WO2016081640A1 - Anti-transferrin receptor / anti-bace1 multispecific antibodies and methods of use - Google Patents

Anti-transferrin receptor / anti-bace1 multispecific antibodies and methods of use Download PDF

Info

Publication number
WO2016081640A1
WO2016081640A1 PCT/US2015/061402 US2015061402W WO2016081640A1 WO 2016081640 A1 WO2016081640 A1 WO 2016081640A1 US 2015061402 W US2015061402 W US 2015061402W WO 2016081640 A1 WO2016081640 A1 WO 2016081640A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
hvr
nos
sequence
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/061402
Other languages
French (fr)
Inventor
Yichin Liu
Jasvinder Atwal
Cecilia Pui Chi Chiu
Ryan J. Watts
Yan Wu
Eric Krauland
Michael Feldhaus
Yin Zhang
Joy Yu Zuchero
Jessica COUCH
Mark S. Dennis
James A. Ernst
Gregory A. Lazar
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Genentech Inc
Adimab LLC
Original Assignee
Genentech Inc
Adimab LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Genentech Inc, Adimab LLC filed Critical Genentech Inc
Priority to EP15804651.6A priority Critical patent/EP3221361B1/en
Priority to US15/525,821 priority patent/US11008403B2/en
Priority to CN201580061990.2A priority patent/CN107250158B/en
Priority to JP2017526560A priority patent/JP6993228B2/en
Priority to HK18104566.6A priority patent/HK1245289B/en
Publication of WO2016081640A1 publication Critical patent/WO2016081640A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2881Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD71
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/20Hypnotics; Sedatives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00Drugs for disorders of the senses
    • A61P27/02Ophthalmic agents
    • A61P27/06Antiglaucoma agents or miotics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/40Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y304/00Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
    • C12Y304/23Aspartic endopeptidases (3.4.23)
    • C12Y304/23046Memapsin 2 (3.4.23.46), i.e. beta-secretase 1 or BACE
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/40Immunoglobulins specific features characterized by post-translational modification
    • C07K2317/41Glycosylation, sialylation, or fucosylation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/528CH4 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/72Increased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70582CD71
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/90Enzymes; Proenzymes
    • G01N2333/914Hydrolases (3)
    • G01N2333/948Hydrolases (3) acting on peptide bonds (3.4)
    • G01N2333/95Proteinases, i.e. endopeptidases (3.4.21-3.4.99)
    • G01N2333/964Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue
    • G01N2333/96425Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals
    • G01N2333/96427Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals in general
    • G01N2333/9643Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from mammals in general with EC number
    • G01N2333/96472Aspartic endopeptidases (3.4.23)
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • Sequence Listing is provided as a file entitled "2015-l l-18_01146-0041-00PCT_ST25.txt” created on November 18, 2015, which is 352,040 bytes in size. The information in the electronic format of the sequence listing is incorporated herein by reference in its entirety.
  • the present invention relates to multispecific antibodies that bind to transferrin receptor and BACE1 and methods of using the same.
  • BBB blood-brain barrier
  • BBB blood- brain barrier
  • the anti-BBB receptor antibody can be made multispecific to target one or more desired antigens in the CNS, or one or more heterologous molecules can be coupled to the anti-BBB receptor antibody; in either case, the anti-BBB receptor antibody can assist in delivering a therapeutic molecule into the CNS across the BBB.
  • BBB- high affinity anti-BBB receptor antibodies
  • the lower affinity of the antibody for the BBB-R is proposed to impair the ability of the antibody to return to the vascular side of the BBB via the BBB-R from the CNS side of the membrane because the overall affinity of the antibody for the BBB-R is low and the local concentration of the antibody on the CNS side of the BBB is non-saturating due to the rapid dispersal of the antibody into the CNS compartment.
  • the circulating antibody levels of the lower-affinity antibody are sustained at therapeutic levels for a longer period of time than the higher-affinity antibody, which consequently improves uptake of antibody in brain for a longer period of time. Furthermore, this improvement in both plasma and brain exposure may reduce the frequency of dosing in the clinic, which would have potential benefit not only for patient compliance and convenience but also in lessening any potential side effects or off-target effects of the antibody and/or of a therapeutic compound coupled thereto.
  • mice displayed a primary response of robust depletion of reticulocyte populations accompanied by rapid onset acute clinical symptoms. Though the mice recovered from both the acute clinical symptoms and the decreased reticulocyte levels in due course, avoiding or otherwise mitigating this impact on reticulocytes is clearly desirable for an anti-TfR antibody to be able to be used safely as a therapeutic molecule.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • the antibodies to greatly reduce or eliminate the unwanted reduction in the TfR-expressing reticulocyte population upon anti-TfR administration while still enabling the enhanced BBB transport, increased CNS distribution and CNS retention provided by the anti-human/primate TfR antibodies administered at therapeutic concentrations.
  • Several general approaches to mitigate the observed effect of the anti-TfR antibodies on both the primary and residual reticulocyte depletion are provided herein, and may be used singly or in combination. [0010]
  • the effector function of the anti-human/cyno TfR antibody is reduced or eliminated in order to reduce or eliminate ADCC activity.
  • the affinity of the anti-human/cyno TfR antibody for human or primate TfR is further lessened such that interactions of the antibody with the reticulocyte population are less detrimental to that population.
  • a third approach is directed to reducing the amount of anti-human/cyno TfR antibody that is present in the plasma to reduce exposure of the reticulocyte population to potentially detrimental concentrations of the antibody.
  • a fourth approach seeks to protect, stabilize and/or replenish reticulocyte populations such that any potential depletion of the reticulocyte population in circulation or in bone marrow by administration of the anti-human/cyno TfR antibody is avoided, lessened, or mitigated.
  • Effector function reduction or elimination may be accomplished by: (i) reduction or elimination of wild-type mammalian glycosylation of the antibody, (for example, by producing the antibody in an environment where such glycosylation cannot occur, by mutating one or more carbohydrate attachment points such that the antibody cannot be glycosylated, or by chemically or enzymatically removing one or more carbohydrates from the antibody after it has been glycosylated); (ii) by reduction or elimination of the Fc receptor-binding capability of the anti-human/cyno TfR antibody (for example, by mutation of the Fc region, by deletion within the Fc region or elimination of the Fc region); or (iii) by utilization of an antibody isotype known to have minimal or no effector function (ie., including but not limited to IgG4).
  • Decreasing antibody complement activation may be accomplished by reduction or elimination of the Clq binding capability of the anti-human/cyno TfR antibody (for example, by mutation of, deletion within or elimination of the Fc region, or by modifying the non- Fc portion of the anti-human/cyno TfR antibody), or by otherwise suppressing activation or activity of the complement system (for example, by co-administering one or more complement pathway activation or complement pathway activity inhibitors).
  • Reducing the amount of anti-human/cyno TfR antibody present in the plasma in order to reduce exposure of the reticulocyte population to potentially detrimental concentrations of the antibody may be accomplished in several ways.
  • One method is to simply decrease the amount of the antibody that is dosed, potentially while also increasing the frequency of the dosing, such that the maximal concentration in the plasma is lowered but a sufficient serum level is maintained for efficacy, while still below the threshold of the cell-depleting side effect.
  • Another method which may be combined with dosing modifications, is to select or engineer an anti-Tf antibody that has pH-sensitive binding to TfR such that it binds to cell surface TfR in the plasma at pH 7.4 with desirably low affinity as described herein, but upon internalization into an endosomal
  • Such binding to TfR is rapidly and significantly reduced at the relatively lower pH of that compartment (pH 5.5-6.0).
  • Such dissociation may protect the antibody from antigen-mediated clearance, or increase the amount of antibody that is either delivered to the CNS or recycled back across the BBB - in either case, the effective concentration of the antibody is increased relative to an anti-TfR antibody that does not comprise such pH sensitivity, without increasing the administered dose of the antibody, and in turn potentially permitting a lower dose of the antibody with concomitantly lesser risk of side effects.
  • Protecting, stabilizing and/or replenishing reticulocyte populations may be accomplished using pharmaceutical or physical methods.
  • at least one further therapeutic agent may be coadministered (simultaneously or sequentially) that mitigates negative side effects of the antibody on reticulocyte populations.
  • therapeutic agents include, but are not limited to, erythropoietin (EPO), iron supplements, vitamin C, folic acid, and vitamin B12.
  • red blood cells ie, reticulocytes
  • transfusion with similar cells which may be from another individual of similar blood type or may have been previously extracted from the subject to whom the anti- human/cyno TfR antibody is administered.
  • any combination of the foregoing methods may be employed to engineer an antibody (and/or dosage regimen for same) with the optimum balance between (i) the desirably low affinity for primate or human TfR that will maximize transport of the antibody and any conjugated compounds into the CNS; (ii) the affinity of the conjugated compound (including as a nonlimiting example, a second or further antigen- binding specificity in the anti-human/cyno TfR antibody) for its CNS antigen, since this is relevant to the amount of the compound that needs to be present in the CNS to have a therapeutic effect; (iii) the clearance rate of the anti-human/cynoTfR antibody; (iv) the lability of the anti- TfR/conjugated compound at low pH to facilitate release of the conjugated compound on the CNS/brain side of the BBB, and (v) the impact on reticulocyte populations.
  • the affinity of the conjugated compound including as a nonlimiting example, a second or further antigen- binding specificity in
  • the reticulocyte-depleting effect recognized herein of anti- TfR antibody administration may be useful in the treatment of any disease or disorder where overproliferation of reticulocytes is problematic.
  • overproliferation of reticulocytes is problematic.
  • congenital polycythemia or neoplastic polycythemia vera raised red blood cell counts due to hyperproliferation of, e.g., reticulocytes, results in thickening of blood and concomitant physiological symptoms.
  • an anti-human/cyno TfR antibody wherein at least partial effector function of the antibody was preserved would permit selective removal of immature reticulocyte populations without impacting normal transferrin transport into the CNS. Dosing of such an antibody could be modulated such that acute clinical symptoms could be minimized (ie, by dosing at a very low dose or at widely-spaced intervals), as well-understood in the art.
  • Anti-TfR/BACEl and anti-TfR/Abeta are each promising and novel therapeutic candidates for the treatment of Alzheimer's disease. Furthermore, receptor mediated transport (RMT)-based bispecific targeting technology opens the door for a wide range of potential therapeutics for CNS diseases.
  • RMT receptor mediated transport
  • the invention provides methods of engineering BBB-penetrant therapeutics that greatly improve transport across the BBB and CNS distribution of the therapeutic without depletion of reticulocytes.
  • an isolated multispecific antibody that binds to human transferrin receptor (TfR) and primate TfR is provided, wherein the antibody does not inhibit the binding of transferrin to TfR, and wherein the antibody also binds BACE1.
  • the binding is specific binding.
  • one or more properties of the antibody have been modified to reduce or eliminate the impact of the antibody on reticulocytes and/or reduce the severity or presence of acute clinical symptoms in a subject or mammal treated with the antibody.
  • the antibody further does not inhibit the binding of human hemachromatosis protein ("HFE") to TfR.
  • the binding is specific binding.
  • the antibody is a monoclonal antibody.
  • the antibody is a human antibody. In another aspect, the antibody is a humanized antibody. In another aspect, the antibody is a chimeric antibody. In another aspect, the antibody is an antibody fragment that binds human TfR and primate TfR, and also binds BACE1. In another aspect, the primate TfR is from cynomolgous monkey.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 31, 33 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 36, 38 and 39.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 36, 40 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR- L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs:42, 43 and 44.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 31, 33 and 34.
  • the anti- TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 46, 48 and 49.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs:52, 54 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 52, 58 and 59.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 62, 63 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs:52, 65 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR- L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 68, 69 and 70.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 73, 75 and 76.
  • the anti- TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 79, 81 and 82.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 79, 83 and 84.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 87, 89 and 90.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 93, 95 and 96.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 99, 101 and 102.
  • the anti-TfR arm of the multispecific antibody comprises HVR- L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 127, 33 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 52, 156 and 55.
  • the anti- TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 52, 157 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 155, 54 and 55
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2 and HVR-H3, respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 38 and 39.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 40 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR- Hl, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 43 and 44.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34.
  • the anti- TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 47, 48 and 49.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 54 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 58 and 59.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 63 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 65 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR- Hl, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 69 and 70.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 74, 75 and 76.
  • the anti- TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 81 and 82.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 83 and 84.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 88, 89 and 90.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 94, 95 and 96.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 100, 101 and 102.
  • the anti-TfR arm of the multispecific antibody comprises HVR- Hl, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 156 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 157 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 35, 30 and 36.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 41, 30 and 42.
  • the anti-TfR arm of the multispecific antibody comprises HVR- Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 45, 30 and 46.
  • the anti- TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 56, 57 and 52.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 61 and 62.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 64 and 52.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 66, 67 and 68.
  • the anti-TfR arm of the multispecific antibody comprises HVR- Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 71, 72 and 73.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs:77, 78 and 79.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 85, 86 and 87.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 91, 92 and 93.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 97, 98 and 99.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 127.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 155.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31 and HVR-H1, HVR-H2 and HVR-H3, respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 35, 30 and 36 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 38 and 39.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 35, 30 and 36 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 40 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 41, 30 and 42 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 43 and 44
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 45, 30 and 46 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 47, 48 and 49.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 54 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 56, 57 and 52 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 58 and 59.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 61 and 62 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 63 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 64 and 52 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 65 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 66, 67 and 68 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 69 and 70.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 71, 72 and 73 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 74, 75 and 76.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs:77, 78 and 79 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 81 and 82.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2 and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 77, 78 and 79, and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 83 and 84.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 85, 86 and 87 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 88, 89 and 90.
  • the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 91, 92 and 93 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 94, 95 and 96.
  • the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 97, 98 and 99 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 100, 101 and 102.
  • the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 127 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34.
  • the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 156 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR- Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 157 and 55.
  • the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 155 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 54 and 55.
