a further embodiment, the antibody binds to the alpha 3 domain of MICA, and thus does not block
NKG2D receptor binding. Exemplary antibodies that specifically bind to MICA (e.g, sMICA) are described, for example, in WO2014/144791.
Exemplary anti-CTLA-4 antibodies for use in anti-CTLA-4 immunotherapy include, for example, Yervoy™ (ipilimumab or antibody 10D1, described in PCT Publication WO 01/14424), tremelimumab (formerly ticilimumab, CP-675,206), or an anti-CTLA-4 antibody described in any of the following publications: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156;
Hurwitz et al. PNAS 1998;95: 10067-71; Camacho et al. J Clin Oncology 2004;22:Abstract No. 2505 (antibody CP-675206); and Mokyr et al. Cancer Res 1998;58:5301-4. Any of the anti- CTLA-4 antibodies disclosed in WO2013/173223 may also be used. In certain embodiments, the anti-CTLA-4 antibody binds to human CTLA-4 with a —8
KD of 5x10 M or less, for example, lxl0"8 M or less, lxlO"9 M or less, lxl0"10 M or less, or lxlO"11 M or less.
Also provided herein are methods for screening agents that bind to CXCL11 or sMICA. For example, chemical libraries, peptide libraries, and or collections of natural products can be screened, using methods well-known in the art, for agents that bind to CXCL11 or sMICA.
In some embodiments, rational drug design is conducted based on the use of crystal or solution structural information on CXCL11 or sMICA.
CXCL11 or sMICA antagonists can be prepared by any known procedure in the art, including recombinant DNA-related technologies, and chemical synthesis technologies.
Methods for generating monoclonal and polyclonal antibodies, as well as antigen-binding fragments thereof, to target antigens are also well-known in the art.
Agents identified to bind to CXCL11 or sMICA can be further tested for antagonist activity using art-recognized methods. Such methods include assays to determine whether the candidate CXCL11 or sMICA antagonist blocks the binding of CXCL11 to CXCR3 and/or CXCR7, or sMICA to NKG2D. In certain embodiments, a candidate CXCL11 antagonist is tested for its ability to reduce CXCR3 internalization and/or chemotaxis, as described in, e.g., Sauty et al., J Imunol 2001;167:7084-93; Colvin et al., JBC 204;279:30219-27). In other embodiments, a candidate sMICA antagonist is tested for its ability to reduce NKG2D internalization and/or NK cytotoxicity using the methods described in, e.g., Groh et al., Nature 2002;419:734-8 and Ashiru et al., Cancer Res 2010:70:481-9).
IV. Combination therapies
Also provided herein are combination therapies for treating a cancer patient determined to have levels of CXCL11 and/or sMICA that are above the levels measured in healthy individuals (e.g., those without cancer and those who are not suspected as being at risk of developing cancer). In some embodiments, the level of CXCL11 in the cancer patient (e.g., in patient serum) is above about 35 pg/mL and/or the level of sMICA is above about 247 pg/mL, as assessed, e.g., using a bead-based immunoassay.
In one embodiment, the patient is administered an anti-CTLA-4 immunotherapy (e.g., ipilimumab or tremelimumab) and a CXCL11 antagonist and/or sMICA antagonist.
In another embodiment, the patient is administered a CXCL11 antagonist and/or sMICA antagonist.
In yet another embodiment, either of the above combination therapies includes administration of one or more additional therapeutic agents (e.g., simultaneous, separate, or sequential administration). Exemplary therapeutic agents administered in these combinations are described below.
In certain embodiments, the therapeutic agent is one or more of the following agents:
(1) An antagonist (inhibitor or blocking agent) of a protein that inhibits T cell activation (e.g., immune checkpoint inhibitors), such as CTLA-4, PD-1, PD- Ll, PD-L2, and LAG-3, as described above, and any of the following proteins: TIM-3, Galectin 9, CEACAM-1, BTLA, CD69, Galectin-1, TIGIT, CD 113, GPR56, VISTA, B7-H3, B7-H4, 2B4, CD48, GARP, PD1H, LAIR1, TIM-1, and TIM-4; and/or
(2) An agonist of a protein that stimulates T cell activation, such as B7-1, B7-2,
CD28, 4-1BB (CD137), 4-1BBL, GITR, ICOS, ICOS-L, OX40, OX40L, CD70, CD27, CD40, DR3 and CD28H.
Exemplary agents that modulate one of the above proteins include: Yervoy™
(ipilimumab) or Tremelimumab (to CTLA-4), galiximab (to B7.1), BMS-936558 (to PD-1), MK- 3475 (to PD-1), AMP224 (to B7DC), BMS-936559 (to B7-H1), MPDL3280A (to B7-H1), MEDI-570 (to ICOS), AMG557 (to B7H2), MGA271 (to B7H3), IMP321 (to LAG-3), BMS- 663513 (to CD137), PF-05082566 (to CD137), CDX-1127 (to CD27), anti-OX40 (Providence Health Services), huMAbOX40L (to OX40L), Atacicept (to TACI), CP-870893 (to CD40), Lucatumumab (to CD40), Dacetuzumab (to CD40), and Muromonab-CD3 (to CD3). In a preferred embodiment, a CXCL11 antagonist or sMICA antagonist is used in combination with ipilimumab.
Suitable anti-CTLA4 antibodies for use in combination therapies include an anti-CTLA-4 antibody described in any of the following publications: WO 98/42752; WO 00/37504; U.S. Pat. No. 6,207,156; Hurwitz et al., PNAS 1998;95: 10067-71; Camacho et al., Clin Oncology 2004;22:Abstract No. 2505 (antibody CP-675206); WO2013/173223, US2014/0105914, and Mokyr et al., Cancer Res 1998;58:5301-4.
Suitable PD-1 antagonists for use in combination therapies include, for example, a PD-1- Fc fusion protein, such as AMP-244. In one embodiment, the PD-1 antagonist is an anti-PD-1 or anti-PD-Ll antibody. An exemplary anti-PD-1 antibody is nivolumab (BMS-936558) or an
antibody that comprises the CDRs or variable regions of one of antibodies 17D8, 2D3, 4H1, 5C4, 7D3, 5F4 and 4A11 described in WO 2006/121168. In certain embodiments, an anti-PDl antibody is MK-3475 (Lambrolizumab) described in WO2012/145493; and AMP-514 described in WO 2012/145493. Further known PD-1 antibodies and other PD-1 inhibitors include those described in WO 2009/014708, WO 03/099196, WO 2009/114335, WO 2011/066389, WO 2011/161699, WO 2012/145493, U.S. Patent Nos. 7,635,757 and 8,217,149, and U.S. Patent Publication No. 2009/0317368. Any of the anti-PD-1 antibodies disclosed in WO2013/173223 may also be used. An anti-PD-1 antibody that competes for binding with, and/or binds to the same epitope on PD-1 as, as one of these antibodies may also be used in combination treatments. Another approach to target the PD-1 receptor is the recombinant protein composed of the extracellular domain of PD-L2 (B7-DC) fused to the Fc portion of IgGl, called AMP-224.
Exemplary PD-L1 antagonists suitable for use in combination therapies described herein include the anti-PD-Ll antibody BMS-936559 (referred to as 12A4 in WO 2007/005874 and US Patent No. 7,943,743), or an antibody that comprises the CDRs or variable regions of 3G10, 12A4, 10A5, 5F8, 10H10, IB 12, 7H1, 11E6, 12B7 and 13G4, which are described in PCT Publication WO 07/005874 and US Patent No. 7,943,743. In certain embodiment an anti-PD-Ll antibody is MEDI4736 (also known as Anti-B7-Hl), MPDL3280A (also known as RG7446), MSB0010718C (WO2013/79174), or rHigM12B7. Any of the anti-PD-Ll antibodies disclosed in WO2013/173223, WO2011/066389, WO2012/145493, U.S. Patent Nos. 7,635,757 and
8,217,149 and U.S. Publication No. 2009/145493 may also be used. Anti-PD-Ll antibodies that compete with and/or bind to the same epitope as that of any of these antibodies may also be used in combination treatments.
Exemplary anti-LAG3 antibodies suitable for use in combination therapies include antibodies comprising the CDRs or variable regions of antibodies 25F7, 26H10, 25E3, 8B7, 11F2 or 17E5, which are described in U.S. Patent Publication No. US2011/0150892,
WO10/19570 and WO2014/008218. In one embodiment, an anti-LAG-3 antibody is BMS- 986016. Other art recognized anti-LAG-3 antibodies that can be used include IMP731 and IMP- 321, described in US 2011/007023, WO08/132601, and WO09/44273.
Exemplary anti-OX40 antibodies suitable for use in combination therapies include, e.g., MEDI-6383, MEDI-6469 or MOXR0916 (RG7888; WO06/029879).
Exemplary anti-CD137 (4-1BB) antibodies suitable for use in combination therapies include urelumab or PF-05082566 (WO 12/32433).
Suitable CD40 agonists that can be used in combination therapies include, for example, lucatumumab (HCD122), dacetuzumab (SGN-40), CP-870,893 or Chi Lob 7/4.