  • the anti-TfR arm of the multispecific antibody comprises at least one HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, or HVR-L3 sequence selected from the group of sequences consisting of an HVR-Hl sequence of SEQ ID NO: 47, 53, or 100; an HVR-H2 sequence of SEQ ID NO: 48, 69, 101, 156 or 157;an HVR-H3 sequence of SEQ ID NO: 49, 76, or 102; an HVR-Ll sequence of SEQ ID NO: 45, 66 or 97; an HVR-L2 sequence of SEQ ID NOs: 30, 67 or 98; and an HVR-L3 sequence of SEQ ID NOs: 46, 68 or 102.
  • the anti-TfR arm of the multispecific antibody comprises (a) a VH sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, 15, 16, 17, 18, 20, 25, 26, 27, 28, 108, 114, 120, 126, 403, or 404; (b) a VL sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4, 5, 6, 11, 12, 13, 14, 19, 21, 22, 23, 24, 105, 111, 117, 123, 401, or 402; or (c) a VH sequence as in (a) and a VL sequence as in (b).
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 4 and a VH sequence of SEQ ID NO: 7. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 5 and a VH sequence of SEQ ID NO: 8. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 5 and a VH sequence of SEQ ID NO: 9. In another such aspect, the anti-Tf arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 6 and a VH sequence of SEQ ID NO: 10.
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 11 and a VH sequence of SEQ ID NO: 15. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 12 and a VH sequence of SEQ ID NO: 16. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 13 and a VH sequence of SEQ ID NO: 17. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 14 and a VH sequence of SEQ ID NO: 18.
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 19 and a VH sequence of SEQ ID NO: 20. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 25. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 22 and a VH sequence of SEQ ID NO: 26. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 23 and a VH sequence of SEQ ID NO: 27.
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 24 and a VH sequence of SEQ ID NO: 28. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 105 and a VH sequence of SEQ ID NO: 108. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO:
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 111 and a VH sequence of SEQ ID NO: 114.
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 117 and a VH sequence of SEQ ID NO: 120.
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 123 and a VH sequence of SEQ ID NO: 126.
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 105 and a VH sequence of SEQ ID NO: 403. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 401 and a VH sequence of SEQ ID NO: 403. In another such aspect, the antibody comprises a VL sequence of SEQ ID NO: 105 and a VH sequence of SEQ ID NO: 404. In another such aspect, the antibody comprises a VL sequence of SEQ ID NO: 401 and a VH sequence of SEQ ID NO: 404. In another such aspect, the antibody comprises a VL sequence of SEQ ID NO:
  • the anti-TfR arm of the multispecific antibody comprises a VH sequence of (a) SEQ ID NO: 108, (b) SEQ ID NO: 114, (c) SEQ ID NO: 120, (d) SEQ ID NO: 126, (e) SEQ ID NO: 403, or (f) SEQ ID NO: 404.
  • the anti-TfR arm of the multispecific antibody comprises a VL sequence of (a) SEQ ID NO: 105, (b) SEQ ID NO: 111, (c) SEQ ID NO: 117, (d) SEQ ID NO: 123, (e) SEQ ID NO: 401, or (f) SEQ ID NO: 402.
  • the anti-TfR arm of the multispecific antibody is selected from the group consisting of antibodies 7A4, 8A2, 15D2, 10D11, 7B10, 15G11, 16G5, 13C3, 16G4, 16F6, 7G7, 4C2, 1B12, and 13D4.
  • the anti-TfR arm of the multispecific antibody is 7A4.
  • the anti-TfR arm of the multispecific antibody is 8A2.
  • the anti-TfR arm of the multispecific antibody is 15D2.
  • the anti-TfR arm of the multispecific antibody is 10D11.
  • the anti-TfR arm of the multispecific antibody is 7B10.
  • the anti- TfR arm of the multispecific antibody is 15G11. In another such aspect, the anti-TfR arm of the multispecific antibody is 16G5. In another such aspect, the anti-TfR arm of the multispecific antibody is 13C3. In another such aspect, the anti-TfR arm of the multispecific antibody is 16G4. In another such aspect, the anti-TfR arm of the multispecific antibody is 16F6. In another such aspect, the anti-TfR arm of the multispecific antibody is 7G7. In another such aspect, the anti-TfR arm of the multispecific antibody is 4C2. In another such aspect, the anti-TfR arm of the multispecific antibody is IB 12. In another such aspect, the anti-TfR arm of the multispecific antibody is 13D4.
  • the antibody is further affinity matured.
  • the anti-TfR arm of the multispecific antibody is selected from the group consisting of 15Gl l .vl, 15Gl l .v2, 15Gl l .v3, 15Gl l .v4, 15Gl l .v5, 7A4.vl; 7A4.v2, 7A4.v3, 7A4.v4, 7A4.v5, 7A4.v6, 7A4.v7, 7A4.v8, 7A4.v9, 7A4.vlO, 7A4.vl l, 7A4.vl2, 7A4.vl3, 7A4.vl4, 7A4.vl5, 7G7.vl, 16F6.vl, 16F6.v2, 16F6.v3, 16F6.v4, 15G11.N52A, 15G11.T53A and 15G11.W92A.
  • the anti-TfR arm of the multispecific antibody is 15G11.vl . In another such aspect, the anti-TfR arm of the multispecific antibody is 15G1 l.v2. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.v3. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.v4. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.v5. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl . In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v2. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v3.
  • the anti-TfR arm of the multispecific antibody is 7A4.v4. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v5. In another such aspect, the anti- TfR arm of the multispecific antibody is 7A4.v6. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v7. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v8. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v9. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vlO. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl 1.
  • the anti-TfR arm of the multispecific antibody is 7A4.vl2. In another such aspect, the anti- TfR arm of the multispecific antibody is 7A4.vl3. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl4. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl5. In another such aspect, the anti-TfR arm of the multispecific antibody is 7G7.vl . In another such aspect, the anti-TfR arm of the multispecific antibody is 16F6.vl. In another such aspect, the anti-TfR arm of the multispecific antibody is 16F6.v2.
  • the anti-TfR arm of the multispecific antibody is 16F6.v3. In another such aspect, the anti- TfR arm of the multispecific antibody is 16F6.v4. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.N52A. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.T53A. In another such aspect, the antibody is 15G11.W92A.
  • the antibody is modified at one or more amino acid positions in the VH or VL to the amino acid indicated for that position in Figures 4E-1 and 4E-2.
  • the anti-TfR arm of the multispecific antibody comprises a sequence or one or more HVR sequences corresponding to that of or one or more of those set forth for any one of the clones in Figures 3 and 4 and Figures 4E-1 and 4E-2.
  • the anti-TfR arm of the multispecific antibody comprises a VH or VL sequence corresponding to that of set forth for any one of the clones in Figures 3 and 4 and Figures 4E-1 and 4E-2.
  • the anti-TfR arm of the multispecific antibody comprises one or more HVR sequences corresponding to one or more of those set forth for any one of the clones in Figures 3 and 4 and Figures 4E-1 and 4E-2.
  • a multispecific antibody TfR comprising a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (TfR) and primate, wherein the antibody does not inhibit the binding of transferrin to TfR; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the second antigen binding site comprises:
  • a multispecific antibody comprising a first half antibody comprising a first antigen binding site that binds to human TfR and primate TfR, wherein the antibody does not inhibit the binding of transferrin to TfR, and wherein one or more properties of the antibody have been modified to reduce or eliminate the impact of the antibody on reticulocytes and/or reduce the severity or presence of acute clinical symptoms in a subject or mammal treated with the antibody; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the second antigen binding site comprises:
  • the second antigen binding site comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody selected from the antibodies in Table 1.
  • the antibody from Table 1 is antibody 6266.
  • the antibody comprises an HVR-Hl of SEQ ID NO: 15; an HVR-H2 sequence of SEQ ID NO: 29; an HVR-H3 sequence of SEQ ID NO: 52; an HVR-Ll sequence of SEQ ID NO: 65; an HVR-L2 sequence of SEQ ID NO: 71; and an HVR-L3 sequence of SEQ ID NO: 80.
  • the second binding site comprises:
  • a heavy chain variable region sequence having at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374; or
  • a light chain variable region sequence having at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366; or c) a heavy chain variable region sequence as in (a) and a light chain variable domain sequence as in (b).
  • the second binding site comprises:
  • a heavy chain variable region sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374; or
  • the second binding site comprises:
  • a heavy chain variable domain sequence having at least 90% sequence identity to a sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374; or
  • the second binding site comprises:
  • a heavy chain variable domain sequence having a sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374; or
  • the isolated antibody modulates the activity of BACEl. In some embodiments, the antibody inhibits the activity of BACEl . In some embodiments, BACEl activity is measured using a homogeneous time-resolved fluorescence (HTRF) assay. In some embodiments, BACEl activity is measured using a cell line that expresses a BACEl substrate. In some embodiments, the BACEl substrate is amyloid precursor protein (APP). In some embodiments, BACEl activity is measured in tissue from an animal that has been administered the multispecific antibody. In some embodiments, the tissue is brain tissue. In some embodiments, the animal is selected from a mouse, rat, rabbit, dog, monkey, and non-human primate.
  • HTRF homogeneous time-resolved fluorescence
  • APP amyloid precursor protein
  • the antibody is an allosteric inhibitor of BACEl activity.
  • the antibody binds BACEl with an affinity (KD) of between 0.1 nM and 10 nM, or between 0.1 nM and 8 nM, or between 0.1 nM and 7 nM, or between 0.1 nM and 5 nM, or between 0.5 nM and 5 nM, or between 0.1 nM and 3 nM, or between 0.5 nM and 3 nM, as measured by surface plasmon resonance (SP ).
  • the antibody achieves a maximum inhibition of BACE1 activity of greater than 60%, greater than 70%, greater than 75%, or greater than 80%, as measured, for example, using the dissociated cortical neuron culture assay.
  • the one or more properties of the multispecific antibody are selected from the effector function of the antibody Fc region, the complement activation function of the antibody and the affinity of the antibody for TfR and/or BACE1.
  • the property is the effector function of the antibody Fc region.
  • the property is the complement activation function of the antibody.
  • the property is the affinity of the antibody for TfR and/or BACE1.
  • the effector function or complement activation function has been reduced or eliminated relative to a wild-type antibody of the same isotype.
  • the effector function is reduced or eliminated by a method selected from reduction of glycosylation of the antibody, modification of the antibody isotype to an isotype that naturally has reduced or eliminated effector function, and modification of the Fc region.
  • the effector function is reduced or eliminated by reduction of glycosylation of the antibody.
  • the glycosylation of the antibody is reduced by a method selected from: production of the antibody in an environment that does not permit wild-type glycosylation; removal of carbohydrate groups already present on the antibody; and modification of the antibody such that wild-type glycosylation does not occur.
  • the glycosylation of the antibody is reduced by a production of the antibody in an environment that does not permit wild-type glycosylation, such as production in a non-mammalian cell production system or where the antibody is produced synthetically.
  • the antibody is produced in a non-mammalian cell production system.
  • the antibody is produced synthetically.
  • the glycosylation of the antibody is reduced by modification of the antibody such that wild-type glycosylation does not occur, such as wherein the Fc region of the antibody comprises a mutation at position 297 such that the wild-type asparagine residue at that position is replaced with another amino acid that interferes with glycosylation at that position.
  • the effector function is reduced or eliminated by at least one modification of the Fc region.
  • the effector function or complement activation function is reduced or eliminated by deletion of all or a portion of the Fc region, or by engineering the antibody such that it does not include an Fc region or non-Fc region competent for effector function or complement activation function.
  • the at least one modification of the Fc region is selected from: a point mutation of the Fc region to impair binding to one or more Fc receptors selected from the following positions: 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 297, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438, and 439; a point mutation of the Fc region to impair binding to Clq selected from the following positions: 270, 322, 329, and 321; eliminating some or all of the Fc region, and a point mutation at position 132 of the CHI domain.
  • the modification is a point mutation of the Fc region to impair binding to Clq selected from the following positions: 270, 322, 329, and 321.
  • the modification is elimination of some or all of the Fc region.
  • complement- triggering function is reduced or eliminated by deletion of all or a portion of the Fc region, or by engineering the antibody such that it does not include an Fc region that engages the complement pathway.
  • the antibody is selected from a Fab or a single chain antibody.
  • the non-Fc region of the antibody is modified to reduce or eliminate activation of the complement pathway by the antibody.
  • the modification is a point mutation of the CHI region to impair binding to C3.
  • the point mutation is at position 132 (see, e.g., Vidarte et al., (2001) J. Biol. Chem. 276(41): 38217-38223).
  • the antibody the half-life of the antibody is increased by a modification in the FcRn binding region.
  • the modification is a substitution in an amino acid selected from the following positions: 251 256, 285, 290, 308, 314, 385, 389, 428, 434, 436, 238, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434.
  • the modification is a substitution selected from the following: M252Y, S254T, T256E, N434A and Y436I.
  • the antibody is combined with a further compound that mitigates or contributes to the reduction of impact on reticulocyte levels or acute clinical symptoms.
  • the further compound protects reticulocytes from antibody-related depletion or supports the growth, development, or reestablishment of reticulocytes.
  • the further compound is selected from erythropoietin (EPO), an iron supplement, vitamin C, folic acid, and vitamin B12, or is red blood cells or reticulocytes.
  • the affinity of the antibody for Tf is decreased, as measured relative to a wild-type antibody of the same isotype not having lowered affinity for TfR.
  • the antibody has a KD or IC50 for Tf of about 1 pM to about 100 ⁇ .
  • the dose amount and/or frequency of administration of the antibody is modulated to reduce the concentration of the antibody to which the red blood cells are exposed.
  • the antibody is coupled to a therapeutic compound.
  • the antibody is coupled to an imaging agent or a label.
  • the antibody is a multispecific antibody and the therapeutic compound optionally forms one portion of the multispecific antibody comprising a first antigen binding site that binds Tf and a second antigen binding site that binds BACE1.
  • the multispecific antibody is an IgG antibody. In some embodiments, the multispecific antibody is an IgG antibody.
  • the antibody is an IgGl or IgG4 antibody. In some embodiments, the antibody is an IgGl antibody. In some embodiments, the antibody comprises a first heavy chain constant region and a second heavy chain constant region, wherein the first heavy chain constant region comprises a knob mutation and the second heavy chain constant region comprises a hole mutation. In some embodiments, the first heavy chain constant region is fused to the first antigen binding site. In some embodiments, the second heavy chain constant region is fused to the second antigen binding site. In some embodiments, the first heavy chain constant region is fused to the second antigen binding site. In some embodiments, the second heavy chain constant region is fused to the first antigen binding site.