Suitable anti-GITR antibodies that can be used in combination therapies include, e.g., an antibody having the CDR sequences of 6C8, e.g., a humanized antibody having the CDRs of 6C8, as described, e.g., in WO2006/ 105021; an antibody comprising the CDRs of an anti-GITR antibody described in WO2011/028683; an antibody comprising the CDRs of an anti-GITR antibody described in JP2008278814, or an antibody comprising the CDRs of an anti-GITR antibody described in WO2015/031667.
Other therapeutic agents include antagonists of inhibitory receptors on NK cells or agonists of activating receptors on NK cells (e.g., antagonists of KIR such as lirilumab).
In certain embodiments, the therapeutic agent is an (i) antagonist (or inhibitor or blocking agent) of a protein of the IgSF family or B7 family or the TNF family that inhibit T cell activation or an antagonist of a cytokine that inhibits T cell activation (e.g., IL-6, IL-10, TGF-β, VEGF; "immunosuppressive cytokines") and/or (ii) agonist of stimulatory receptors of the IgSF family, B7 family or the TNF family or of cytokines that stimulate T cell activation, for stimulating an immune response, e.g., for treating proliferative diseases, such as cancer.
Yet other agents suitable for use in combination therapies include agents that inhibit or deplete macrophages or monocytes, including but not limited to CSF-IR antagonists such as CSF-IR antagonist antibodies including RG7155 (WOl l/70024, WOl l/107553, WOl l/131407, W013/87699, W013/119716, WO13/132044) or FPA-008 (WOl 1/140249; W013169264;
WO14/036357).
Additional therapeutic agents include those that inhibit TGF-β signaling, such as GC1008, LY2157299, TEW7197, or IMC-TR1.
Another class of agents includes Toll-like receptor agonists, such as a TLR2/4 agonist (e.g., Bacillus Calmette-Guerin); a TLR7 agonist (e.g., Hiltonol or Imiquimod); a TLR7/8 agonist (e.g., Resiquimod); or a TLR9 agonist (e.g., CpG7909).
Additional agents are those that enhance tumor antigen presentation, e.g., dendritic cell vaccines, GM-CSF secreting cellular vaccines, CpG oligonucleotides, and imiquimod, or therapies that enhance the immunogenicity of tumor cells (e.g., anthracyclines).
Therapies that may be used in combination therapies include those that deplete or block Treg cells, e.g., an agent that specifically binds to CD25.
Another agent for use in combination therapy is an agent that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase.
Another class of agents for use in combination therapy includes agents that inhibit the formation of adenosine or inhibit the adenosine A2A receptor.
Yet another agent for use in combination therapy includes an IDO antagonist, such as INCB-024360 (WO2006/122150, WO07/75598, WO08/36653, WO08/36642), indoximod, NLG-919 (WO09/73620, WO09/1156652, WOl 1/56652, W012/142237) or F001287.
Other therapies for use in combination include those that reverse/prevent T cell anergy or exhaustion and therapies that trigger an innate immune activation and/or inflammation at a tumor site.
The combination therapies disclosed herein may include one or more immuno-oncology agents, and may be, e.g., combined with a combinatorial approach that targets multiple elements of the immune pathway, such as one or more of the following: a therapy that enhances tumor antigen presentation (e.g., dendritic cell vaccine, GM-CSF secreting cellular vaccines, CpG oligonucleotides, imiquimod); a therapy that inhibits negative immune regulation e.g., by inhibiting CTLA-4 and/or PD1/PD-L1/PD-L2 pathway and/or depleting or blocking Tregs or other immune suppressing cells; a therapy that stimulates positive immune regulation, e.g., with agonists that stimulate the CD- 137, OX-40, and/or GITR pathway and/or stimulate T cell effector function; a therapy that increases systemically the frequency of anti-tumor T cells; a therapy that depletes or inhibits Tregs, such as Tregs in the tumor, e.g., using an antagonist of CD25 (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion; a therapy that impacts the function of suppressor myeloid cells in the tumor; a therapy that enhances immunogenicity of tumor cells (e.g., anthracyclines); adoptive T cell or NK cell transfer including genetically modified cells, e.g., cells modified by chimeric antigen receptors (CAR-T therapy); a therapy that inhibits a metabolic enzyme such as indoleamine dioxigenase (IDO), dioxigenase, arginase, or nitric oxide synthetase; a therapy that reverses/prevents T cell anergy or exhaustion; a therapy that triggers an innate immune activation and/or inflammation at a tumor site; administration of immune stimulatory cytokines; or blocking of immuno repressive cytokines.
Further therapeutic agents which can be included in the combination therapies described herein include one or more of agonistic agents that ligate positive costimulatory receptors, blocking agents that attenuate signaling through inhibitory receptors, antagonists, and one or more agents that increase systemically the frequency of anti-tumor T cells, agents that overcome distinct immune suppressive pathways within the tumor microenvironment (e.g., block inhibitory receptor engagement (e.g., PD-Ll/PD-1 interactions), deplete or inhibit Tregs (e.g., using an anti-CD25 monoclonal antibody (e.g., daclizumab) or by ex vivo anti-CD25 bead depletion), inhibit metabolic enzymes such as IDO, or reverse/prevent T cell anergy or exhaustion) and agents that trigger innate immune activation and/or inflammation at tumor sites.
In further embodiments, the combination therapies disclosed herein can be used with irradiation, chemotherapy (e.g., using camptothecin (CPT-11), 5-fluorouracil (5-FU), cisplatin, doxorubicin, irinotecan, paclitaxel, gemcitabine, cisplatin, paclitaxel, carboplatin-paclitaxel (Taxol), doxorubicin, 5-fu, or camptothecin + apo21/TRAIL (a 6X combo)), one or more proteasome inhibitors (e.g., bortezomib or MG132), one or more Bcl-2 inhibitors (e.g., BH3I-2' (bcl-xl inhibitor), indoleamine dioxygenase-1 inhibitor (e.g., INCB24360, indoximod, NLG-919, or F001287), AT-101 (R-(-)-gossypol derivative), ABT-263 (small molecule), GX-15-070 (obatoclax), or MCL-1 (myeloid leukemia cell differentiation protein-1) antagonists), iAP (inhibitor of apoptosis protein) antagonists (e.g., smac7, smac4, small molecule smac mimetic, synthetic smac peptides (see Fulda et al, Nat Med 2002;8:808-15), ISIS23722 (LY2181308), or AEG-35156 (GEM-640)), HDAC (histone deacetylase) inhibitors, anti-CD20 antibodies (e.g., rituximab), angiogenesis inhibitors (e.g., bevacizumab), anti-angiogenic agents targeting VEGF and VEGFR (e.g., Avastin), synthetic triterpenoids (see Hyer et al., Cancer Research
2005;65:4799-808), c-FLIP (cellular FLICE-inhibitory protein) modulators (e.g., natural and synthetic ligands of PPARy (peroxisome proliferator-activated receptor γ), 5809354 or 5569100), kinase inhibitors (e.g., Sorafenib), Trastuzumab, Cetuximab, Temsirolimus, mTOR inhibitors such as rapamycin and temsirolimus, Bortezomib, JAK2 inhibitors, HSP90 inhibitors, PI3K- AKT inhibitors, Lenalildomide, GSK3P inhibitors, IAP inhibitors and/or genotoxic drugs.
In other embodiments, one or more anti-proliferative cytotoxic agents can be used in the combination therapies. Classes of compounds that may be used as anti-proliferative cytotoxic agents include, but are not limited to, the following:
Alkylating agents (including, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): Uracil mustard, Chlormethine,
Cyclophosphamide (CYTOXAN™) fosfamide, Melphalan, Chlorambucil, Pipobroman,
Triethylenemelamine, Triethylenethiophosphoramine, Busulfan, Carmustine, Lomustine,
Streptozocin, Dacarbazine, and Temozolomide.
Antimetabolites (including, without limitation, folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors): Methotrexate, 5-Fluorouracil, Floxuridine, Cytarabine, 6-Mercaptopurine, 6-Thioguanine, Fludarabine phosphate, Pentostatine, and
Gemcitabine.
Anti-proliferative agents suitable for use in the combination therapies include, without limitation, taxanes, paclitaxel (paclitaxel is commercially available as TAXOL™), docetaxel, discodermolide (DDM), dictyostatin (DCT), Peloruside A, epothilones, epothilone A, epothilone B, epothilone C, epothilone D, epothilone E, epothilone F, furanoepothilone D, desoxyepothilone Bl, [17]-dehydrodesoxyepothilone B, [18]dehydrodesoxyepothilones B, C12,13-cyclopropyl- epothilone A, C6-C8 bridged epothilone A, trans-9,10-dehydroepothilone D, cis-9,10- dehydroepothilone D, 16-desmethylepothilone B, epothilone B IO, discoderomolide, patupilone (EPO-906), KOS-862, KOS-1584, ZK-EPO, ABJ-789, XAA296A (Discodermolide), TZT-1027 (soblidotin), ILX-651 (tasidotin hydrochloride), Halichondrin B, Eribulin mesylate (E-7389), Hemiasterlin (HTI-286), E-7974, Cyrptophycins, LY-355703, Maytansinoid immunoconjugates (DM-1), MKC-1, ABT-751, Tl-38067, T-900607, SB-715992 (ispinesib), SB-743921, MK-0731, STA-5312, eleutherobin, 17beta-acetoxy-2-ethoxy-6-oxo-B-homo-estra-l,3,5(10)-trien-3-ol, cyclostreptin, isolaulimalide, laulimalide, 4-epi-7-dehydroxy-14,16-didemethyl-(+)- discodermolides, and cryptothilone 1, in addition to other microtubuline stabilizing agents known in the art.
In cases where it is desirable to render aberrantly proliferative cells quiescent in conjunction with or prior to treatment with the combination therapies disclosed herein, hormones and steroids (including synthetic analogs), such as 17a-Ethinylestradiol, Diethylstilbestrol, Testosterone, Prednisone, Fluoxymesterone, Dromostanolone propionate, Testolactone,
Megestrolacetate, Methylprednisolone, Methyl-testosterone, Prednisolone, Triamcinolone, Chlorotrianisene, Hydroxyprogesterone, Aminoglutethimide, Estramustine,
Medroxyprogesteroneacetate, Leuprolide, Flutamide, Toremifene, ZOLADEX™, can also be
administered to the patient. When employing the methods or compositions described herein, other agents used in the modulation of tumor growth or metastasis in a clinical setting, such as antimimetics, can also be administered as desired.
Methods for the safe and effective administration of chemotherapeutic agents are known to those skilled in the art. In addition, their administration is described in the standard literature. For example, the administration of many of the chemotherapeutic agents is described in the Physicians' Desk Reference (PDR), e.g., 1996 edition (Medical Economics Company, Montvale, N.J. 07645-1742, USA); the disclosure of which is incorporated herein by reference.
The chemotherapeutic agent(s) and/or radiation therapy can be administered according to therapeutic protocols well known in the art. It will be apparent to those skilled in the art that the administration of the chemotherapeutic agent(s) and/or radiation therapy can be varied depending on the disease being treated and the known effects of the chemotherapeutic agent(s) and/or radiation therapy on that disease. Also, in accordance with the knowledge of the skilled clinician, the therapeutic protocols (e.g., dosage amounts and times of administration) can be varied in view of the observed effects of the administered therapeutic agents on the patient, and in view of the observed responses of the disease to the administered therapeutic agents.
V. Compositions
Compositions provided herein include one or more therapeutic agents selected from a anti-CTLA-4 immunotherapeutic (e.g., antibody), a CXCL11 antagonist, and/or a sMICA antagonist, optionally formulated together with a pharmaceutically acceptable carrier.
The compositions may include additional therapeutic agents, as discussed above. For example, the composition can include an CXCL11 antagonist, sMICA antagonist, and/or anti- CTLA-4 immunotherapy, combined with at least one other anti-cancer and/or T-cell stimulating (e.g., activating) agent.
In some embodiments, the compositions includes other compounds, drugs, and/or agents used for the treatment of cancer. Such compounds, drugs, and/or agents can include, for example, chemotherapy drugs, small molecule drugs, or antibodies that stimulate the immune response to a given cancer.
As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying
agents, and the like that are physiologically compatible. Preferably, the carrier is suitable for oral, intravenous, intramuscular, subcutaneous, parenteral, spinal or epidermal administration (e.g. , by injection or infusion). Depending on the route of administration, the active compound may be coated in a material to protect the compound from the action of acids and other natural conditions that may inactivate the compound.
The pharmaceutical compositions described herein may include one or more
pharmaceutically acceptable salts. A "pharmaceutically acceptable salt" refers to a salt that retains the desired biological activity of the parent compound and does not impart any undesired toxicological effects (see e.g. , Berge, S.M., et al. (1977) J. Pharm. Sci. 66: 1-19).
The pharmaceutical compositions also may include a pharmaceutically acceptable antioxidant, such as a water soluble antioxidant, oil- soluble antioxidant, or metal chelating agent.
Examples of suitable aqueous and nonaqueous carriers include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
These pharmaceutical compositions may also contain an effective amount of an adjuvant, preservative, wetting agent, emulsifying agent, and/or dispersing agent. In this context, an "effective amount" of a preservative refers to an amount sufficient to prevent the active ingredient from degrading, relative to the active ingredient in the absence of a preservative, for a certain duration (e.g., at least 2 weeks, such as at least 3 weeks, at least 1 month, at least 2 months, at least 4 months, at least 6 months, at least 1 year, or at least 2 years). Prevention of presence of microorganisms may be ensured both by sterilization procedures, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. In certain embodiments, isotonic agents, such as sugars, sodium chloride, and the like, are included in the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
The use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions described herein is contemplated. A
pharmaceutical composition may comprise a preservative or may be devoid of a preservative. Supplementary active compounds can be incorporated into the compositions.
Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated herein. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will vary depending upon the subject being treated, and the particular mode of administration. The amount of active ingredient which can be combined with a carrier material to produce a single dosage form will generally be that amount of the composition which produces a therapeutic effect. Generally, out of one hundred per cent, this amount will range from about 0.01 per cent to about ninety-nine percent of active ingredient,
preferably from about 0.1 per cent to about 70 per cent, most preferably from about 1 per cent to about 30 per cent of active ingredient in combination with a pharmaceutically acceptable carrier.
Dosage regimens are adjusted to provide the optimum desired response (e.g. , a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms described herein are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals.
For administration of an CXCL11 antagonist, sMICA antagonist, and/or anti-CTLA-4 immunotherapy (e.g., ipilimumab), the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 or 10 mg/kg, of the host body weight. For example dosages can be 0.3 mg/kg body weight, 1 mg/kg body weight, 3 mg/kg body weight, 5 mg/kg body weight or 10 mg/kg body weight or within the range of 1- 10 mg/kg. An exemplary treatment regime entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every 3 months or once every three to 6 months.
In some embodiments, the CXCL11 antagonist, sMICA antagonist, and/or anti-CTLA-4 immunotherapy may be administered at a flat dose (flat dose regimen).
When the antagonist is an antibody, in some embodiments, two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated. Antibodies are typically administered on multiple occasions. Intervals between single dosages can be, for example, weekly, monthly, every three months or yearly. Intervals can also be irregular as indicated by measuring blood levels of antibody to the target antigen in the patient. In some embodiments, the dosage is adjusted to achieve a plasma antibody concentration of about 1- 1000 μg/ml, and in particular embodiments, about 25-300 μg/ml.
In some embodiments, the CXCL11 antagonist, sMICA antagonist, and/or anti-CTLA-4 immunotherapy is administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
Actual dosage levels of the active ingredients in the pharmaceutical compositions may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient. The selected dosage level will depend upon a variety of
pharmacokinetic factors including the activity of the particular compositions described herein employed, or the ester, salt or amide thereof, the route of administration, the time of
administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
A "therapeutically effective dosage" of a CXCL11 antagonist, sMICA antagonist, and/or anti-CTLA-4 immunotherapy preferably results in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction. In the context of cancer, a therapeutically effective dose preferably results in increased survival (e.g., increased overall survival), and/or prevention of further deterioration of physical symptoms associated with cancer. Symptoms of cancer are well-known in the art and include, for example, unusual mole features, a change in the appearance of a mole, including asymmetry, border, color and/or diameter, a newly pigmented skin area, an abnormal mole, darkened area under nail, breast lumps, nipple changes, breast cysts,
breast pain, death, weight loss, weakness, excessive fatigue, difficulty eating, loss of appetite, chronic cough, worsening breathlessness, coughing up blood, blood in the urine, blood in stool, nausea, vomiting, liver metastases, lung metastases, bone metastases, abdominal fullness, bloating, fluid in peritoneal cavity, vaginal bleeding, constipation, abdominal distension, perforation of colon, acute peritonitis (infection, fever, pain), pain, vomiting blood, heavy sweating, fever, high blood pressure, anemia, diarrhea, jaundice, dizziness, chills, muscle spasms, colon metastases, lung metastases, bladder metastases, liver metastases, bone metastases, kidney metastases, and pancreatic metastases, difficulty swallowing, and the like.
A therapeutically effective dose may prevent or delay onset of cancer, such as may be desired when early or preliminary signs of the disease are present. Laboratory tests utilized in the diagnosis of cancer include chemistries, hematology, serology, and radiology. Accordingly, any clinical or biochemical assay that monitors any of the foregoing may be used to determine whether a particular treatment is a therapeutically effective dose for treating cancer. One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
A composition described herein can be administered via one or more routes of
administration using one or more of a variety of methods known in the art. As will be
appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. Preferred routes of administration for antibodies described herein include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion. The phrase "parenteral administration" as used herein means modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
Alternatively, an antibody described herein can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
The active compounds can be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen,
polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J.R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
Therapeutic compositions can be administered with medical devices known in the art. For example, in a preferred embodiment, a therapeutic composition described herein can be administered with a needleless hypodermic injection device, such as the devices disclosed in U.S. Patent Nos. 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824; or
4,596,556. Examples of well-known implants and modules include: U.S. Patent No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Patent No. 4,486,194, which discloses a therapeutic device for administering medicants through the skin; U.S. Patent No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Patent No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery;
U.S. Patent No. 4,439,196, which discloses an osmotic drug delivery system having multi- chamber compartments; and U.S. Patent No. 4,475,196, which discloses an osmotic drug delivery system. These patents are incorporated herein by reference. Many other such implants, delivery systems, and modules are known to those skilled in the art.