  • the antibody is an IgGl antibody and wherein the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgGl antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V. In some embodiments, the antibody is an IgG4 antibody and wherein the knob mutation comprises a T366W mutation.
  • the antibody is an IgG4 antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations.
  • a multispecific antibody comprising a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (Tf ) and primate, wherein the antibody does not inhibit the binding of transferrin to TfR; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein:
  • the first heavy chain and the first light chain are selected from SEQ ID NOs: 329 and 330, SEQ ID NOs: 333 and 334, SEQ ID NOs: 337 and 338, SEQ ID NOs: 341 and 342, and SEQ ID NOs: 394 and 342; and
  • the second heavy chain and the second light chain are selected from SEQ ID NOs:
  • SEQ ID NOs: 335 and 336 SEQ ID NOs: 339 and 340, and SEQ ID NOs: 343 and 344.
  • the antibody comprises:
  • the first heavy chain and the first light chain are selected from SEQ ID NOs: 333 and 334, SEQ ID NOs: 341 and 342, and SEQ ID NOs: 394 and 342; and b) the second heavy chain and the second light chain are selected from SEQ ID NOs:
  • a multispecific antibody comprises a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (Tf ) and primate Tf , and a second half antibody comprising a second antigen binding site that binds BACE1, wherein:
  • the first half antibody comprises a first heavy chain having the sequence of SEQ ID NO: 394 and a first light chain having the sequence of SEQ ID NO: 342, and the second half antibody comprises a second heavy chain having the sequence of SEQ ID NO: 343 and a second light chain having the sequence of SEQ ID NO: 344; or b) the first half antibody comprises a first heavy chain variable region comprising the sequence of SEQ ID NO: 396 and a first light chain variable region comprising the sequence of SEQ ID NO: 398, and the second half antibody comprises a second heavy chain variable region comprising the sequence of SEQ ID NO: 399 and a second light chain variable region comprising the sequence of SEQ ID NO: 400.
  • the multispecific antibody comprises a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (TfR) and primate TfR, and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the first half antibody comprises a first heavy chain variable region comprising the sequence of SEQ ID NO: 395 and a first light chain variable region comprising the sequence of SEQ ID NO: 397, and the second half antibody comprises a second heavy chain variable region comprising the sequence of SEQ ID NO: 399 and a second light chain variable region comprising the sequence of SEQ ID NO: 400.
  • TfR human transferrin receptor
  • the invention provides an isolated nucleic acid encoding any of the foregoing antibodies.
  • the invention provides a host cell comprising such nucleic acid.
  • the invention provides a method of producing any of the foregoing antibodies comprising culturing such host cell so that the antibody is produced and optionally further comprising recovering the antibody from the host cell.
  • the invention provides a pharmaceutical formulation comprising any of the foregoing antibodies and a pharmaceutically acceptable carrier.
  • the invention provides any of the foregoing antibodies for use as a medicament.
  • the invention provides the use of any of the foregoing antibodies in the manufacture of a medicament for treating a neurological disorder.
  • the neurological disorder is selected from the group consisting of a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder, and CNS inflammation.
  • the invention provides any of the foregoing antibodies for use in treating a neurological disorder.
  • the neurological disorder is selected from the group consisting of a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder, and CNS inflammation.
  • the invention provides any of the foregoing antibodies for use in transporting one or more compounds across the BBB.
  • use of any of the foregoing antibodies in the manufacture of a medicament for transporting one or more compounds across the BBB is provided.
  • a method of transporting a compound across the BBB in a subject comprising exposing any of the foregoing antibodies to the BBB such that the antibody transports the compound coupled thereto across the BBB.
  • the BBB is in a human subject.
  • the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which red blood cells are exposed.
  • the method further comprises the step of monitoring the subject for depletion of red blood cells.
  • the antibody coupled to the compound is administered at a therapeutic dose.
  • the therapeutic dose is Tf -saturating.
  • administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
  • a method of increasing exposure of the CNS of a subject to a compound comprising exposing any of the foregoing antibodies to the BBB such that the antibody transports the compound coupled thereto across the BBB.
  • the BBB is in a human subject.
  • the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which red blood cells are exposed.
  • the method further comprises the step of monitoring the subject for depletion of red blood cells.
  • the antibody coupled to the compound is administered at a therapeutic dose.
  • the therapeutic dose is Tf -saturating.
  • administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
  • a method of increasing rentention in the CNS of a compound administered to a subject comprising exposing any of the foregoing antibodies to the BBB such that the retention in the CNS of the compound is increased.
  • the BBB is in a human subject.
  • the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which red blood cells are exposed.
  • the method further comprises the step of monitoring the subject for depletion of red blood cells.
  • the antibody coupled to the compound is administered at a therapeutic dose.
  • the therapeutic dose is Tf -saturating.
  • administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
  • a method of treating a neurological disorder in a mammal comprising treating the mammal with any of the foregoing antibodies.
  • the neurological disorder is selected from the group consisting of a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder, and CNS inflammation.
  • the neurological disorder is in a human subject.
  • the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which the re blood cells are exposed.
  • the method further comprises the step of monitoring the subject for depletion of red blood cells.
  • the antibody coupled to the compound is administered at a therapeutic dose.
  • the therapeutic dose is Tf -saturating.
  • administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
  • the invention provides an isolated multispecific antibody comprising an anti-Tf arm that binds to the same epitope on Tf as an antibody selected from the group consisting of antibodies 7A4, 8A2, 15D2, 10D11, 7B10, 15G11, 16G5, 13C3, 16G4, 16F6, 7G7, 4C2, 1B12, 13D4, 15Gl l.vl, 15Gl l.v2, 15Gl l.v3, 15Gl l.v4, 15Gl l .v5, 7A4.vl ; 7A4.v2, 7A4.v3, 7A4.v4, 7A4.v5, 7A4.v6, 7A4.v7, 7A4.v8, 7A4.v9, 7A4.vlO, 7A4.vl l, 7A4.vl2, 7A4.vl3, 7A4.vl4, 7A4.vl5, 7G7.vl, 16F6.v2, 16F6.v3, 16F6.
  • a method of decreasing clearance of a compound administered to a subject wherein the compound is coupled to an antibody which binds with low affinity to TfR, such that the clearance of the compound is decreased, and wherein reduction of red blood cell levels in the subject upon compound-coupled antibody administration to the subject is decreased or eliminated.
  • pharmacodynamics of a compound to be efficacious in the CNS in a subject wherein the compound is coupled to an antibody which binds with low affinity to TfR, and the antibody is selected such that its affinity for TfR after coupling to the compound results in an amount of transport of the antibody conjugated to the compound across the BBB that optimizes the pharmacokinetics and/or pharmacodynamics of the compound in the CNS, wherein reduction of red blood cell levels in the subject upon compound-coupled antibody administration to the subject is decreased or eliminated.
  • Figure 1 depicts a three-dimensional crystal structure of a TfR dimer in complex with Tf, based on the pdb file 3SM9.
  • the non-Tf-binding apical region of TfR is labeled.
  • FIGS 2A-2B depict FACS analysis of mouse hybridoma parental clone supernatants binding to human and cynomolgus TfR transiently expressed in 293 cells in the presence of 1 ⁇ human holo-Tf.
  • the filled grey trace in each graph is background from the detection antibody
  • the medium grey trace is binding to 293 cells that endogenously express basal levels of human TfR
  • the bold black trace represents binding to transiently expressed human
  • TfR and the thin grey trace represents binding to transiently expressed cyno TfR.
  • Figure 2C depicts the results of human/cynomolgous cross-reactive antibody competition assays as described in Example 1. Nine of the fourteen clones were found to block binding of the apical binding antibody displayed on phage.
  • Figures 3A-1, 3A-2, 3B-1, 3B-2, 3C-1, 3C-2, 3D-land 3D-2 depict the heavy and light chain variable region sequences of hybridoma clones that bind to apical and non-apical regions of TfR.
  • the sequences can be further subdivided by epitope and sequence similarity into class I-III (apical binders) and class IV (non-apical binders).
  • the HVRs according to Kabat are indicated by underlining.
  • Figures 4A-1, 4A-2, 4B-1, 4B-2, 4C-1, 4C-2, 4D-1 and 4D-2 depict alignments of humanized sequences for (A) 15G11, (B) 7A4/8A2, (C) 7G7 and (D) 16F6.
  • Each mouse light or heavy variable domain sequence (second line) is aligned to the closest human germline or consensus variable domain (first line).
  • the humanized version for each antibody is shown at the bottom (third line). Differences from the human germline or consensus sequences are shaded.
  • HVR sequences that were grafted into the human framework are boxed. CDR definitions according to Kabat are indicated.
  • Figure 4E-1 and 4E-2 show that for the class I-III groups of antibodies, variant forms of the antibodies with modifications at one or more residues of an FR retained affinity and binding specifity.
  • Figure 5 depicts the binding of hu7A4.vl 5, hul 5G11.v5 and hu7G7.vl to huTfR in the presence of 6.3 ⁇ holo-Tf.
  • Antibody binding to immobilized huTfR is shown in the presence (open sybols and dashed lines) or absence (filled symbols and solid lines) of 6.3 ⁇ holo-Tf.
  • Figures 6A-B depict the results of the HFE - HuTfR binding and the HFE blocking assays described in Example 1.
  • Figure 6A shows the binding of antibody to increasing concentrations of huTfR captured via immobilized HFE.
  • Figure 6B shows the binding of huTfR to immobilized HFE in the presence of increasing concentrations of antibody.
  • Figure 7A-B depict binding analyses of 15G1 l.v5 and 7A4.v5 IgG and Fab Ala variants on cyno and human TfR, demonstrating the effects on affinity of Ala mutations in CDR-L3 and CDR- H3 of each antibody assessed as IgG by ELISA binding and IgG or Fab by SPR analysis to immobilized human or cyno TfR, as described in Example 2.
  • Figures 8A-B and Figures 9A-B depict the results of experiments assessing the impact of effector function status on ADCC activity of anti-human TfR ("anti-hTFR”) antibodies in primary human bone marrow mononuclear cells or in a human erythroblast cell line, as described in Example 4.
  • anti-hTFR anti-human TfR
  • Figure 10 depicts the dosing and sampling scheme for the primate study described in Example 5.
  • Figures 11 A-l IB depict the pharmacokinetic results of the experiments described in Example 5, specifically individual and group mean anti-TfRVBACEl, anti-TfR 2 /BACEl and anti- gD serum concentrations versus time following a single IV bolus administration at 30 mg/kg in cynomolgus monkeys in serum ( Figure 11A) and CSF ( Figure 1 IB).
  • Figures 12A-12E depict the pharmacodynamic results of the experiments described in Example 5, specifically individual and group mean anti-TfRVBACEl, anti-TfR 2 /BACEl and anti- gD plasma (A) or CSF (B-E) concentrations versus time following a single IV bolus administration at 30 mg/kg in cynomolgus monkeys.
  • the upper panels show Abetal-40 levels in plasma (Figure 12A) and CSF ( Figure 12B), while the lower panels show soluble APPa levels (Figure 12C), soluble ⁇ levels ( Figure 12D), and sAPPp/sAPPa ratio (Figure 12E) over time.
  • Figures 13A-13D depict the results of hematological sampling performed during the studies described in Example 5. At each of the indicated time points, total reticulocytes (Figure 13 A), red blood cells (Figure 13B), hemoglobin (Figure 13D) and the percentage of immature reticulocytes in the total reticulocyte pool ( Figure 13C) were measured using standard techniques.
  • Figure 14 depicts the dosing and sampling scheme for the primate study described in Example 6.
  • Figures 15A-15B depict the pharmacodynamic results (A) and brain antibody
  • Figure 15A shows individual and group mean anti-TfRVBACEl, anti-TfR 2 /BACEl , anti-gD, and anti-BACEl ration of sAPPp/sAPPa in CSF versus time following a single IV bolus administration at 30 mg/kg in cynomolgus monkeys.
  • Figure 15B show individual anti-TfRVBACEl , anti-TfR 2 /BACEl , anti- gD, and anti-BACEl concentrations of antibody in various brain regions at 24 hours post-dose.
  • Figures 16A-B depict the light and heavy chain amino acid sequences of anti-BACEl clone YW412.8 obtained from a na ' ive sort of the natural diversity phage display library and affinity- matured forms of YW412.8.
  • Fig. 16A depicts the variable light (VL) sequence alignments (SEQ ID NOs. 132-137).
  • Fig. 16B depicts the variable heavy (VH) sequence alignments (SEQ ID Nos. 138-139).
  • the HVR sequences for each clone are indicated by the boxed regions, with the first box indicating HVR-Ll (Fig. 16A) or HVR-Hl (Fig. 16B), the second box indicating HVR-L2 (Fig. 16A) or HVR-H2 (Fig. 16B), and the third box indicating HVR-L3 (Fig. 16A) or HVR-H3 (Fig. 16B).
  • Figure 17 depicts the pharmacokinetic properties of the murine IgG2a Anti-TfR D /BACEl and Anti-gD antibodies with the Fc effector function LALAPG mutations as described in Example 7.
  • Figure 18 depicts the total and immature reticulocyte count in mice 24 hours after administration of a 50mg/kg dose of the murine IgG2a Anti-TfR D /BACEl and Anti-gD antibodies with the Fc effector function LALAPG mutations as described in Example 7.
  • Figure 19 depicts the heavy and light chain variable region sequences of 15G1 lv.5 (light chain - SEQ ID NO: 401 and heavy chain - SEQ ID NO: 108) and affinity variants 15G11.52A (light chain - SEQ ID NO: 401 and heavy chain - SEQ ID NO: 403), 15G11.53A (light chain - SEQ ID NO: 401 and heavy chain - SEQ ID NO: 404) and 15G1 1.92A (light chain - SEQ ID NO: 402 and heavy chain - SEQ ID NO: 108).
  • the HVRs according to Kabat are indicated by underlining.
  • Figure 20 depicts a competition assay between 15G1 lv.5 and anti-TfR cl2 as described in Example 1.