VI. Kits
Also provided herein are kits which include one or more agents for detecting and/or determining levels of CXCL1 and/or sMICA, optionally in combination with one or more therapeutic agents (e.g., anti-CTLA-4 immunotherapies and/or CXCL11 antagonists and/or sMICA antagonists), and instructions for use. Accordingly, in some embodiments, the kit comprises agents that bind to and detect CXCL11 and/or bind to and detect sMICA. In one embodiment, the binding agent is an antibody, or antigen-binding portion thereof.
Such kits may comprise at least one additional reagent. For example, the kits may comprise buffers, stabilizers, substrates, detection reagents, and/or cofactors required for the
assay. In some embodiments, the binding agent and, optionally the reagents, are suitably aliquoted. In other embodiments, the kit comprises a means for obtaining the biological sample from a cancer patient. Such means can comprise, for example, reagents that can be used to obtain fluid or tissue sample from the cancer patient.
The present disclosure is further illustrated by the following examples, which should not be construed as further limiting. The contents of all figures and all references, Genbank sequences, and patents and published patent applications cited throughout this application are expressly incorporated herein by reference.
EXAMPLES
Materials and Methods
To identify candidate soluble factor(s) that predict improved overall survival following ipilimumab treatment, pretreatment sera from treatment (ipilimumab) and "active control" (gplOO vaccine) patients from the phase 3 clinical trial of ipilimumab were analyzed for a variety of factors and their levels were correlated with OS. Candidate biomarkers were selected and each analyte was assessed in univariate and multivariate models for correlation with OS.
Correlative biomarkers identified in the initial screen were further validated by testing sera from an independent cohort of ipilimumab-treated patients.
Clinical Trials
Detailed information regarding the phase 3 clinical trial of ipilimumab (NCT00094653) can be found in Hodi et al., NEJM 2010;363:711-23. Patients with metastatic melanoma having failed at least one prior therapy that may have included interleukin-2 (IL-2), dacarbazine, and/or temozolomide were enrolled, excluding those with ocular melanoma. All patients were HLA- A*0201+ as the restricting element for the gplOO peptides employed. All ipilimumab-treated patients received ipilimumab alone at 3 mg/kg every 3 weeks for 4 treatments. In the gplOO group, patients received two peptides (lmg each), injected subcutaneously as an emulsion with incomplete Freund's adjuvant (Montanide ISA-51). Peptide injections were given immediately
after a 90-minute intravenous infusion of placebo. Tumor burden was assessed by the treating physician.
Serum samples were also obtained from patients treated on an expanded access program at the Earle A. Chiles Research Institute (EACRI cohort). Detailed information regarding this Compassionate Use Trial for Unresectable Melanoma with Ipilimumab is available at
ClinicalTrials.gov under the identifier NCT00495066. All patients received ipilimumab alone (3 mg/kg or 10 mg/kg every 3 weeks for 4 treatments), with no exclusions for ocular primary melanomas or HLA type.
Serum Cytokine Analysis
Serum was collected and stored at -80 C until use. Chemokine (C-C motif) ligand 2 (CCL2), CCL3, CCL4, CCL8, CCL18, CCL26, chemokine (C-X-C motif) ligand 9 (CXCL9), CXCL10, CXCL11, CXCL13, and vascular endothelial growth factor (VEGF) were measured using a bead-based multiplexed immunoassay (R&D Systems, Minneapolis, MN). Soluble MHC class I polypeptide-related sequence A (sMICA), sMICB, soluble UL16 binding protein
(sULBP)-l, sULBP-2, sULBP-3, and sULBP-4 were measured using a custom multiplex bead array (R&D Systems). Bead-based immunoassays were analyzed using the Luminex-based Bio- Plex system (BIO-RAD, Hercules, CA). Soluble CD25 (sCD25) and soluble lymphocyte- activation gene 3 (sLAG-3) were measured by ELISA (R&D Systems). Serum sHLA-G was measured by ELISA (Exbio Vestec, Czech Republic). Only serum cytokines having statistical significance in univariate analyses of overall survival (OS) were reported.
Statistical Considerations
Differences in baseline characteristics between treatment groups (ipilimumab vs. gplOO) or trials (phase 3 vs compassionate use) were evaluated using a t-test for age and chi-square tests for gender, Eastern Cooperative Oncology Group (ECOG) performance status, lactate dehydrogenase (LDH), prior IL-2 therapy, and prior immunotherapy. Differences in baseline serum biomarkers between study and treatment groups were tested with Wilcoxon rank sum tests due to skewed distributions.
Analysis of OS was conducted in the phase 3 trial and separately in the confirmatory EACRI cohort due to differences in the patient populations, study design, and study protocol. In
the phase 3 trial, differences within treatment groups were of primary interest and thus tested in separate models. Survival was defined as the time from initiating ipilimumab treatment to date of death, censoring a date of last follow-up. To calculate median follow-up time, deaths were censored.
Univariate survival analysis was performed for each treatment subgroup using Cox proportional hazards regression. Effects of CXCL11, sMICA, sMICB, sCD25, VEGF, absolutely lymphocyte counts (ALC), tumor burden, and effect of LDH (< vs > Upper Limit of Normal [ULN]) were shown. Models of quadratic effects to examine possible non-linear effects and models of linear effects of continuous variables were tested. When the quadratic effect was not significant or the linear effect was more strongly significant, main effects model results were reported. For sMICA and VEGF, the quadratic effect was significant in some models. In order to present a hazard ratio, results were also reported for a categorized variable, with the cut point determined as the quintile where a threshold effect was observed in phase 3 trial. Kaplan-Meier plots used for determining cut points are shown (Figs. 6A-6F). In multivariate analyses, model results of the remaining variables (other than sMICA), however, are from the model containing the continuous form of the variable with the quadratic effect. Continuous measures were approximately log normal and analyzed as log base 10 transformed.
In multivariate analysis of OS, Cox proportional hazards regression was used to test the effects of biomarker candidates on survival after adjusting for other biomarkers and baseline patient characteristics. Only CXCL11 and sMICA were included as they were significant in univariate survival models of the ipilimumab group, but not the gplOO group. Covariates in models for both studies were age, gender ECOG status, prior immunotherapy, LDH, and ALC. Tumor burden was also included in the multivariate model for the phase 3 trial cohort, but not the EACRI cohort, as these data were not captured.
Analyses were performed using SAS 9.3 (SAS Institute Inc., Cary, NC). Forest plots were prepared using Forest Plot Viewer and edited using Adobe Illustrator (San Jose, CA). Graph Pad Prism (La Jolla, CA) was used for depicting some Kaplan-Meier plots.
Example 1: Patient Characteristics of Phase 3 Study
Demographics for the phase 3 study were previously reported (Hodi et al., NEJM
2010;363:711-23). Briefly, 676 patients were enrolled, and 137 were selected to receive
ipilimumab monotherapy (treatment group), 136 to receive gplOO monotheraphy (control group), and 403 treated with the combination of these agents. Biomarker analysis was restricted to the monotherapy groups.
Baseline characteristics were similar between monotherapy groups (Table 1), except that a higher proportion of patients received prior immunotherapy in the gplOO alone groups (P= 0.036) (Table 1, column D). Patients were followed for a median of 31 months (range, 27-43 months). Overall survival of the ipilimumab group was 45.6% at 12 months, 33.2% at 18 months, and 23.5% at 24 months, with a median overall survival of 10.1 months (95% CI, 8.0 to 13.8). Overall survival of the gplOO group was 25.3% at 12 months, 16.3% at 18 months, and 13.7% at 24 months, with a median overall survival of 6.4 months (95% CI, 5.5 to 8.7). Analysis of soluble immunomodulatory proteins was performed on serum collected prior to treatment. Baseline CXCL11 concentrations were comparable between ipilimumab (median 38, range 2- 1027 pg/mL) and gplOO (median 39, range 2-911 pg/mL) groups. Similarly, baseline levels of sMICA were consistent between ipilimumab (median 115, range 13-1573 pg/mL) and gplOO (median 121, range 13-2074 pg/mL) groups.
Table 1
Abbreviations: ECOG, Eastern Cooperative Oncology Group performance status; ULN, upper limit of normal; LDH, Lactate dehydrogenase; IL-2, interleukin-2. P-values shown from t-test for age, Wilcoxon log rank test for CXCLl 1 and sMICA, and Chi-square tests for all other variables. ECOG 1-2 vs O Including IL-2 Median survival times calculated from Kaplan- Meier estimates.
Example 2: CXCL11, sMICA, and Overall Survival
Univariate analysis of ipilimumab-treated patients showed that a 10-fold increase in CXCLl 1 was associated with double the risk of death (hazard ratio [HR], 2.08; 95% CI, 1.40 to 3.11 ; P= .0003) (Fig. 1), whereas CXCLl 1 was not associated with OS in the gplOO group (HR, 1.21 ; 95% CI, 0.87 to 1.68; P = .2597). The effect of CXCLl 1 on OS was significantly different for the ipilimumab group versus the gplOO group (P = .040). In the univariate analysis of logio sMICA, higher sMICA was associated with decreased survival in the ipilimumab group (logio sMICA quadratic effect P < .0001 ; sMICA (>247 vs <247): HR, 3.46; 95% CI, 2.16 to 5.56 with P < .0001), but not in the gplOO group (logio sMICA HR, 0.91 ; 95% CI, 0.61 to 1.36; P = .6373). Elevated sMICB, LDH, tumor burden, and sCD25 were all associated with poorer survival regardless of treatment (Fig. 1). Elevated VEGF was also associated with decreased survival in both groups, though marginally so for the ipilimumab-treated group (Fig. 1). Higher numbers of lymphocytes (ALC) at baseline were associated with better OS in both treatment groups (Fig. 1). These univariate analyses suggest that CXCLl 1 and sMICA are potential predictors of overall survival in ipilimumab treated melanoma patients, while sMICB, sCD25, VEGF, LDH, tumor burden, and ALC represent putative prognostic biomarkers.
Multivariate analyses were also conducted with a focus on CXCLl 1 and sMICA, as these two biomarkers were identified in the univariate analysis as correlating with ipilimumab but not gplOO treatment. Models were used to test the independent effects of CXCLl 1 and sMICA after
adjusting for each other and the covariates LDH, ALC, tumor burden, age, sex, and ECOG status. Within the ipilimumab-treated group, CXCL11 and LDH, but not tumor burden, ALC, age, sex, or ECOG score, were associated with OS (logio CXCL11 HR, 1.88; 95% CI; 1.14 to 3.12; P
= .014: LDH HR, 2.99; 95% CI, 1.78 to 5.02; P < .0001) (Fig. 2A). sMICA was also associated with OS (logio sMICA quadratic effect P = .0659; sMICA (>247 vs <247): HR, 1.75; 95% CI, 1.02 to 3.01 with P = .0420), but less strongly than CXCL11 (Fig. 2A). In the gplOO-treated group, only LDH was independently associated with OS (LDH HR, 2.24; 95% CI, 1.36 to 3.69; P= .0016 (Fig. 2B). These multivariate results again suggest that CXCL11 and sMICA are potential predictive biomarkers of overall survival in ipilimumab-treated melanoma patients, whereas LDH represents a prognostic biomarker for melanoma patients irrespective of treatment.
Example 3: CXCL11 and sMICA in an independent ipilimumab-treated cohort
Sera from melanoma patients (48 of 52, 92.3%) collected prior to treatment with ipilimumab in an expanded access program (EACRI cohort) was analyzed. When comparing patient characteristics between the ipilimumab-treated phase 3 trial cohort and the EACRI cohort, more patients in the EACRI cohort had elevated LDH (P = .0007), prior IL-2 therapy (P
< .0001), and prior immunotherapy (P < .0001) (Table 1, column A, C, and E). This
comparison suggests that the EACRI cohort included more patients with advanced disease and poorer prognosis. This discrepancy may account for shorter median survival of the EACRI cohort (8.6 months) relative to that of ipilimumab-treated phase 3 trial cohort (10.1 months). In the EACRI cohort, median follow up was 39 months (range, 0.8-40 months).
Univariate analyses showed that elevated pretreatment concentrations of CXCL11, sCD25, and LDH were associated with an increased risk of death (Fig. 3). Similar to phase 3 study findings, a 10-fold increase in CXCL11 was associated with a 3.7-fold increase in the risk of death (HR, 3.74; 95% CI, 1.71 to 8.22; P = .0010). sMICA and VEGF effects were non-linear, depicted by the threshold effect as seen in the Kaplan-Meier plots of survival (Figs. 7A-7C). Elevated sMICA was also associated with increased risk of death (loglO sMICA quadratic effect P = .0244; sMICA (>247 vs <247): HR, 2.06; 95% CI, 1.06 to 4.00 with P = .0324; Fig. 3).
Elevated VEGF was associated with decreased survival and sMICB and ALC were not associated with survival.
Multivariate analysis showed that CXCL11 and LDH were associated with OS (loglO CXCL11 HR, 3.18; 95% CI, 1.13 to 8.95; P = .0288; and LDH HR, 2.24; 95% CI, 1.02 to 4.95; P = .0457) after controlling for each other, gender, age, ECOG status, and prior immunotherapy (Fig. 4). sMICA may be associated with OS in this cohort (loglO sMICA quadratic effect P
= .1589; sMICA (>247 vs <247): HR, 1.48; 95% CI, 0.67 to 3.27 with P = .3284; Fig. 4), a result due in part to adjusting for CXCL11 and LDH and somewhat small cohort size. Thus, the predictive association between CXCL11 and OS in ipilimumab-treated melanoma patients was confirmed, although there was a weaker association between sMICA and OS in the EACRI cohort. The association between LDH and OS in the EACRI cohort was also confirmed, compatible with the notion that LDH is a prognostic marker for patients with metastatic melanoma.
Example 4: Kaplan-Meier survival curves
To illustrate the effects of CXC l 1 and sMICA on OS in the phase 3 trial, Kaplan-Meier survival plots were generated (Figs. 5A-5D) for the biomarker high or low groups based on selected cut points (the median of CXCl 1 ; 35 pg/mL, the 80th percentile of sMICA; 247 pg/mL; Figs. 5A and 5B). Due to the quadratic association of sMICA with survival, the 80th percentile was the cut point chosen based on the approximate threshold value seen in the sMICA quintile plot (Figs. 6A-6F). Kaplan-Meier survival plots for the EACRI cohort were also generated using the same cut points as used for the phase 3 study data plot (Figs. 5C and 5D). The distribution of baseline CXCL11 was lower and the distribution of sMICA levels higher in the confirmatory cohort (Table 1, column E). Nonetheless, both cut points successfully dichotomize patients treated with ipilimumab into patients with poor or better OS.
Equivalents
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents of the specific embodiments disclosed herein. Such equivalents are intended to be encompassed by the following claims.
Claims
1. A method of selecting a cancer patient for treatment with an anti-CTLA-4
immunotherapy comprising:
(a) determining the level of CXCLl 1 and/or sMICA in a biological sample from the patient;
(b) comparing the level with a threshold level, wherein levels of CXCLl 1 and/or sMICA below the threshold level is indicative that the patient is likely to respond to anti-CTLA-4 immunotherapy, and levels above the threshold level is indicative that the patient is unlikely to respond to anti-CTLA-4 immunotherapy,
(c) if the levels of CXCLl 1 and/or sMICA are below the threshold level, then selecting the patient for treatment with an anti-CTLA-4 immunotherapy.
2. A method of predicting the responsiveness of a cancer patient to anti-CTLA-4 immunotherapy comprising:
(a) determining the level of CXCLl 1 and/or sMICA in a biological sample from the patient;
(b) comparing the level with a threshold level, wherein levels of CXCLl 1 and/or sMICA below the threshold level is indicative that the patient is likely to respond to anti-CTLA-4 immunotherapy and levels above the threshold level is indicative that the patient is unlikely to respond to anti-CTLA-4 immunotherapy,
(c) if the levels of CXCLl 1 and/or sMICA are below the threshold level, then predicting the patient will be responsive to anti-CTLA-4 immunotherapy.
3. A method of treating a cancer patient with anti-CTLA-4 immunotherapy comprising:
(a) determining the levels of CXCLl 1 and/or sMICA in a biological sample from the patient; and
(b) if the levels of CXCLl 1 and/or sMICA are below a threshold level, then
administering a therapeutically effective amount of an anti-CTLA4 immunotherapy.
4. The method of claim 3, wherein the patient is further administered a therapeutically effective amount of a CXCL11 antagonist and/or sMICA antagonist.
5. A method of treating a cancer in a patient, comprising:
(a) obtaining the levels of CXCL11 and/or sMICA in a biological sample from the patient;
(b) if the levels of CXCL11 and/or sMICA are below a threshold level, then
administering, or ordering the administration of, a therapeutically effective amount of an anti- CTLA4 immunotherapy.
6. The method of claim 5, further comprising ordering the administration of a
therapeutically effective amount of a CXCL11 antagonist and/or sMICA antagonist.
7. The method of claim 4 or 6, wherein the CXCL11 antagonist and/or sMICA antagonist is administered or ordered to be administered concurrently with an anti-CTLA-4 immunotherapy.
8. The method of claim 4 or 6, wherein the CXCL11 antagonist and/or sMICA antagonist is administered or ordered to be administered sequentially with an anti-CTLA-4 immunotherapy.
9. The method of claim 4 and 6, wherein the CXCL11 antagonist and/or sMICA antagonist is a protein, small molecule, or nucleic acid.
10. The method of claim 9, wherein the protein is an antibody or antigen-binding portion thereof.
11. The method of any one of claims 1-3, wherein step (a) involves determining the level of CXCL11 and/or sMICA protein or gene expression.
12. The method of any one of claims 1-3, wherein the level of CXCL11 or sMICA is determined by contacting the biological sample from the patient with an agent that binds to
CXCLl 1 or sMICA, respectively, and detecting the binding of the agent to CXCLl 1 or sMICA in the biological sample.
13. The method of claim 12, wherein the agent is an anti-CXCLl 1 antibody or anti-sMICA antibody or antigen-binding portion thereof.
14. The method of any one of the preceding claims, wherein the biological sample is serum.
15. The method of any one of the preceding claims, wherein the threshold level for CXCLl 1 is about 35 pg/mL, as measured by bead assay.