  • Figures 21A-21D show the epitope bin and heavy chain HVR-Hl , HVR-H2, and HVR-H3 sequences of certain anti-BACEl antibodies described herein.
  • Figures 22A-22C show the epitope bin and light chain HVR-Ll, HVR-L2, and HVR-L3 sequences of certain anti-BACEl antibodies described herein.
  • Figures 23A-23G show the epitope bin and heavy chain variable region (VH) sequences of certain anti-BACEl antibodies described herein.
  • Figures 24A-24F show the epitope bin and light chain variable region (VL) sequences of certain anti-BACEl antibodies described herein.
  • Figures 25A-25D show the affinity (KD) of certain anti-BACEl antibodies for human BACEl at pH 7.5 (column 2), murine BACEl at pH 7.5 (column 3), human BACEl at pH 5.0 (column 4), and murine BACEl at pH 5.0 (column 5) using an Octet® system (ForteBio); and the affinity (KD) of certain anti-BACEl antibodies for human BACEl by surface plasmon resonance (BiacoreTM). For certain antibodies, affinities deteremined in two separate assays are shown.
  • Figure 26 shows modulation of BACEl activity by the anti-BACEl antibodies using a short substrate assay.
  • Figures 27A-27B shows modulation of BACEl activity by the anti-BACEl antibodies using a long substrate assay and a short substrate assay.
  • Figures 28A-28C show in vitro modulation of APP processing in cells by the anti-BACEl antibodies.
  • Figure 29 shows inhibition of BACEl activity in mouse cortical neurons with anti-BACEl antibody 6266, anti-BACEl antibody YW412.8.13, and bispecific antibodies Tf 2 /6266 and Tf 2 /YW412.8.31.
  • Figure 30 shows plasma pharmacokinetics (PK) in mice following a 25 mg/kg intravenous dose or bispecific antibody Tf D /YW412.8.31 or bispecific antibody Tf D /6266.
  • Figures 31 A and 3 IB show brain (A) pharmacokinetics and (B) pharmacodynamics in mice following a 25 mg/kg intravenous dose or bispecific antibody Tf D /YW412.8.31 or bispecific antibody Tf D /6266.
  • Figures 32A and 32B show (A) pharmacokinetics and (B) pharmacodynamics in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibody Tf VYW412.8.31 or bispecific antibody Tf V6266.
  • Figure 33 depicts the dosing and sampling scheme for the primate study described in Example 14.
  • Figures 34A and 34B show pharmacokinetics in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibodies (A) Tf 2 /6266 or Tf 2 /6266 FcRn HIGH , or (B) Tf 52A /6266 or Tf 52A /6266 FcRn HIGH .
  • Figures 35A and 35B show pharmacodynamics in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibodies (A) Tf 2 /6266 or Tf 2 /6266 FcRnHigh, or (B) TfR 52A /6266 or TfR 52A /6266 FcRnHigh.
  • Figure 36A-B show reticulocyte levels in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibodies TfR 2 /6266, TfR 2 /6266 FcRnHigh, TfR 52A /6266, or TfR 52A /6266 FcRnHigh, or control antibody.
  • Figure 37A-B show the (A) light chain variable region sequences and (B) heavy chain variable region sequences of the affinity -matured variants 1-7 of antibody 6266.
  • Figure 38A-B show the (A) light chain variable region sequences and (B) heavy chain variable region sequences of the affinity -matured variants 8-15 of antibody 6266.
  • Figure 39 shows affinity constants and melting temperature for the affinity-matured variants of antibody 6266.
  • Binding affinity refers to intrinsic binding affinity which reflects a 1 :1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD, which is a ratio of the off-rate of X from Y (kd or Koff) to the on-rate of X to Y (ka or kon)).
  • a surrogate measurement for the affinity of one or more antibodies for its target is its half maximal inhibitory concentration (IC50), a measure of how much of the antibody is needed to inhibit the binding of a known ligand to the antibody target by 50%.
  • IC50 half maximal inhibitory concentration
  • Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described herein.
  • the "blood-brain barrier” or “BBB” refers to the physiological barrier between the peripheral circulation and the brain and spinal cord (i.e., the CNS) which is formed by tight junctions within the brain capillary endothelial plasma membranes, creating a tight barrier that restricts the transport of molecules into the brain, even very small molecules such as urea (60 Daltons).
  • the blood-brain barrier within the brain, the blood-spinal cord barrier within the spinal cord, and the blood-retinal barrier within the retina are contiguous capillary barriers within the CNS, and are herein collectively referred to a the blood-brain barrier or BBB.
  • the BBB also encompasses the blood-CSF barrier (choroid plexus) where the barrier is comprised of ependymal cells rather than capillary endothelial cells.
  • amyloid beta refers to the fragment of amyloid precursor protein (“APP) that is produced upon ⁇ -secretase 1 (“BACEl”) cleavage of APP, as well as modifications, fragments and any functional equivalents thereof, including, but not limited to, ⁇ 1-40, and ⁇ 1-42.
  • APP amyloid precursor protein
  • BACEl ⁇ -secretase 1
  • is known to exist in monomeric form, as well as to associate to form oligomers and fibril structures, which may be found as constituent members of amyloid plaque.
  • ⁇ peptides are well known to one of ordinary skill in the art and methods of producing said peptides or of extracting them from brain and other tissues are described, for example, in Glenner and Wong, Biochem Biophys Res. Comm. 129: 885-890 (1984). Moreover, ⁇ peptides are also commercially available in various forms.
  • Anti-Abeta immunoglobulin "anti-Abeta antibody”
  • Abeta are used interchangeably herein, and refer to an antibody that specifically binds to human Abeta.
  • a nonlimiting example of an anti-Abeta antibody is crenezumab.
  • Other non-limiting examples of anti-Abeta antibodies are solanezumab, bapineuzumab, gantenerumab, aducanumab, ponezumab, and any anti-Abeta antibodies disclosed in the following publications:
  • crenezumab and “MABT5102A” are used interchangeably herein, and refer to a specific anti-Abeta antibody that binds to monomeric, oligomeric, and fibril forms of Abeta, and which is associated with CAS registry number 1095207.
  • Apolipoprotein E4 carrier or "ApoE4 carrier,” used interchangeably herein with
  • apolipoprotein E4 positive or "ApoE4 positive,” refers to an individual having at least one apolipoprotein E4 (or "ApoE4") allele.
  • An individual with zero ApoE4 alleles is referred to herein as being "ApoE4 negative” or an "ApoE4 non-carrier.” See also Prekumar, et al., 1996, Am. J Pathol. 148:2083-95.
  • Cerebral vasogenic edema refers to an excess accumulation of intravascular fluid or protein in the intracellular or extracellular spaces of the brain. Cerebral vasogenic edema is detectable by, e.g., brain MRI, including, but not limited to FLAIR MRI, and can be asymptomatic ("asymptomatic vasogenic edema") or associated with neurological symptoms, such as confusion, dizziness, vomiting, and lethargy (“symptomatic vasogenic edema”) (see Sperling et al. Alzheimer's & Dementia, 7:367, 2011).
  • Cerebral macrohemorrhage refers to an intracranial hemorrhage, or bleeding in the brain, of an area that is more than about 1 cm in diameter. Cerebral
  • macrohemorrhage is detectable by, e.g., brain MRI, including but not limited to T2*-weighted GRE MRI, and can be asymptomatic ("asymptomatic macrohemorrhage") or associated with symptoms such as transient or permanent focal motor or sensory impairment, ataxia, aphasia, and dysarthria (“symptomatic macrohemorrhage”) (see, e.g., Chalela JA, Gomes J. Expert Rev.
  • Cerebral microhemorrhage refers to an intracranial hemorrhage, or bleeding in the brain, of an area that is less than about 1 cm in diameter. Cerebral microhemorrhage is detectable by, e.g., brain MRI, including, but not limited to T2*-weighted GRE MRI, and can be asymptomatic ("asymptomatic microhemorrhage") or can potentially be associated with symptoms such as transient or permanent focal motor or sensory impairment, ataxia, aphasia, and dysarthria ("symptomatic microhemorrhage"). See, e.g., Greenberg, et al., 2009, Lancet Neurol. 8:165-74.
  • sulcal effusion refers to an effusion of fluid in the furrows, or sulci, of the brain. Sulcal effusions are detectable by, e.g., brain MRI, including but not limited to FLAIR MRI. Seesperling et al. Alzheimer's & Dementia, 7:367, 2011.
  • the term "superficial siderosis of the central nervous system” refers to bleeding or hemorrhage into the subarachnoid space of the brain and is detectable by, e.g., brain MRI, including but not limited to T2* -weighted GRE MRI. Symptoms indicative of superficial siderosis of the central nervous system include sensorineural deafness, cerebellar ataxia, and pyramidal signs. See Kumara-N, Am J Neuroradiol. 31 :5, 2010.
  • amyloidosis refers to a group of diseases and disorders caused by or associated with amyloid or amyloid-like proteins and includes, but is not limited to, diseases and disorders caused by the presence or activity of amyloid-like proteins in monomeric, fibril, or polymeric state, or any combination of the three, including by amyloid plaques.
  • Such diseases include, but are not limited to, secondary amyloidosis and age-related amyloidosis, such as diseases including, but not limited to, neurological disorders such as Alzheimer's Disease (“AD"), diseases or conditions characterized by a loss of cognitive memory capacity such as, for example, mild cognitive impairment (MCI), Lewy body dementia, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type), the Guam Parkinson-Demential complex and other diseases which are based on or associated with amyloid-like proteins such as progressive supranuclear palsy, multiple sclerosis, Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotropic lateral sclerosis), inclusion-body myositis (IBM), adult onset diabetes, endocrine tumor and senile cardiac amyloidosis, and various eye diseases including macular degeneration, drusen-related optic neuropathy, glaucoma, and cataract due to beta-amyloid deposition.
  • Glaucoma is a group of diseases of the optic nerve involving loss of retinal ganglion cells (RGCs) in a characteristic pattern of optic neuropathy.
  • RGCs are the nerve cells that transmit visual signals from the eye to the brain.
  • Caspase-3 and Caspase-8 two major enzymes in the apoptotic process, are activated in the process leading to apoptosis of RGCs.
  • Caspase-3 cleaves amyloid precursor protein (APP) to produce neurotoxic fragments, including Abeta.
  • APP amyloid precursor protein
  • Glaucoma is often, but not always, accompanied by an increased eye pressure, which may be a result of blockage of the circulation of aqueous, or its drainage.
  • raised intraocular pressure is a significant risk factor for developing glaucoma
  • no threshold of intraocular pressure can be defined which would be determinative for causing glaucoma.
  • the damage may also be caused by poor blood supply to the vital optic nerve fibers, a weakness in the structure of the nerve, and/or a problem in the health of the nerve fibers themselves.
  • Untreated glaucoma leads to permanent damage of the optic nerve and resultant visual field loss, which can progress to blindness.
  • micromild Alzheimer's Disease or "mild AD” as used herein (e.g., a “patient diagnosed with mild AD”) refers to a stage of AD characterized by an MMSE score of 20 to 26.
  • Mild to moderate Alzheimer's Disease or “mild to moderate AD” as used herein encompasses both mild and moderate AD, and is characterized by an MMSE score of 18 to 26.
  • moderate Alzheimer's Disease or “moderate AD” as used herein (e.g., a)
  • patient diagnosed with moderate AD refers to a stage of AD characterized by an MMSE score of 18 to 19.
  • central nervous system or “CNS” refers to the complex of nerve tissues that control bodily function, and includes the brain and spinal cord.
  • a "blood-brain barrier receptor” (abbreviated “BBB- " herein) is a transmembrane receptor protein expressed on brain endothelial cells which is capable of transporting molecules across the blood-brain barrier.
  • BBB-R include, but are not limited to: transferrin receptor (TfR), insulin receptor, insulin-like growth factor receptor (IGF-R), low density lipoprotein receptors including without limitation low density lipoprotein receptor-related protein 1 (LRP1) and low density lipoprotein receptor-related protein 8 (LRP8), glucose transporter 1 (Glutl) and heparin-binding epidermal growth factor-like growth factor (HB-EGF).
  • TfR transferrin receptor
  • IGF-R insulin-like growth factor receptor
  • LRP1 low density lipoprotein receptor-related protein 1
  • LRP8 low density lipoprotein receptor-related protein 8
  • Glutl glucose transporter 1
  • HB-EGF heparin-binding epidermal growth factor-like growth factor
  • TfR transferrin receptor
  • mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
  • the term encompasses "full-length,” unprocessed TfR as well as any form of TfR that results from processing in the cell.
  • the term also encompasses naturally occurring variants of TfR, e.g., splice variants or allelic variants.
  • TfR is a transmembrane glycoprotein (with a molecular weight of about 180,000) composed of two disulphide-bonded sub- units (each of apparent molecular weight of about 90,000) involved in iron uptake in vertebrates.
  • the TfR herein is human TfR ("hTfR") comprising the amino acid sequence as set forth in Schneider et al. Nature 311 : 675 - 678 (1984), for example (SEQ ID NO: 1).
  • the TfR herein is primate TfR ("pTfR") comprising the amino acid sequence as set forth in Genbank reference AFDl 8260.1 (SEQ ID NO: 2).
  • pTfR primate TfR
  • the mouse TfR sequence may be found in Genbank reference AAH54522.1 (SEQ ID NO: 3).
  • a "neurological disorder” as used herein refers to a disease or disorder which affects the CNS and/or which has an etiology in the CNS.
  • exemplary CNS diseases or disorders include, but are not limited to, neuropathy, amyloidosis, cancer, an ocular disease or disorder, viral or microbial infection, inflammation, ischemia, neurodegenerative disease, seizure, behavioral disorders, and a lysosomal storage disease.
  • the CNS will be understood to include the eye, which is normally sequestered from the rest of the body by the blood-retina barrier.
  • neurological disorders include, but are not limited to, neurodegenerative diseases (including, but not limited to, Lewy body disease, postpoliomyelitis syndrome, Shy-Draeger syndrome, olivopontocerebellar atrophy, Parkinson's disease, multiple system atrophy, striatonigral degeneration, tauopathies (including, but not limited to, Alzheimer disease and supranuclear palsy), prion diseases (including, but not limited to, bovine spongiform encephalopathy, scrapie, Creutzfeldt- Jakob syndrome, kuru, Gerstmann-Straussler-Scheinker disease, chronic wasting disease, and fatal familial insomnia), bulbar palsy, motor neuron disease, and nervous system heterodegenerative disorders (including, but not limited to, Canavan disease, Huntington's disease, neuronal ceroid-lipofuscinosis, Alexander's disease, Tourette's syndrome, Menkes kinky hair syndrome, Cockayne syndrome, Halervorden-Spatz syndrome, la
  • a "neurological disorder drug” is a drug or therapeutic agent that treats one or more neurological disorder(s).
  • Neurological disorder drugs of the invention include, but are not limited to, antibodies, peptides, proteins, natural ligands of one or more CNS target(s), modified versions of natural ligands of one or more CNS target(s), aptamers, inhibitory nucleic acids (i.e., small inhibitory RNAs (siRNA) and short hairpin RNAs (shRNA)), ribozymes, and small molecules, or active fragments of any of the foregoing.
  • siRNA small inhibitory RNAs
  • shRNA short hairpin RNAs
  • Exemplary neurological disorder drugs of the invention include, but are not limited to: antibodies, aptamers, proteins, peptides, inhibitory nucleic acids and small molecules and active fragments of any of the foregoing that either are themselves or specifically recognize and/or act upon (i.e., inhibit, activate, or detect) a CNS antigen or target molecule such as, but not limited to, amyloid precursor protein or portions thereof, amyloid beta, beta-secretase, gamma-secretase, tau, alpha-synuclein, parkin, huntingtin, DR6, presenilin, ApoE, glioma or other CNS cancer markers, and neurotrophins.
  • Non-limiting examples of neurological disorder drugs and the disorders they may be used to treat are provided in the following Table A: TABLE A: Non-limiting examples of neurological disorder drugs and the corresponding disorders they may be used to treat
  • imaging agent is a compound that has one or more properties that permit its presence and/or location to be detected directly or indirectly.
  • imaging agents include proteins and small molecule compounds incorporating a labeled moiety that permits detection.
  • a "CNS antigen” or "brain antigen” is an antigen expressed in the CNS, including the brain, which can be targeted with an antibody or small molecule.
  • antigens include, without limitation: beta-secretase 1 (BACE1), amyloid beta (Abeta), epidermal growth factor receptor (EGFR), human epidermal growth factor receptor 2 (HER2), tau, apolipoprotein E4 (ApoE4), alpha-synuclein, CD20, huntingtin, prion protein (PrP), leucine rich repeat kinase 2 (LRRK2), parkin, presenilin 1 , presenilin 2, gamma secretase, death receptor 6 (DR6), amyloid precursor protein (APP), p75 neurotrophin receptor (p75NTR), interleukin 6 receptor (IL6R), TNF receptor 1 (TNFRl), interleukin 1 beta (ILip), and caspase 6.
  • BACE1 beta-secretase 1
  • the antigen is BACE1.
  • BACEl refers to any native beta-secretase 1 (also called ⁇ - site amyloid precursor protein cleaving enzyme 1, membrane-associated aspartic protease 2, memapsin 2, aspartyl protease 2 or Asp2) from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g. , mice and rats), unless otherwise indicated.
  • the term encompasses "full-length,” unprocessed BACEl as well as any form of BACEl which results from processing in the cell.
  • the term also encompasses naturally occurring variants of BACEl, e.g., splice variants or allelic variants.
  • the amino acid sequence of an exemplary BACEl polypeptide is shown in SEQ ID NO: 147 below, and is the sequence for human BACEl, isoform A as reported in Vassar et ah, Science 286:735-741 (1999), which is incorporated herein by reference in its entirety.
  • isoforms B, C and D are examples of isoforms of human BACEl. See UniProtKB/Swiss-Prot Entry P56817, which is incorporated herein by reference in its entirety.
  • Isoform B is shown in SEQ ID NO: 148 and differs from isoform A (SEQ ID NO: 147) in that it is missing amino acids 190-214 (i.e. deletion of amino acids 190-214 of SEQ ID NO:147).
  • Isoform C is shown in SEQ ID NO: 149 and differs from isoform A (SEQ ID NO:147) in that it is missing amino acids 146-189 (i.e. deletion of amino acids 146-189 of (SEQ ID NO: 147).
  • Isoform D is shown in SEQ ID NO: 150 and differs from isoform A (SEQ ID NO:147) in that it is missing amino acids 146-189 and 190-214 (i.e. deletion of amino acids 146-189 and 190-214 of SEQ ID NO: 147).
  • anti-beta-secretase antibody refers to an antibody that is capable of binding BACEl with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BACEl.
  • the extent of binding of an anti- BACEl antibody to an unrelated, non-BACEl protein is less than about 10% of the binding of the antibody to BACEl as measured, e.g., by a radioimmunoassay (RIA).
  • an antibody that binds to BACEl has a dissociation constant (Kd) of ⁇ ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 "8 M or less, e.g. from 10 "8 M to 10 "13 M, e.g., from 10 "9 M to 10 "13 M).
  • Kd dissociation constant
  • an anti-BACEl antibody binds to an epitope of BACE1 that is conserved among BACE1 from different species and isoforms.
  • an antibody that binds to the epitope on BACE1 bound by anti-BACEl antibody YW 412.8.31. In other embodiments, an antibody is provided that binds to an exosite within BACE1 located in the catalytic domain of BACE1. In some embodiments an antibody is provided that competes with the peptides identified in Kornacker et al., Biochem.
  • exemplary BACE1 antibody sequences are depicted in Figs. 23 to 26, 38, and 39.
  • One exemplary antibody herein comprises the variable domains of the antibody YW412.8.31 (e.g. as in Figs. 15A-B).
  • a "native sequence" protein herein refers to a protein comprising the amino acid sequence of a protein found in nature, including naturally occurring variants of the protein.
  • the term as used herein includes the protein as isolated from a natural source thereof or as
  • antibody herein is used in the broadest sense and encompasses various antibody stuctures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
  • an "antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds.
  • Examples of antibody fragments are well known in the art (see, e.g., Nelson, MAbs (2010) 2(1): 77-83) and include but are not limited to Fab, Fab', Fab'-SH, F(ab')2, and Fv; diabodies; linear antibodies; single-chain antibody molecules including but not limited to single-chain variable fragments (scFv), fusions of light and/or heavy-chain antigen-binding domains with or without a linker (and optionally in tandem); and monospecific or multispecific antigen-binding molecules formed from antibody fragments (including, but not limited to multispecific antibodies constructed from multiple variable domains which lack Fc regions).
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants, e.g., containing naturally occurring mutations or that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts.
  • polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
  • each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on the antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method (see, e.g., Kohler et al, Nature, 256:495 (1975)), recombinant DNA methods (see, e.g., U.S. Patent No.
  • phage-display methods e.g., using the techniques described in Clackson et al, Nature, 352:624-628 (1991) and Marks et al, J. Mol. Biol, 222:581-597 (1991)
  • methods utilizing transgenic animals containing all or part of the human immunoglobulin loci such methods and other exemplary methods for making monoclonal antibodies being described herein.
  • Specific examples of monoclonal antibodies herein include chimeric antibodies, humanized antibodies, and human antibodies, including antigen-binding fragments thereof.
  • the monoclonal antibodies herein specifically include “chimeric” antibodies
  • immunoglobulins in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al, Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
  • An "acceptor human framework” for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
  • An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
  • the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
  • a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
  • the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
  • the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91- 3242, Bethesda MD (1991), vols. 1-3.
  • the subgroup is subgroup kappa I as in Kabat et al supra.
  • the subgroup is subgroup III as in Kabat et al supra.
  • Humanized forms of non-human ⁇ e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human antibodies.
  • humanized antibodies are human antibodies (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CD s) correspond to those of a non-human antibody, and all or substantially all of the framework regions (FRs) correspond to those of a human antibody.
  • HVRs e.g., CD s
  • FRs framework regions
  • FR residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
  • a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human antibody and all or substantially all of the FRs are those of a human antibody, except for FR substitution(s) as noted above.
  • the humanized antibody optionally also will comprise at least a portion of an antibody constant region, typically that of a human antibody.
  • a "humanized form" of an antibody, e.g., a non-human antibody refers to an antibody that has undergone humanization.
  • a "human antibody” herein is an antibody comprising an amino acid sequence structure that corresponds with the amino acid sequence structure of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
  • Such antibodies can be identified or made by a variety of techniques, including, but not limited to:
  • transgenic animals ⁇ e.g., mice
  • transgenic animals ⁇ e.g., mice
  • transgenic animals that are capable, upon immunization, of producing human antibodies in the absence of endogenous immunoglobulin production
  • Jakobovits et al Proc. Natl. Acad. Sci. USA, 90:2551 (1993); Jakobovits et al, Nature, 362:255-258 (1993); Bruggermann et al, Year in Immuno., 7:33 (1993); and US Patent Nos.
  • multispecific antibody is used in the broadest sense and specifically covers an antibody comprising an antigen-binding domain that has polyepitopic specificity (i.e., is capable of specifically binding to two, or more, different epitopes on one biological molecule or is capable of specifically binding to epitopes on two, or more, different biological molecules).
  • an antigen-binding domain of a multispecific antibody (such as a bispecific antibody) comprises two VH/VL units, wherein a first VH/VL unit specifically binds to a first epitope and a second VH/VL unit specifically binds to a second epitope, wherein each VH/VL unit comprises a heavy chain variable domain (VH) and a light chain variable domain (VL).
  • a multispecific antibody may bind both a Tf and a brain antigen.
  • a multispecific antibody binds Tf and BACE1 ("anti-TfR/BACEl antibody").
  • Such multispecific antibodies include, but are not limited to, full length antibodies, antibodies having two or more VL and VH domains, antibody fragments such as Fab, Fv, dsFv, scFv, diabodies, bispecific diabodies and triabodies, antibody fragments that have been linked covalently or non-covalently.
  • a VH/VL unit that further comprises at least a portion of a heavy chain variable region and/or at least a portion of a light chain variable region may also be referred to as An "arm” or "hemimer” or "half antibody.”
  • a hemimer comprises a sufficient portion of a heavy chain variable region to allow intramolecular disulfide bonds to be formed with a second hemimer.
  • a hemimer comprises a knob mutation or a hole mutation, for example, to allow heterodimerization with a second hemimer or half antibody that comprises a complementary hole mutation or knob mutation. Knob mutations and hole mutations are discussed further below.
  • a “bispecific antibody” is a multispecific antibody comprising an antigen-binding domain that is capable of specifically binding to two different epitopes on one biological molecule or is capable of specifically binding to epitopes on two different biological molecules.
  • a bispecific antibody may also be referred to herein as having “dual specificity” or as being “dual specific.”
  • KnH knock-into-hole
  • a protuberance for example, KnHs have been introduced in the Fc:Fc binding interfaces, CL:CH1 interfaces or VH/VL interfaces of antibodies (see, e.g., US 2011/0287009, US2007/0178552, WO 96/02701 1, WO 98/050431, and Zhu et al., 1997, Protein Science 6:781 - 788).
  • KnHs drive the pairing of two different heavy chains together during the manufacture of multispecific antibodies.
  • multispecific antibodies having KnH in their Fc regions can further comprise single variable domains linked to each Fc region, or further comprise different heavy chain variable domains that pair with similar or different light chain variable domains.
  • KnH technology can be also be used to pair two different receptor extracellular domains together or any other polypeptide sequences that comprises different target recognition sequences (e.g., including affibodies, peptibodies and other Fc fusions).
  • knock mutation refers to a mutation that introduces a protuberance (knob) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide.
  • the other polypeptide has a hole mutation.
  • hole mutation refers to a mutation that introduces a cavity (hole) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide.
  • the other polypeptide has a knob mutation.
  • Antibodies herein include "amino acid sequence variants" with altered antigen-binding or biological activity.
  • amino acid alterations include antibodies with enhanced affinity for antigen (e.g. "affinity matured” antibodies), and antibodies with altered Fc region, if present, e.g. with altered (increased or diminished) antibody dependent cellular cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) (see, for example, WO 00/42072, Presta, L. and WO 99/51642, Iduosogie et al.); and/or increased or diminished serum half-life (see, for example, WO00/42072, Presta, L.).
  • ADCC antibody dependent cellular cytotoxicity
  • CDC complement dependent cytotoxicity
  • An "affinity modified variant” has one or more substituted hypervariable region or framework residues of a parent antibody (e.g. of a parent chimeric, humanized, or human antibody) that alter (increase or reduce) affinity.
  • a parent antibody e.g. of a parent chimeric, humanized, or human antibody
  • a convenient way for generating such substitutional variants uses phage display. Briefly, several hypervariable region sites (e.g. 6-7 sites) are mutated to generate all possible amino substitutions at each site. The antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of Ml 3 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g. binding affinity).
  • alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
  • a "pH-sensitive antibody variant” is an antibody variant which has a different binding binding affinity for a target antigen at a first pH than it does for that target antigen at a different pH.
  • an anti-TfR/BACEl antibody of the invention may be selected for or engineered to have pH-sensitive binding to Tf such that it binds with desirably low affinity (as described herein) to cell surface Tf in the plasma at pH 7.4, but upon internalization into an endosomal compartment, rapidly dissociates from TfR at the relatively lower pH (pH 5.5-6.0); such dissociation may protect the antibody from antigen-mediated clearance, and increase the amount of antibody that is either delivered to the CNS or recycled back across the BBB - in either case, the effective concentration of the antibody is increased relative to an anti-TfR antibody that does not comprise such pH sensitivity (see, e.g., Chaparro-Riggers et al.
  • the antibody herein may be conjugated with a "heterologous molecule" for example to increase half-life or stability or otherwise improve the antibody.
  • the antibody may be linked to one of a variety of non-proteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol.
  • Antibody fragments, such as Fab', linked to one or more PEG molecules are an exemplary embodiment of the invention.
  • the heterologous molecule is a therapeutic compound or a visualization agent (ie., a detectable label), and the antibody is being used to transport such heterologous molecule across the BBB.