16. The method of any one of the preceding claims, wherein the threshold level for sMICA is about 247 pg/mL, as measured by a bead-based immunoassay.
17. The method of any one of the preceding claims, wherein the cancer is melanoma.
18. The method of any one of the preceding claims, wherein the cancer is a metastatic cancer, refractory cancer, or recurrent cancer.
19. The method of any one of the preceding claims, further comprising administering one or more additional therapeutics.
20. The method of any one of the preceding claims, wherein the cancer patient has previously failed at least one non-CTLA-4-based therapy.
21. The method of claim 20, wherein the non-CTLA-4-based therapy is IL-2, dacarbazine, or temozolomide.
22. The method of any one of the preceding claims, wherein the anti-CTLA-4
immunotherapy is an anti-CTLA-4 antibody.
23. The method of any one of the preceding claims, wherein the anti-CTLA-4 antibody is ipilimumab.
24. The method of any one of the preceding claims, wherein the anti-CTLA-4 antibody is tremelimumab.
25. The method of any one of claims 22-24, wherein the anti-CTLA4 antibody is
administered to the patient at between 1 mg/kg to 10 mg/kg.
26. The method of claim 25, wherein the anti-CTLA-4 antibody is administered to the patient at 3 mg/kg.
27. The method of claim 26, wherein the anti-CTLA-4 antibody is administered to the patient at 10 mg/kg.
28. The method of any one of claims 22-27, wherein the anti-CTLA-4 antibody is administered every 1 to 4 weeks.
29. The method of claim 28, wherein the anti-CTLA-4 antibody is administered every 3 weeks.
30. The method of any one of claims 22-29, wherein the anti-CTLA-4 antibody is administered 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times or more.
31. The method of claim 30, wherein the anti-CTLA-4 antibody is administered 4 times.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US15/547,304 US10983128B2 (en) | 2015-02-05 | 2016-02-05 | CXCL11 and SMICA as predictive biomarkers for efficacy of anti-CTLA4 immunotherapy |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562112359P | 2015-02-05 | 2015-02-05 | |
| US62/112,359 | 2015-02-05 | ||
| US201562220726P | 2015-09-18 | 2015-09-18 | |
| US62/220,726 | 2015-09-18 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016127052A1 true WO2016127052A1 (en) | 2016-08-11 |
Family
ID=55487083
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/016769 Ceased WO2016127052A1 (en) | 2015-02-05 | 2016-02-05 | Cxcl11 and smica as predictive biomarkers for efficacy of anti-ctla4 immunotherapy |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US10983128B2 (en) |
| WO (1) | WO2016127052A1 (en) |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019005757A1 (en) * | 2017-06-27 | 2019-01-03 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for identifying and treating resistance to ctla4 antagonists in leukemia |
| WO2019094352A1 (en) * | 2017-11-07 | 2019-05-16 | Memorial Sloan Kettering Cancer Center | Inhibition of ctla-4 and/or pd-1 for regulation of t cells |
| WO2019224275A1 (en) | 2018-05-23 | 2019-11-28 | Adc Therapeutics Sa | Molecular adjuvant |
| US10544223B2 (en) | 2017-04-20 | 2020-01-28 | Adc Therapeutics Sa | Combination therapy with an anti-axl antibody-drug conjugate |
| EP3526259A4 (en) * | 2016-10-13 | 2020-06-17 | Dana-Farber Cancer Institute, Inc. | COMPOSITIONS AND METHODS FOR PREDICTING RESPONSE AND RESISTANCE TO CTLA4 BLOCKAGE IN MELANOMA USING GENE EXPRESSION SIGNATURE |
| GB202102396D0 (en) | 2021-02-19 | 2021-04-07 | Adc Therapeutics Sa | Molecular adjuvant |
| WO2021104834A1 (en) | 2019-11-27 | 2021-06-03 | Adc Therapeutics Sa | Combination therapy |
| US11059893B2 (en) | 2015-04-15 | 2021-07-13 | Bergenbio Asa | Humanized anti-AXL antibodies |
| US11318211B2 (en) | 2017-06-14 | 2022-05-03 | Adc Therapeutics Sa | Dosage regimes for the administration of an anti-CD19 ADC |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3612236A1 (en) | 2017-04-20 | 2020-02-26 | ADC Therapeutics SA | Combination therapy with an anti-cd25 antibody-drug conjugate |
| AR122043A1 (en) * | 2020-05-12 | 2022-08-03 | Bristol Myers Squibb Co | DOSAGE AND ADMINISTRATION OF ACTIVABLE ANTI-CTLA-4 ANTIBODY |
Citations (62)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| WO1995017886A1 (en) | 1993-12-27 | 1995-07-06 | Baxter International Inc. | Water soluble non-immunogenic polyamide cross-linking agents |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| EP1074563A1 (en) | 1999-08-02 | 2001-02-07 | F. Hoffmann-La Roche Ag | Chimeric polypeptides enhancing dimer formation through electrostatic interactions and disulfide bond, method for production and uses thereof |
| WO2003099196A2 (en) | 2002-05-23 | 2003-12-04 | Cure Tech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| WO2003106488A2 (en) | 2002-06-12 | 2003-12-24 | Applied Research Systems Ars Holding N.V. | Novel antagonists of cxcr3-binding cxc chemokines |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122150A1 (en) | 2005-05-10 | 2006-11-16 | Incyte Corporation | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| WO2007075598A2 (en) | 2005-12-20 | 2007-07-05 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036642A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036653A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008077945A2 (en) | 2006-12-22 | 2008-07-03 | Ablynx N.V. | Anti-chemokine (ccl2, ccl3, ccl5, cxcl11, cxcl12) single-domain antibodies |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| JP2008278814A (en) | 2007-05-11 | 2008-11-20 | Igaku Seibutsugaku Kenkyusho:Kk | Release of immune control by agonistic anti-human GITR antibody and its application |
| WO2009014708A2 (en) | 2007-07-23 | 2009-01-29 | Cell Genesys, Inc. | Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| WO2009059278A1 (en) | 2007-11-02 | 2009-05-07 | Centocor, Inc. | Semi-synthetic glp-1 peptide-fc fusion constructs, methods and uses |
| US20090145493A1 (en) | 2004-11-23 | 2009-06-11 | Pip Co., Ltd. | Built-in wall water service box |
| WO2009073620A2 (en) | 2007-11-30 | 2009-06-11 | Newlink Genetics | Ido inhibitors |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| US7635757B2 (en) | 1999-08-23 | 2009-12-22 | Dana-Farber Cancer Institute, Inc. | B7-4 Antibodies and uses therefor |
| US20090317368A1 (en) | 1999-11-30 | 2009-12-24 | Lieping Chen | B7-h1, a novel immunoregulatory molecule |
| WO2009156652A1 (en) | 2008-05-29 | 2009-12-30 | Saint-Gobain Centre De Recherches Et D'etudes Europeen | Cellular structure containing aluminium titanate |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US20110007023A1 (en) | 2009-07-09 | 2011-01-13 | Sony Ericsson Mobile Communications Ab | Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011045704A1 (en) * | 2009-10-12 | 2011-04-21 | Pfizer Inc. | Cancer treatment |
| WO2011056652A1 (en) | 2009-10-28 | 2011-05-12 | Newlink Genetics | Imidazole derivatives as ido inhibitors |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011070024A1 (en) | 2009-12-10 | 2011-06-16 | F. Hoffmann-La Roche Ag | Antibodies binding preferentially human csf1r extracellular domain 4 and their use |
| WO2011140249A2 (en) | 2010-05-04 | 2011-11-10 | Five Prime Therapeutics, Inc. | Antibodies that bind csf1r |
| WO2011161699A2 (en) | 2010-06-25 | 2011-12-29 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| WO2012032433A1 (en) | 2010-09-09 | 2012-03-15 | Pfizer Inc. | 4-1bb binding molecules |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| WO2012142237A1 (en) | 2011-04-15 | 2012-10-18 | Newlink Geneticks Corporation | Fused imidazole derivatives useful as ido inhibitors |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013087699A1 (en) | 2011-12-15 | 2013-06-20 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2013119716A1 (en) | 2012-02-06 | 2013-08-15 | Genentech, Inc. | Compositions and methods for using csf1r inhibitors |