  • heterologous molecules include, but are not limited to, a chemical compound, a peptide, a polymer, a lipid, a nucleic acid, and a protein.
  • the antibody herein may be a "glycosylation variant" such that any carbohydrate attached to the Fc region, if present, is altered, either modified in presence/absence, or modified in type.
  • a glycoslation variant such that any carbohydrate attached to the Fc region, if present, is altered, either modified in presence/absence, or modified in type.
  • antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 (Presta, L.). See also US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
  • Antibodies with a bisecting N- acetylglucosamine (GlcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in WO 2003/011878, Jean-Mairet et al.
  • hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence ("complementarity determining regions” or “CDRs") and/or form structurally defined loops ("hypervariable loops") and/or contain the antigen-contacting residues ("antigen contact”).
  • CDRs complementarity determining regions
  • hypervariable loops form structurally defined loops
  • antigen contact Generally, antibodies comprise six HVRs: three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
  • Exemplary HVRs herein include:
  • HVR residues comprise those identified in Figures 3 and 4 and Tables 3 and 4, or elsewhere in the specification.
  • HVR residues and other residues in the variable domain are numbered herein according to Kabat et al., supra.
  • FR residues are those variable domain residues other than the hypervariable region residues as herein defined.
  • the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3 and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4.
  • one or more FR residue may be modified to modulate the stability of the antibody or to modulate the three-dimensional positioning of one or more HV of the antibody to, e.g., enhance binding.
  • a “full length antibody” is one which comprises an antigen-binding variable region as well as a light chain constant domain (CL) and heavy chain constant domains, CHI, CH2 and CH3.
  • the constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variants thereof.
  • full length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
  • naked antibody refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety or radiolabel).
  • the naked antibody may be present in a pharmaceutical formulation.
  • Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures.
  • native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2 and CH3).
  • VH variable region
  • VL variable region
  • the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
  • Antibody effector functions refer to those biological activities of an antibody that result in activation of the immune system other than activation of the complement pathway. Such activities are largely found in the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include, for example, Fc receptor binding and antibody-dependent cell-mediated cytotoxicity (ADCC). In some embodiments, the antibody herein essentially lacks effector function. In another embodiment, the antibody herein retains minimal effector function.
  • Methods of modifying or eliminating effector function include, but are not limited to, eliminating all or a portion of the Fc region responsible for the effector function (ie, using an antibody or antibody fragment in a format lacking all or a portion of the Fc region such as, but not limited to, a Fab fragment, a single- chain antibody, and the like as described herein and as known in the art; modifying the Fc region at one or more amino acid positions to eliminate effector function (Fc binding-impacting: positions 238, 239, 248, 249, 252, 254, 256, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 297, 298, 301, 303, 311, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 436, 437, 438, and 439; and
  • Antibody "complement activation” functions, or properties of an antibody that enable or trigger “activation of the complement pathway” are used interchangeably, and refer to those biological activities of an antibody that engage or stimulate the complement pathway of the immune system in a subject. Such activities include, e.g., Clq binding and complement dependent cytotoxicity (CDC), and may be mediated by both the Fc portion and the non-Fc portion of the antibody.
  • CDC complement dependent cytotoxicity
  • Methods of modifying or eliminating complement activation function include, but are not limited to, eliminating all or a portion of the Fc region responsible for complement activation (ie., using an antibody or antibody fragment in a format lacking all or a portion of the Fc region such as, but not limited to, a Fab fragment, a single-chain antibody, and the like as described herein and as known in the art, or modifying the Fc region at one or more amino acid positions to eliminate or lessen interactions with complement components or the ability to activate complement components, such as positions 270, 322, 329 and 321, known to be involved in Clq binding), and modifying or eliminating a portion of the non-Fc region responsible for complement activation (ie, modifying the CHI region at position 132 (see, e.g., Vidarte et al., (2001) J. Biol. Chem. 276(41): 38217-38223)).
  • full length antibodies can be assigned to different "classes". There are five major classes of full length antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into “subclasses” (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2.
  • the heavy-chain constant domains that correspond to the different classes of antibodies are called alpha, delta, epsilon, gamma, and mu, respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known in the art.
  • recombinant antibody refers to an antibody (e.g. a chimeric, humanized, or human antibody or antigen-binding fragment thereof) that is expressed by a recombinant host cell comprising nucleic acid encoding the antibody.
  • host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
  • Host cells include “transformants” and “transformed cells,” which include the primary transformed cells and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
  • Examples of "host cells” for producing recombinant antibodies include: (1) mammalian cells, for example, Chinese Hamster Ovary (CHO), COS, myeloma cells (including Y0 and NSO cells), baby hamster kidney (BHK), Hela and Vero cells; (2) insect cells, for example, sf9, sf21 and Tn5; (3) plant cells, for example plants belonging to the genus Nicotiana (e.g. Nicotiana tabacum); (4) yeast cells, for example, those belonging to the genus Saccharomyces (e.g. Saccharomyces cerevisiae) or the genus Aspergillus (e.g. Aspergillus niger); (5) bacterial cells, for example Escherichia coli cells or Bacillus subtilis cells, etc.
  • mammalian cells for example, Chinese Hamster Ovary (CHO), COS, myeloma cells (including Y0 and NSO cells), baby hamster kidney (BHK),
  • binding affinity is generally determined using a standard assay, such as Scatchard analysis, or surface plasmon resonance technique (e.g. using BIACORE®).
  • an "antibody that binds to the same epitope" as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
  • an anti-BACEl antibody forming one of the bispecific or multispecific antibodies of the invention binds to the BACEl epitope bound by antibody 6266.
  • An exemplary competition assay is provided herein.
  • cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
  • Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of
  • an "effective amount" of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
  • Fc region herein is used to define a C-terminal region of an
  • immunoglobulin heavy chain that contains at least a portion of the constant region.
  • the term includes native sequence Fc regions and variant Fc regions.
  • a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain.
  • the C-terminal lysine (Lys447) of the Fc region may or may not be present.
  • numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
  • FcRn receptor or “FcRn” as used herein refers to an Fc receptor ("n" indicates neonatal) which is known to be involved in transfer of maternal IgGs to a fetus through the human or primate placenta, or yolk sac (rabbits) and to a neonate from the colostrum through the small intestine. It is also known that FcRn is involved in the maintenance of constant serum IgG levels by binding the IgG molecules and recycling them into the serum. "FcRn binding region” or “FcRn receptor binding region” refers to that portion an an antibody which interacts with the FcRn receptor.
  • Certain modifications in the FcRn binding region of an antibody increase the affinity of the antibody or fragment thereof, for the FcRn, and also increase the in vivo half-life of the molecule.
  • Amino acid substitutions in one or more of the following amino acid positions 251 256, 285, 290, 308, 314, 385, 389, 428, 434 and 436 increases the interaction of the antibody with the FcRn receptor. Substitutions at the following positions also increases the interaction of an antibody with the FcRn receptor 238, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of (US Patent No. 7,371,826).
  • an "immunoconjugate” is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a label or cytotoxic agent. Optionally such conjugation is via a linker.
  • a "linker” as used herein is a structure that covalently or non-covalently connects an antibody to heterologous molecule.
  • a linker is a peptide.
  • a linker is a chemical linker.
  • a "label” is a marker coupled with the antibody herein and used for detection or imaging.
  • labels include: radiolabel, a fluorophore, a chromophore, or an affinity tag.
  • the label is a radiolabel used for medical imaging, for example tc99m or 1123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine- 123 again, iodine-131, indium- 111, fluorine- 19, carbon- 13, nitrogen- 15, oxygen- 17, gadolinium, manganese, iron, etc.
  • NMR nuclear magnetic resonance
  • An "individual” or “subject” is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non- human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human.
  • An "isolated” antibody is one which has been separated from a component of its natural environment.
  • an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC) methods.
  • electrophoretic e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
  • chromatographic e.g., ion exchange or reverse phase HPLC
  • An "isolated nucleic acid” refers to a nucleic acid molecule that has been separated from a component of its natural environment.
  • An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
  • isolated nucleic acid encoding an antibody refers to one ormore nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
  • package insert is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
  • Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTA ) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
  • the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
  • composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • a “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
  • treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • antibodies of the invention are used to delay development of a disease or to slow the progression of a disease.
  • variable region refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen.
  • the variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HV s).
  • FRs conserved framework regions
  • HV s hypervariable regions
  • antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
  • vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
  • the term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
  • Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as
  • the invention is based, in part, on anti-TfR antibodies that can be used to transport desired molecules across the BBB.
  • an anti-TfR/BACEl antibody is provided.
  • antibodies that bind to human TfR are provided.
  • antibodies that bind to both human TfR and primate TfR are provided.
  • Antibodies of the invention are useful, e.g., for the diagnosis or treatment of diseases affecting the brain and/or CNS.
  • the invention provides isolated multispecific antibodies that bind to TfR and BACE1.
  • an anti-TfR arm of the multispecific antibody of the invention binds specifically to both human TfR and primate TfR.
  • the anti-TfR arm of the multispecific antibody of the invention does not inhibit binding of transferrin to the TfR.
  • the anti-TfR arm of the multispecific antibody of the invention binds to an apical domain of TfR.
  • the anti-TfR arm of the multispecific antibody of the invention binds to a non-apical domain of TfR.
  • the anti-TfR arm of the multispecific antibody may be used to transport one or more conjugated imaging or therapeutic compounds across the BBB, such as the anti-BACEl antibody that forms a second arm of the multispecific antibody.
  • the invention provides a multispecific antibody comprising an anti- TfR antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR- Hl comprising the amino acid sequence of SEQ ID NO:32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:33; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:29; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:31.
  • the antibody comprises all six of the above- recited HVR sequences.
  • the anti-TfR arm of the multispecific antibody is clone 7A4, as shown in Figure 3 A and Table 3.
  • the invention provides a multispecific antibody comprising an anti- TfR antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR- Hl comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:38; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:39; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:35; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:36.
  • the anti-TfR arm of the multispecific antibody comprises all six of the above-recited HVR sequences.
  • the antibody is clone 8A2, as shown in Figure 3 A and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:40; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 35; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 36.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 15D2, as shown in Figure 3 A and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 43; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 44; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 41 ; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 10D11, as shown in Figure 3 A and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 33; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 29; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:31.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 7B10, as shown in Figure 3 A and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:54; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:55; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:50; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:51 ; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:52.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 15G11, as shown in Figure 3B and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:58; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:59; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:56; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:57; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:52.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 16G5, as shown in Figure 3B and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:63; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:55; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:60; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:61 ; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:62.
  • HVR-H1 comprising the amino acid sequence of SEQ ID NO:53
  • HVR-H2 comprising the amino acid sequence of SEQ ID NO:63
  • HVR-H3 comprising the amino acid sequence of SEQ ID NO:55
  • HVR-Ll comprising the amino acid sequence of S
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 13C3, as shown in Figure 3B and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:65; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:55; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:60; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:64; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:52.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:74; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:75; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:76; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:71 ; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:72; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:73.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 16F6, as shown in Figure 3C and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:80; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:81 ; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:82; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:77; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:78; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:79.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 7G7, as shown in Figure 3D and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 80; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 83; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:84; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:77; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:78; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:79.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 4C2, as shown in Figure 3D and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:88; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:89; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:90; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:85; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:86; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:87.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone IB 12, as shown in Figure 3D and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:94; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:95; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:96; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:91 ; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:92; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:93.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 13D4, as shown in Figure 3D and Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:33; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:29; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:127.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the anti-TfR arm is clone 7A4.vl5, as shown in Figure 4B and Table 4.
  • the clones above fall into four complementation groups, with sequence similarity within the HVRs. As shown in Table 3, consensus sequences are readily derivable from the provided antibody sequences for each HVR. As one nonlimiting example, the class I antibody consensus HVRs are as follows:
  • HVR-Ll Arg-Ala-Ser-Glu-Ser-Val-Asp-[Ser or Asp]-Tyr-Gly-[Asn or Pro]-Ser-Phe-Met- His (SEQ ID NO: 45);
  • HVR-L2 Arg-Ala-Ser-Asn-Leu-Glu-Ser (SEQ ID NO: 30);
  • HVR-L3 Gln-[Gln or His]-Ser-Asn-Glu-[Ala, Gly or Asp]-Pro-Pro-Thr (SEQ ID NO: 46);
  • HVR-H1 Asp-Tyr-[Ala or Gly]-Met-His (SEQ ID NO: 47);
  • HVR-H2 [Gly or Val]-Ile-Ser-[Thr, Phe or Pro]-Tyr-[Phe or Ser]-Gly-[Arg or Lys]-Thr- Asn-Tyr-[Asn or Ser]-Gln-[Lys or Asn]-Phe-[Lys or Met]-Gly (SEQ ID NO: 48);
  • HVR-H3 Gly-Leu-Ser-Gly-Asn-[Tyr or Phe]-Val-[Met or Val]-Asp-[Tyr or Phe] (SEQ ID NO: 49). (see Table 3). The consensus sequences for class II and IV are also provided in Table 3.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:47; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:48; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:49; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:45; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:46.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:69; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:70; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:66; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:67; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:68.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 100; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 101 ; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 102; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:97; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:98; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:99.
  • the antibody comprises all six of the above-recited HVR sequences.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising at least one, at least two, or all three VH HVR sequences of any of the antibodies described above.
  • the antibody comprises the HVR-H3 sequence of any one of the antibodies described above.
  • the antibody comprises the HVR-H3 and HVR-L3 sequences of any one of the antibodies described above.
  • the antibody comprises the HVR-H3, HVR-L3 and HVR-H2 sequences of any one of the antibodies described above.
  • the antibody comprises the HVR-H1, HVR- H2 and HVR-H3 sequences of any one of the antibodies described above.
  • the invention provides an antibody comprising at least one, at least two or all three VL HVR sequences of any of the antibodies described above.
  • the antibody comprises the HVR- Ll, HVR-L2, and HVR-L3 sequences of any one of the antibodies described above.
  • a multispecific antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from the HVR-H1, HVR-H2, and HVR-H3 sequences of any one of the antibodies described above; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from the HVR-Ll, HVR-L2 and HVR-L3 sequences of any one of the antibodies described above.