| WO2013132044A1 (en) | 2012-03-08 | 2013-09-12 | F. Hoffmann-La Roche Ag | Combination therapy of antibodies against human csf-1r and uses thereof |
| WO2013169264A1 (en) | 2012-05-11 | 2013-11-14 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014036357A1 (en) | 2012-08-31 | 2014-03-06 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| US20140105914A1 (en) | 2011-03-09 | 2014-04-17 | Antitope Limited | Humanised anti ctla-4 antibodies |
| WO2014064240A1 (en) * | 2012-10-26 | 2014-05-01 | Institut Gustave Roussy | Methods for predicting the sensitivity of a subject to immunotherapy |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
-
2016
- 2016-02-05 US US15/547,304 patent/US10983128B2/en active Active
- 2016-02-05 WO PCT/US2016/016769 patent/WO2016127052A1/en not_active Ceased
Patent Citations (66)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4475196A (en) | 1981-03-06 | 1984-10-02 | Zor Clair G | Instrument for locating faults in aircraft passenger reading light and attendant call control system |
| US4447233A (en) | 1981-04-10 | 1984-05-08 | Parker-Hannifin Corporation | Medication infusion pump |
| US4439196A (en) | 1982-03-18 | 1984-03-27 | Merck & Co., Inc. | Osmotic drug delivery system |
| US4447224A (en) | 1982-09-20 | 1984-05-08 | Infusaid Corporation | Variable flow implantable infusion apparatus |
| US4487603A (en) | 1982-11-26 | 1984-12-11 | Cordis Corporation | Implantable microinfusion pump system |
| US4486194A (en) | 1983-06-08 | 1984-12-04 | James Ferrara | Therapeutic device for administering medicaments through the skin |
| US4596556A (en) | 1985-03-25 | 1986-06-24 | Bioject, Inc. | Hypodermic injection apparatus |
| US4790824A (en) | 1987-06-19 | 1988-12-13 | Bioject, Inc. | Non-invasive hypodermic injection device |
| US4941880A (en) | 1987-06-19 | 1990-07-17 | Bioject, Inc. | Pre-filled ampule and non-invasive hypodermic injection device assembly |
| US5312335A (en) | 1989-11-09 | 1994-05-17 | Bioject Inc. | Needleless hypodermic injection device |
| US5064413A (en) | 1989-11-09 | 1991-11-12 | Bioject, Inc. | Needleless hypodermic injection device |
| US5383851A (en) | 1992-07-24 | 1995-01-24 | Bioject Inc. | Needleless hypodermic injection device |
| US5399163A (en) | 1992-07-24 | 1995-03-21 | Bioject Inc. | Needleless hypodermic injection methods and device |
| WO1995017886A1 (en) | 1993-12-27 | 1995-07-06 | Baxter International Inc. | Water soluble non-immunogenic polyamide cross-linking agents |
| WO1998042752A1 (en) | 1997-03-21 | 1998-10-01 | Brigham And Women's Hospital Inc. | Immunotherapeutic ctla-4 binding peptides |
| US6207156B1 (en) | 1997-03-21 | 2001-03-27 | Brigham And Women's Hospital, Inc. | Specific antibodies and antibody fragments |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| EP1074563A1 (en) | 1999-08-02 | 2001-02-07 | F. Hoffmann-La Roche Ag | Chimeric polypeptides enhancing dimer formation through electrostatic interactions and disulfide bond, method for production and uses thereof |
| US7635757B2 (en) | 1999-08-23 | 2009-12-22 | Dana-Farber Cancer Institute, Inc. | B7-4 Antibodies and uses therefor |
| US20090317368A1 (en) | 1999-11-30 | 2009-12-24 | Lieping Chen | B7-h1, a novel immunoregulatory molecule |
| WO2003099196A2 (en) | 2002-05-23 | 2003-12-04 | Cure Tech Ltd. | Humanized immunomodulatory monoclonal antibodies for the treatment of neoplastic disease or immunodeficiency |
| WO2003106488A2 (en) | 2002-06-12 | 2003-12-24 | Applied Research Systems Ars Holding N.V. | Novel antagonists of cxcr3-binding cxc chemokines |
| WO2006029879A2 (en) | 2004-09-17 | 2006-03-23 | F.Hoffmann-La Roche Ag | Anti-ox40l antibodies |
| US20090145493A1 (en) | 2004-11-23 | 2009-06-11 | Pip Co., Ltd. | Built-in wall water service box |
| WO2006105021A2 (en) | 2005-03-25 | 2006-10-05 | Tolerrx, Inc. | Gitr binding molecules and uses therefor |
| WO2006121168A1 (en) | 2005-05-09 | 2006-11-16 | Ono Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics |
| WO2006122150A1 (en) | 2005-05-10 | 2006-11-16 | Incyte Corporation | Modulators of indoleamine 2,3-dioxygenase and methods of using the same |
| WO2007005874A2 (en) | 2005-07-01 | 2007-01-11 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (pd-l1) |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2007075598A2 (en) | 2005-12-20 | 2007-07-05 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036653A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008036642A2 (en) | 2006-09-19 | 2008-03-27 | Incyte Corporation | N-hydroxyamidinoheterocycles as modulators of indoleamine 2,3-dioxygenase |
| WO2008077945A2 (en) | 2006-12-22 | 2008-07-03 | Ablynx N.V. | Anti-chemokine (ccl2, ccl3, ccl5, cxcl11, cxcl12) single-domain antibodies |
| WO2008132601A1 (en) | 2007-04-30 | 2008-11-06 | Immutep | Cytotoxic anti-lag-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| JP2008278814A (en) | 2007-05-11 | 2008-11-20 | Igaku Seibutsugaku Kenkyusho:Kk | Release of immune control by agonistic anti-human GITR antibody and its application |
| WO2009014708A2 (en) | 2007-07-23 | 2009-01-29 | Cell Genesys, Inc. | Pd-1 antibodies in combination with a cytokine-secreting cell and methods of use thereof |
| WO2009044273A2 (en) | 2007-10-05 | 2009-04-09 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| WO2009059278A1 (en) | 2007-11-02 | 2009-05-07 | Centocor, Inc. | Semi-synthetic glp-1 peptide-fc fusion constructs, methods and uses |
| WO2009073620A2 (en) | 2007-11-30 | 2009-06-11 | Newlink Genetics | Ido inhibitors |
| WO2009114335A2 (en) | 2008-03-12 | 2009-09-17 | Merck & Co., Inc. | Pd-1 binding proteins |
| WO2009156652A1 (en) | 2008-05-29 | 2009-12-30 | Saint-Gobain Centre De Recherches Et D'etudes Europeen | Cellular structure containing aluminium titanate |
| US20110150892A1 (en) | 2008-08-11 | 2011-06-23 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3) and uses thereof |
| WO2010019570A2 (en) | 2008-08-11 | 2010-02-18 | Medarex, Inc. | Human antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| US8217149B2 (en) | 2008-12-09 | 2012-07-10 | Genentech, Inc. | Anti-PD-L1 antibodies, compositions and articles of manufacture |
| US20110007023A1 (en) | 2009-07-09 | 2011-01-13 | Sony Ericsson Mobile Communications Ab | Display device, touch screen device comprising the display device, mobile device and method for sensing a force on a display device |
| WO2011028683A1 (en) | 2009-09-03 | 2011-03-10 | Schering Corporation | Anti-gitr antibodies |
| WO2011045704A1 (en) * | 2009-10-12 | 2011-04-21 | Pfizer Inc. | Cancer treatment |
| WO2011056652A1 (en) | 2009-10-28 | 2011-05-12 | Newlink Genetics | Imidazole derivatives as ido inhibitors |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011070024A1 (en) | 2009-12-10 | 2011-06-16 | F. Hoffmann-La Roche Ag | Antibodies binding preferentially human csf1r extracellular domain 4 and their use |
| WO2011140249A2 (en) | 2010-05-04 | 2011-11-10 | Five Prime Therapeutics, Inc. | Antibodies that bind csf1r |
| WO2011161699A2 (en) | 2010-06-25 | 2011-12-29 | Aurigene Discovery Technologies Limited | Immunosuppression modulating compounds |
| WO2012032433A1 (en) | 2010-09-09 | 2012-03-15 | Pfizer Inc. | 4-1bb binding molecules |
| US20140105914A1 (en) | 2011-03-09 | 2014-04-17 | Antitope Limited | Humanised anti ctla-4 antibodies |
| WO2012142237A1 (en) | 2011-04-15 | 2012-10-18 | Newlink Geneticks Corporation | Fused imidazole derivatives useful as ido inhibitors |
| WO2012145493A1 (en) | 2011-04-20 | 2012-10-26 | Amplimmune, Inc. | Antibodies and other molecules that bind b7-h1 and pd-1 |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013087699A1 (en) | 2011-12-15 | 2013-06-20 | F. Hoffmann-La Roche Ag | Antibodies against human csf-1r and uses thereof |
| WO2013119716A1 (en) | 2012-02-06 | 2013-08-15 | Genentech, Inc. | Compositions and methods for using csf1r inhibitors |