  • an anti-TfR arm of a multispecific antibody is humanized.
  • an anti-TfR arm of a multispecific antibody comprises HVRs as in any of the above embodiments, and further comprises an acceptor human framework, e.g. a human immunoglobulin framework or a human consensus framework.
  • an anti-TfR arm of a multispecific antibody comprises HVRs as in any of the above embodiments, and further comprises a VH or VL comprising one or more amino acid substitutions in one or more FR regions.
  • Applicants performed alanine scanning on certain antibodies selected from those above, and determined that similar or improved binding was obtained despite amino acid modifications at selected FR positions.
  • positions 58 and 68 of the light chain FR3, position 24 in the heavy chain FR1 and position 71 in the heavy chain FR3 could be modified as shown in Figures 4E-1 and 4E-2 and the resulting antibody still retained specificity and strong binding affinity for human/primate TfR.
  • positions 43 and 44 of the light chain FR2 and positions 71 and 78 of the heavy chain FR3 could be modified as shown in Figures 4E-1 and 4E-2 and the resulting antibody still retained specificity and strong binding affinity for human/primate TfR.
  • an anti-TfR/BACEl bispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 7-10, 15-18, 20, 25-28, 108, 114, 120, 126, 403, and 404.
  • VH heavy chain variable domain
  • a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to Tf .
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NOs:7-10, 15- 18, 20, 25-28, 108, 114, 120 and 126.
  • substitutions, insertions, or deletions occur in regions outside the HV s (i.e., in the FRs).
  • the anti-TfR/BACEl bispecific antibody comprises the VH sequence of any one of SEQ ID NOs: 7-10, 15-18, 20 25-28, 108, 114, 120, 126, 403, and 404, including post-translational modifications of that sequence.
  • the VH for a particular antibody comprises one, two or three HVRs selected from: the HVRs set forth above and in Table 3 or 4 for that particular antibody.
  • VH sequences for the antibodies of the invention are shown in Figures 3 and 4 herein.
  • an anti-TfR/BACEl multispecific antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs:4-6, 11-14, 19, 21-24, 105, 111, 117, 123, 401, or 402.
  • VL light chain variable domain
  • a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to TfR.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NOs:4-6, 11-14, 19, 21-24, 105, 111, 117, 123, 401, or 402.
  • the substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
  • the anti-TfR/BACEl multispecific antibody comprises the VL sequence in any of SEQ ID NOs:4-6, 11-14, 19, 21-24, 105, 111, 117, 123, 401, or 402, including post-translational modifications of that sequence.
  • the VL comprises one, two or three HVRs selected from the HVRs set forth above and in Table 3 or 4 for that particular antibody. VL sequences for the antibodies of the invention are shown in Figures 3 and 4 herein.
  • an anti-TfRBACEl multispecific antibody comprising a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
  • the antibody comprises the VL and VH sequences, respectively, in SEQ ID NOs: 4 and 7; 5 and 8; 5 and 9; 6 and 10; 4 and 7; 11 and 15; 12 and 16; 13 and 17; 14 and 18; 19 and 20; 21 and 25; 22 and 26; 23 and 27; 24 and 28; 105 and 108; 402 and 108; 401 and 108; 401 and 403; 401 and 404; 105 and 403; 105 and 404; 111 and 114; 117 and 120; and 123 and 126 , including post-translational modifications of those sequences.
  • the invention provides an antibody that binds to the same epitope as an anti-Tf antibody provided herein.
  • an antibody is provided that binds to the same epitope as an anti-Tf antibody comprising VL and VH sequences, respectively, of SEQ ID NOs: 4 and 7; 5 and 8; 5 and 9; 6 and 10; 4 and 7; 11 and 15; 12 and 16; 13 and 17; 14 and 18; 19 and 20; 21 and 25; 22 and 26; 23 and 27; 24 and 28; 105 and 108; 402 and 108; 401 and 108; 401 and 403; 401 and 404; 105 and 403; 105 and 404; 111 and 114; 117 and 120; or 123 and 126.
  • the antibody competes with any of the antibodies in Class I (ie., clones 7A4, 8A2, 15D2, 10D11, or 7B10, or affinity-matured versions of any of those antibodies) for binding to Tf .
  • the antibody competes with any of the antibodies in Class II (ie, clones 15G11, 16G5, 13C3 or 16G, or affinity-matured versions of any of those antibodies) for binding to TfR.
  • the antibody competes with clone 16F6 or affinity-matured versions thereof for binding to TfR.
  • the antibody competes with any of the antibodies in Class IV (ie, clones 7G7, 4C2, 1B12 or 13D4, or affinity matured versions thereof) for binding to TfR.
  • the anti-TfR arm of a multispecific antibody is a monoclonal antibody, including a chimeric, humanized or human antibody.
  • a multispecific antibody is an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab')2 fragment.
  • the antibody is a full length antibody, e.g., an intact IgGl, IgG2, IgG3, or IgG4 antibody or other antibody class or isotype as defined herein.
  • an antibody according to any of the above embodiments may incorporate any of the features, singly or in combination, as described in Sections 1 -7 below.
  • anti-TfR/BACEl multispecific antibodies are provided.
  • an anti-TfR/BACEl multispecific antibody provided herein is an allosteric inhibitor of BACE1 activity.
  • Nonlimiting exemplary anti-TfR/BACEl multispecific antibodies include antibodies comprising the heavy chain and light chain variable regions of the antibodies listed in Table 1. The heavy and light chain variable regions of the antibodies listed in Table 1 are shown in Figures 23 and 24, respectively.
  • an anti-BACEl antibody described herein is an allosteric inhibitor of BACEl activity.
  • an anti-BACEl antibody binds BACEl with an affinity (KD) of less than 10 nM, less than 9 nM, less than 8 nM, less than 7 nM, less than 6 nM, less than 5 nM, less than 4 nM, or less than 3 nM, as measured by surface plasmon resonance (SPR).
  • KD affinity
  • an anti-BACEl antibody binds BACEl with an affinity (KD) of between 0.1 nM and 10 nM, or between 0.1 nM and 8 nM, or between 0.1 nM and 7 nM, or between 0.1 nM and 5 nM, or between 0.5 nM and 5 nM, or between 0.1 nM and 3 nM, or between 0.5 nM and 3 nM, as measured by surface plasmon resonance (SPR).
  • KD affinity
  • an anti-BACEl antibody achieves a maximum inhibition of BACEl activity of greater than 60%, greater than 70%, greater than 75%, or greater than 80%, as measured, for example, using the dissociated cortical neuron culture assay described in Example 9E.
  • the invention provides a multispecific antibody comprising an anti- BACEl arm comprising at least one, two, three, four, five, or six HVRs of an antibody selected from the anti-BACEl antibodies listed in Table 1.
  • Figures 21 and 22 show the heavy chain and light chain HVR sequences, respectively, of each of those antibodies.
  • the invention provides a multispecific antibody comprising an anti-BACEl arm comprising HVR-H1, HVR-H2, HVR-H3, HVR-L1, HVR-L2, and HVR-L3 of an antibody selected from the anti- BACE1 antibodies listed in Table 1.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR-Hl sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201 ; an HVR-L1 sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR-Hl sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385; an HVR-Ll sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR-Hl sequence selected from SEQ ID NOs: 165, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 179, 377, and 383; an HVR-H3 sequence selected from SEQ ID NOs: 202, 378, 379, 384, and 385; an HVR-Ll sequence of SEQ ID NO: 215; an HVR-L2 sequence selected from SEQ ID NOs: 221 and 375; and an HVR-L3 sequence of SEQ ID NO: 230.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR-Hl of SEQ ID NO: 165; an HVR-H2 sequence of SEQ ID NO: 179; an HVR-H3 sequence of SEQ ID NO: 202; an HVR-Ll sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221; and an HVR-L3 sequence of SEQ ID NO: 230.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody selected from antibody 6266 variants 1-15.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising at least one, at least two, or all three VH HVR sequences selected of an antibody selected from the anti-BACEl antibodies listed in Table 1.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising HVR-Hl, HVR-H2, and HVR-H3 of an antibody selected from the anti-BACEl antibodies listed in Table 1.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR- Hl sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; and an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR-Hl sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; and an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR- Hl sequence selected from SEQ ID NOs: 165, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 179, 377, and 383; and an HVR-H3 sequence selected from SEQ ID NOs: 202, 378, 379, 384, and 385.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-H1 of SEQ ID NO: 165; an HVR-H2 sequence of SEQ ID NO: 179; and an HVR-H3 sequence of SEQ ID NO: 202.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-H1, HVR-H2, and HVR-H3 of an antibody selected from antibody 6266 variants 1-15.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising at least one, at least two, or all three VL HVR sequences selected of an antibody selected from the anti-BACEl antibodies listed in Table 1.
  • the invention provides an anti-TfR/BACEl multispecific antibody comprising HVR-L1, HVR-L2, and HVR-L3 of an antibody selected from the anti-BACEl antibodies listed in Table 1.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR- Ll sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-L1 sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247.
  • an anti-TfR/BACEl multispecific antibody comprising an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221, 223, or 375; and an HVR-L3 sequence of SEQ ID NO: 230.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221; and an HVR-L3 sequence of SEQ ID NO: 230.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-L1, HVR-L2, and HVR-L3 of an antibody selected from antibody 6266 variants 1-15.
  • an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the VH of an anti-BACEl antibody of Table 1.
  • an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374.
  • an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374.
  • an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 288.
  • a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti- TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to BACE1 and/or inhibit or reduce BACE1 activity.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NO: 249 to 297, 352 to 358, and 367 to 374.
  • the antibody comprises the VH sequence in any one of SEQ ID NO: 249 to 297, 352 to 358, and 367 to 374, including post-translational modifications of that sequence.
  • the VH comprises one, two or three HVRs of an anti-BACEl antibody listed in Table 1.
  • the VH comprises an HVR-Hl sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; and an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201.
  • the VH comprises an HVR-Hl sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; and an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385.
  • the VH comprises an HVR-Hl sequence selected from SEQ ID NOs: 165, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 179, 377, and 383; and an HVR-H3 sequence selected from SEQ ID NOs: 202, 378, 379, 384, and 385.
  • the VH comprises an HVR-Hl of SEQ ID NO: 165; an HVR-H2 sequence of SEQ ID NO: 179; and an HVR-H3 sequence of SEQ ID NO: 202.
  • the VH comprises an HVR-Hl, HVR-H2, and HVR-H3 of an antibody selected from antibody 6266 variants 1-15.
  • an anti-TfR/BACEl multispecific antibody comprises a light chain variable domain (VL) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the VL of an anti-BACEl antibody of Table 1.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 298 to 328, 345 to 351 , and 359 to 366.
  • an anti-TfR/BACEl multispecific antibody comprising a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 306.
  • a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g. , conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to BACE1 and/or inhibit or reduce BACE1 activity.
  • a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366.
  • the substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs).
  • the antibody comprises the VL sequence in any one of SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366, including post-translational modifications of that sequence.
  • the VL comprises one, two or three HVRs of an anti-BACEl antibody listed in Table 1.
  • the VL comprises an HVR-L1 sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248.
  • the VL comprises an HVR-L1 sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247.
  • the VL comprises an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221 , 223, or 375; and an HVR-L3 sequence of SEQ ID NO: 230.
  • the VL comprises an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221 ; and an HVR-L3 sequence of SEQ ID NO: 230. In some embodiments, the VL comprises an HVR-L1 , HVR-L2, and HVR-L3 of an antibody selected from antibody 6266 variants 1-15.
  • an anti-TfR/BACEl multispecific antibody comprising a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH sequence selected from SEQ ID NOs: 249 to 256 and a VL sequence selected from SEQ ID NOs: 298 to 302.
  • an anti- TfR/BACEl multispecific antibody comprising a VH sequence selected from SEQ ID NOs: 257 to 297, 352 to 358, and 367 to 374 and a VL sequence selected from SEQ ID NOs: 303 to 328, 345 to 351, and 359 to 366.
  • an anti- TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH and a VL of an anti-BACEl antibody listed in Table 1.
  • an anti-TfR/BACEl multispecific antibody comprising a VH sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374 and a VL sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366.
  • the antibody comprises the VH and VL sequences of SEQ ID NO: 288 and SEQ ID NO: 306, respectively, including post-translational modifications of those sequences.
  • an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH and a VL of an antibody selected from antibody 6266 variants 1-15.
  • the invention provides a multispecific antibody that binds to the same epitope as an anti-BACEl antibody provided herein, such as the anti-BACEl antibodies listed in Table 1.
  • an antibody is provided that binds to the same epitope as an anti-BACEl antibody comprising a VH sequence selected from SEQ ID NOs: 249 to 256 and a VL sequence selected from SEQ ID NOs: 298 to 302.
  • an antibody that binds to the same epitope as an anti-BACEl antibody comprising a VH sequence selected from SEQ ID NOs: 257 to 297, 352 to 358, and 367 to 374 and a VL sequence selected from SEQ ID NOs: 303 to 328, 345 to 351, and 359 to 366.
  • an antibody is provided that binds to the same epitope as an anti-BACEl antibody comprising the VH and VL sequences of SEQ ID NO: 288 and SEQ ID NO: 306, respectively.
  • a multispecific antibody that competes for binding (e.g., binds to the same epitope) as any anti-BACEl antibody described herein.
  • the anti-BACEl arm of an anti-TfR/BACEl multispecific antibody is a monoclonal antibody, including a chimeric or human antibody.
  • an antibody is an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab')2 fragment.
  • the antibody is a full length antibody, e.g., an intact IgGl antibody or other antibody class or isotype as defined herein.
  • an anti-TfR/BACEl multispecific antibody may incorporate any of the features, singly or in combination, as described in Sections 1-7 below.
  • an antibody provided herein has a dissociation constant (Kd) of ⁇ ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 10 "8 M or less, e.g. from 10 "8 M to 10 "13 M, e.g., from 10 "9 M to lO 3 M).
  • Kd dissociation constant
  • a "low affinity" anti-Tf arm of an anti- TfR/BACEl multispecific antibody of the invention is selected, based, e.g., on the results in Example 5 and in Atwal et al., Sci. Transl. Med. 3, 84ra43 (2011) and Yu et al., Sci. Transl. Med. 25 May 2011 : Vol. 3, Issue 84, p. 84ra44, showing that such lower-affinity antibodies to Tf display improved CNS (for example, brain) uptake and/or persistence in the brain/CNS.