| WO2013132044A1 (en) | 2012-03-08 | 2013-09-12 | F. Hoffmann-La Roche Ag | Combination therapy of antibodies against human csf-1r and uses thereof |
| WO2013169264A1 (en) | 2012-05-11 | 2013-11-14 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2014008218A1 (en) | 2012-07-02 | 2014-01-09 | Bristol-Myers Squibb Company | Optimization of antibodies that bind lymphocyte activation gene-3 (lag-3), and uses thereof |
| WO2014036357A1 (en) | 2012-08-31 | 2014-03-06 | Five Prime Therapeutics, Inc. | Methods of treating conditions with antibodies that bind colony stimulating factor 1 receptor (csf1r) |
| WO2014064240A1 (en) * | 2012-10-26 | 2014-05-01 | Institut Gustave Roussy | Methods for predicting the sensitivity of a subject to immunotherapy |
| WO2015031667A2 (en) | 2013-08-30 | 2015-03-05 | Amgen Inc. | Gitr antigen binding proteins |
Non-Patent Citations (46)
| Title |
|---|
| "Physicians' Desk Reference (PDR", 1996, MEDICAL ECONOMICS COMPANY |
| "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC |
| ASHIRU ET AL., CANCER RES, vol. 70, 2010, pages 481 - 9 |
| BALZANO, INT J CANCER, vol. 7, 1992, pages 28 - 32 |
| BERGE, S.M. ET AL., J. PHARM. SCI, vol. 66, 1977, pages 1 - 19 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 6 |
| BORDUSA ET AL., BIOORGANIC CHEMISTRY, 2004, pages 389 - 403 |
| BURNS ET AL., J EXP MED, vol. 203, 2006, pages 2201 - 13 |
| CAMACHO ET AL., J CLIN ONCOLOGY, vol. 22, 2004 |
| CHAMPSAUR; LANIER, MMUNOLOGICAL REVIEWS, vol. 235, 2010, pages 267 - 85 |
| COLVIN ET AL., JBC, vol. 204, no. 279, pages 30219 - 27 |
| COLVIN ET AL., JBC, vol. 279, 2004, pages 30219 - 27 |
| DE GRAAF ET AL., BIOCONJUG CHEM, vol. 20, 2009, pages 1281 - 95 |
| FRESE ET AL., CHEMBIOCHEM, vol. 10, 2009, pages 425 - 7 |
| FULDA ET AL., NAT MED, vol. 8, 2002, pages 808 - 15 |
| GAUTIER ET AL., CHEM BIOL, vol. 15, 2008, pages 128 - 36 |
| GROH ET AL., NATURE, vol. 419, 2002, pages 734 - 8 |
| HACKENBERGER ET AL., ANGEW CHEM INT ED ENGL, vol. 47, 2008, pages 10030 - 74 |
| HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| HODI ET AL., NEJM, vol. 363, 2010, pages 711 - 23 |
| HODI ET AL., PNAS, vol. 100, 2003, pages 4712 - 7 |
| HURWITZ ET AL., PNAS, vol. 95, 1998, pages 10067 - 71 |
| HUSTON ET AL., PNAS, vol. 85, 1998, pages 5879 - 83 |
| HYER ET AL., CANCER RESEARCH, vol. 65, 2005, pages 4799 - 808 |
| JINUSHI M ET AL: "Therapy-induced antibodies to MHC class I chain-related protein A antagonize immune suppression and stimulate antitumor cytotoxicity", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, NATIONAL ACADEMY OF SCIENCES, US, vol. 103, no. 24, 13 June 2006 (2006-06-13), pages 9190 - 9195, XP008109620, ISSN: 0027-8424, DOI: 10.1073/PNAS.0603503103 * |
| KONDO ET AL., CANCER SCI, vol. 97, 2006, pages 780 - 6 |
| LONBERG, NATURE BIOTECH, vol. 23, 2005, pages 1117 - 25 |
| MOKYR ET AL., CANCER RES, vol. 58, 1998, pages 5301 - 4 |
| MURATA, AM J PATHOL, vol. 155, 1999, pages 453 - 60 |
| PASINI ET AL., J GASTROENTEROL, vol. 49, 2014, pages 1453 - 66 |
| PHAN ET AL., PNAS, vol. 100, 2003, pages 8372 - 7 |
| REBMANN ET AL: "Soluble MICA as an independent prognostic factor for the overall survival and progression-free survival of multiple myeloma patients", CLINICAL IMMUNOLOGY, ACADEMIC PRESS, US, vol. 123, no. 1, 15 March 2007 (2007-03-15), pages 114 - 120, XP005923915, ISSN: 1521-6616, DOI: 10.1016/J.CLIM.2006.11.007 * |
| REN ET AL., ANGEW CHEM INT ED ENGL, vol. 48, 2009, pages 9658 - 62 |
| RUDD ET AL., IMMUNOL REV, vol. 229, 2009, pages 12 - 26 |
| RUI-RU JI ET AL: "An immune-active tumor microenvironment favors clinical response to ipilimumab", CANCER IMMUNOLOGY, IMMUNOTHERAPY, SPRINGER, BERLIN, DE, vol. 61, no. 7, 7 December 2011 (2011-12-07), pages 1019 - 1031, XP035074379, ISSN: 1432-0851, DOI: 10.1007/S00262-011-1172-6 * |
| SAUTY ET AL., JIMUNOL, vol. 167, 2001, pages 7084 - 93 |
| SENTER ET AL., CURR OPIN CHEM BIOL, vol. 13, 2009, pages 235 - 44 |
| SIMPSON ET AL., J EXP MED, vol. 210, 2013, pages 1695 - 1710 |
| SUNBUL ET AL., ORG BIOMOL CHEM, vol. 7, 2009, pages 3361 - 71 |
| TAKI ET AL., PROT ENG DES SEL, vol. 17, 2004, pages 119 - 26 |
| TAYLOR ET AL., NUCLEIC ACIDS AND MOLECULAR BIOLOGY, vol. 22, 2009, pages 65 - 96 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 6 |
| WEBER ET AL., J CLIN ONCOL, vol. 26, 2008, pages 5950 - 6 |
| WEBER, CANCER IMMUNOL IMMUNOTHER, vol. 58, 2009, pages 823 - 30 |
| WOLCHOK ET AL., ANNALS OF THE NEW YORK ACADEMY OF SCIENCES, vol. 1291, 2013, pages 1 - 13 |
| YOSHINOBU KOGUCHI ET AL: "Serum immunoregulatory proteins as predictors of overall survival of metastatic melanoma patients treated with ipilimumab", JOURNAL FOR IMMUNOTHERAPY OF CANCER, BIOMED CENTRAL LTD, LONDON, UK, vol. 3, no. 2, 4 November 2015 (2015-11-04), pages 1, XP021235640, DOI: 10.1186/2051-1426-3-S2-P96 * |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11059893B2 (en) | 2015-04-15 | 2021-07-13 | Bergenbio Asa | Humanized anti-AXL antibodies |
| EP3526259A4 (en) * | 2016-10-13 | 2020-06-17 | Dana-Farber Cancer Institute, Inc. | COMPOSITIONS AND METHODS FOR PREDICTING RESPONSE AND RESISTANCE TO CTLA4 BLOCKAGE IN MELANOMA USING GENE EXPRESSION SIGNATURE |
| US10544223B2 (en) | 2017-04-20 | 2020-01-28 | Adc Therapeutics Sa | Combination therapy with an anti-axl antibody-drug conjugate |
| US11318211B2 (en) | 2017-06-14 | 2022-05-03 | Adc Therapeutics Sa | Dosage regimes for the administration of an anti-CD19 ADC |
| US11938192B2 (en) | 2017-06-14 | 2024-03-26 | Medimmune Limited | Dosage regimes for the administration of an anti-CD19 ADC |
| WO2019005757A1 (en) * | 2017-06-27 | 2019-01-03 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for identifying and treating resistance to ctla4 antagonists in leukemia |
| WO2019094352A1 (en) * | 2017-11-07 | 2019-05-16 | Memorial Sloan Kettering Cancer Center | Inhibition of ctla-4 and/or pd-1 for regulation of t cells |
| WO2019224275A1 (en) | 2018-05-23 | 2019-11-28 | Adc Therapeutics Sa | Molecular adjuvant |
| WO2021104834A1 (en) | 2019-11-27 | 2021-06-03 | Adc Therapeutics Sa | Combination therapy |
| GB202102396D0 (en) | 2021-02-19 | 2021-04-07 | Adc Therapeutics Sa | Molecular adjuvant |
Also Published As
| Publication number | Publication date |
|---|---|
| US20180246113A1 (en) | 2018-08-30 |
| US10983128B2 (en) | 2021-04-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7854529B2 (en) | Anti-NKG2A antibody and its use | |
| US10983128B2 (en) | CXCL11 and SMICA as predictive biomarkers for efficacy of anti-CTLA4 immunotherapy | |
| US12227575B2 (en) | Combination of TIM-4 antagonist and PD-1 antagonist and methods of use | |
| US20210147570A1 (en) | Anticancer combination therapy with cd73 antagonist antibody and pd-1/pd-l1 axis antagonist antibody | |
| US20230357423A1 (en) | Immunostimulatory agonistic antibodies for use in treating cancer | |
| JP7474827B2 (en) | Treatment of ovarian cancer with anti-CD47 and anti-PD-L1 | |
| CA2949121A1 (en) | Treatment of lung cancer using a combination of an anti-pd-1 antibody and another anti-cancer agent | |
| JP2016534090A (en) | Medical use of CD38 agonist | |
| JP2018525367A (en) | Combination of anti-PD-1 antibody and anti-M-CSF antibody in cancer treatment | |
| US20220008570A1 (en) | Combination of radioimmunotherapy and immune checkpoint therapy in the treatment of cancer | |
| US20250034254A1 (en) | Use of anti-pd-1 antibody in combination with chemotherapy in treating esophageal cancer | |
| WO2021183428A1 (en) | Antibodies to cd40 with enhanced agonist activity | |
| CA3157048A1 (en) | Humanized anti-ca ix antibodies and methods of their use | |
| EP4619435A1 (en) | Predictive efficacy biomarkers for anti-sirpa antibodies |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16708805 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15547304 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 16708805 Country of ref document: EP Kind code of ref document: A1 |