  • CNS for example, brain
  • the antibody has an affinity for human or primate TfR from about 5nM, or from about 20 nM, or from about 100 nM, to about 50 ⁇ , or to about 30 ⁇ , or to about 10 ⁇ , or to about 1 ⁇ , or to about 500 nM.
  • the affinity may be in the range from about 5 nM to about 50 ⁇ , or in the range from about 20 nM to about 30 ⁇ , or in the range from about 30 nM to about 30 ⁇ , or in the range from about 50 nM to about 1 ⁇ , or in the range from about 100 nM to about 500 nM, e.g. as measured by Scatchard analysis or BIACORE®.
  • the antibody has a dissociation half-life from TfR of less than 1 minute, less than 2 minutes, less than 3 minutes, less than four minutes, less than 5 minutes, or less than 10 minutes to about 20 minutes, or to about 30 minutes, as measured by competition binding analysis or BIACORE®.
  • the invention provides a method of making an antibody useful for transporting a neurological disorder drug across the blood-brain barrier comprising selecting an antibody from a panel of antibodies against TfR because it has an affinity for TfR which is in the range from about 5nM, or from about 20 nM, or from about 100 nM, to about 50 ⁇ , or to about 30 ⁇ , or to about 10 ⁇ , or to about 1 ⁇ , or to about 500 mM.
  • the affinity may be in the range from about 5 nM to about 50 ⁇ , or in the range from about 20 nM to about 30 ⁇ , or in the range from about 30 nM to about 30 ⁇ , or in the range from about 50 nM to about 1 ⁇ , or in the range from about 100 nM to about 500 nM, e.g. as measured by Scatchard analysis or BIACORE®.
  • a heterologous molecule/compound conjugating a heterologous molecule/compound to an antibody will often decrease the affinity of the antibody for its target due, e.g., to steric hindrance or even to elimination of one binding arm if the antibody is made multispecific with one or more arms binding to a different antigen than the antibody's original target.
  • a low affinity antibody of the invention specific for TfR conjugated to anti-BACEl had a Kd for TfR as measured by BIACORE of about 30 nM.
  • a low affinity antibody of the invention specific for TfR conjugated to BACE1 had a Kd for TfR as measured by BIACORE of about 600 nM.
  • a low affinity antibody of the invention specific for TfR conjugated to BACE1 had a Kd for TfR as measured by BIACORE of about 20 ⁇ . In another embodiment, a low affinity antibody of the invention specific for Tf conjugated to BACE1 had a Kd for TfR as measured by BIACORE of about 30 ⁇ .
  • Kd is measured by a radiolabeled antigen binding assay (RIA).
  • RIA radiolabeled antigen binding assay
  • an RIA is performed with the Fab version of an antibody of interest and its antigen.
  • solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol. 293:865-881(1999)).
  • MICROTITER ® multi-well plates (Thermo Scientific) are coated overnight with 5 ⁇ g/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
  • a non-adsorbent plate (Nunc #269620)
  • 100 pM or 26 pM [ 125 I]-antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti- VEGF antibody, Fab-12, in Presta et al., Cancer Res. 57:4593-4599 (1997)).
  • the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN-20 ® ) in PBS. When the plates have dried, 150 ⁇ /well of scintillant (MICROSCINT-20TM; Packard) is added, and the plates are counted on a TOPCOUNTTM gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
  • the RIA is a Scatchard analysis.
  • the anti-TfR antibody of interest can be iodinated using the lactoperoxidase method (Bennett and Horuk, Methods in Enzymology 288 pg.134-148 (1997)).
  • a radiolabeled anti-TfR antibody is purified from free 125 I-Na by gel filtration using a NAP-5 column and its specific activity measured.
  • Competition reaction mixtures of 50 ⁇ ⁇ containing a fixed concentration of iodinated antibody and decreasing concentrations of serially diluted unlabeled antibody are placed into 96-well plates.
  • Cells transiently expressing TfR are cultured in growth media, consisting of Dulbecco's modified eagle's medium (DMEM) (Genentech) supplemented with 10% FBS, 2 mM L-glutamine and
  • DMEM Dulbecco's modified eagle's medium
  • Competition reactions with cells are incubated for 2 hours at room temperature. After the 2-hour incubation, the competition reactions are transferred to a filter plate and washed four times with binding buffer to separate free from bound iodinated antibody. The filters are counted by gamma counter and the binding data are evaluated using the fitting algorithm of Munson and odbard (1980) to determine the binding affinity of the antibody.
  • compositions of the invention may be performed as follows. Kd was measured using surface plasmon resonance assays using a
  • BIACORE®-2000 (BIAcore, Inc., Piscataway, NJ) at 25 °C using anti-human Fc kit (BiAcore Inc., Piscataway, NJ). Briefly, carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) were activated with N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions.
  • CM5 carboxymethylated dextran biosensor chips
  • EDC N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N-hydroxysuccinimide
  • Anti-human Fc antibody was diluted with 10 niM sodium acetate, pH 4.0, to 50 ⁇ g/ml before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10000 response units (RU) of coupled protein. Following the injection of antibody, 1 M ethanolamine was injected to block unreacted groups. For kinetics measurements, monospecific or multispecific anti-TfR antibody variants were injected in HBS-P to reach about 220 RU, then two-fold serial dilutions of MuTfR-His (0.61 nM to 157 nM) were injected in HBS-P at 25°C at a flow rate of approximately 30 ⁇ /min.
  • Kd is measured using surface plasmon resonance assays with a BIACORE®-2000 device (BIAcore, Inc., Piscataway, NJ) at 25°C using anti-human Fc kit (BiAcore Inc., Piscataway, NJ). Briefly, carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) are activated with N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions.
  • CM5 carboxymethylated dextran biosensor chips
  • EDC N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
  • NHS N-hydroxysuccinimide
  • Anti -human Fc antibody is diluted with 10 mM sodium acetate, pH 4.0, to 50 ⁇ g/ml before injection at a flow rate of 5 ⁇ /minute to achieve approximately 10000 response units (RU) of coupled protein. Following the injection of antibody, 1 M ethanolamine is injected to block unreacted groups.
  • anti-TfR antibody variants are injected in HBS-P to reach about 220 RU, then two-fold serial dilutions of TfR-His (0.61 nM to 157 nM) are injected in HBS-P at 25°C at a flow rate of approximately 30 ⁇ /min.
  • association rates (kon) and dissociation rates (koff) are calculated using a simple one-to-one Langmuir binding model (BIACORE ® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
  • the equilibrium dissociation constant (Kd) is calculated as the ratio koff/kon. See, e.g., Chen et al., J. Mol. Biol. 293:865-881 (1999).
  • IC50 for a given compound
  • a common approach is to perform a competition binding assay, such as that described herein.
  • a high IC50 indicates that more of the antibody is required to inhibit binding of the known ligand, and thus that the antibody's affinity for that ligand is relatively low.
  • a low IC50 indicates that less of the antibody is required to inhibit binding of the known ligand, and thus that the antibody's affinity for that ligand is relatively high.
  • An exemplary competitive ELISA assay to measure IC50 is one in which increasing concentrations of anti-Tf or anti-TfR/brain antigen (i.e., anti-TfR/BACEl) variant antibodies are used to compete against a biotinylated known anti-TfR antibody for binding to TfR.
  • the anti-TfR competition ELISA was performed in Maxisorp plates (Neptune, N.J.) coated with 2.5 ⁇ g/ml of purified murine TfR extracellular domain in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using Superblock blocking buffer in PBS (Thermo Scientific, Hudson, NH).
  • a titration of each individual anti-TfR or anti-TfR/brain antigen i.e., anti- TfR/BACEl (1 :3 serial dilution) was combined with biotinylated known anti-TfR (0.5 nM final concentration) and added to the plate for 1 hour at room temperature. Plates were washed with PBS/0.05% Tween 20, and HRP-streptavidin (Southern Biotech, Birmingham) was added to the plate and incubated for 1 hour at room temperature. Plates were washed with PBS/0.05% Tween 20, and biotinylated anti-TfR antibody bound to the plate was detected using TMB substrate (BioFX Laboratories, Owings Mills).
  • an antibody provided herein is an antibody fragment.
  • Antibody fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab')2, Fv, and scFv fragments, and other fragments described below.
  • Fab fragment antigen binding protein
  • Fab' fragment antigen binding protein
  • Fab'-SH fragment antigen binding protein
  • F(ab')2 fragment antigen binding protein
  • scFv fragments fragment antigen binding protein fragments
  • other fragments described below For a review of certain antibody fragments, see Hudson et al. Nat. Med. 9:129-134 (2003).
  • scFv fragments see, e.g., Pluckthiin, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer- Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Patent Nos. 5,571,894 and 5,587,458.
  • Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9:129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al., Nat. Med. 9:129-134 (2003).
  • Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody.
  • a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see, e.g., U.S. Patent No. 6,248,516 Bl).
  • Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein.
  • recombinant host cells e.g. E. coli or phage
  • an antibody provided herein is a chimeric antibody.
  • Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
  • a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
  • Chimeric antibodies of interest herein include "primatized" antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g.
  • a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
  • a chimeric antibody is a humanized antibody.
  • a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
  • a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
  • HVRs e.g., CDRs, (or portions thereof) are derived from a non-human antibody
  • FRs or portions thereof
  • a humanized antibody optionally will also comprise at least a portion of a human constant region.
  • some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
  • a non-human antibody e.g., the antibody from which the HVR residues are derived
  • Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit” method (see, e.g., Sims et al. J.
  • an antibody provided herein is a human antibody.
  • Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5 : 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).
  • Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
  • Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes.
  • the endogenous immunoglobulin loci have generally been inactivated.
  • Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol, 133 : 3001 (1984); Brodeur et al.,
  • Trioma technology Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3): 185-91 (2005).
  • Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
  • Antibodies of the invention may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol.
  • phage display methods repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PC ) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol, 12: 433-455 (1994). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
  • PC polymerase chain reaction
  • naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993).
  • naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992).
  • Patent publications describing human antibody phage libraries include, for example: US Patent No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126,
  • Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
  • an antibody provided herein is a multispecific antibody, e.g. a bispecific antibody.
  • Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites.
  • one of the binding specificities is for TfR and the other is for BACEl.
  • Bispecific antibodies may also be used to localize cytotoxic agents to cells which express Tf .
  • Bispecific antibodies can be prepared as full length antibodies or antibody fragments.
  • Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and Traunecker et al., EMBO J. 10: 3655 (1991)), and "knob-in-hole” engineering (see, e.g., U.S. Patent No.
  • Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., US Patent No. 4,676,980, and Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny et al., J. Immunol, 148(5): 1547-1553 (1992)); using "diabody” technology for making bispecific antibody fragments (see, e.g., Hollinger et al., Proc. Natl. Acad. Sci.
  • Engineered antibodies with three or more functional antigen binding sites including "Octopus antibodies” or “dual- variable domain immunoglobulins” (DVDs) are also included herein (see, e.g. US 2006/0025576A1, and Wu et al. Nature Biotechnology (2007)).
  • the antibody or fragment herein also includes a "Dual Acting FAb” or “DAF” comprising an antigen binding site that binds to TfR as well as another, different antigen, such as BACEl (see, US 2008/0069820, for example).
  • DAF Double Acting FAb
  • BACEl another, different antigen
  • the "coupling" is achieved by generating a multispecific antibody (e.g. a bispecific antibody).
  • Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens or epitopes.
  • the multispecific antibody comprises a first antigen binding site which binds the TfR and a second antigen binding site which binds a brain antigen, such as beta-secretase 1 (BACE1) or Abeta, and the other brain antigens disclosed herein.
  • BACE1 beta-secretase 1
  • An exemplary brain antigen bound by such multispecific/bispecific antibody is BACE1, and an exemplary antibody binding thereto is an antibody listed in Table 1 herein, such as antibody 6266.
  • knobs into holes as a method of producing multispecific antibodies is described, e.g., in U.S. Pat. No. 5,731,168, WO2009/089004, US2009/0182127, US2011/0287009, Marvin and Zhu, Acta Pharmacol. Sin. (2005) 26(6):649-658, and Kontermann (2005) Acta Pharmacol. Sin., 26: 1-9.
  • a brief nonlimiting discussion is provided below.
  • a “protuberance” refers to at least one amino acid side chain which projects from the interface of a first polypeptide and is therefore positionable in a compensatory cavity in the adjacent interface (i.e. the interface of a second polypeptide) so as to stabilize the heteromultimer, and thereby favor heteromultimer formation over homomultimer formation, for example.
  • the protuberance may exist in the original interface or may be introduced synthetically (e.g. by altering nucleic acid encoding the interface). In some embodiments, nucleic acid encoding the interface of the first polypeptide is altered to encode the protuberance.
  • nucleic acid encoding at least one "original” amino acid residue in the interface of the first polypeptide is replaced with nucleic acid encoding at least one "import” amino acid residue which has a larger side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue.
  • the side chain volumes of the various amino residues are shown, for example, in Table 1 of US2011/0287009. A mutation to introduce a "protuberance" may be referred to as a "knob mutation.”
  • import residues for the formation of a protuberance are naturally occurring amino acid residues selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W).
  • an import residue is tryptophan or tyrosine.
  • the original residue for the formation of the protuberance has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine.
  • a "cavity” refers to at least one amino acid side chain which is recessed from the interface of a second polypeptide and therefore accommodates a corresponding protuberance on the adjacent interface of a first polypeptide.
  • the cavity may exist in the original interface or may be introduced synthetically (e.g. by altering nucleic acid encoding the interface).
  • nucleic acid encoding the interface of the second polypeptide is altered to encode the cavity. To achieve this, the nucleic acid encoding at least one "original" amino acid residue in the interface of the second polypeptide is replaced with DNA encoding at least one "import” amino acid residue which has a smaller side chain volume than the original amino acid residue.
  • import residues for the formation of a cavity are naturally occurring amino acid residues selected from alanine (A), serine (S), threonine (T) and valine (V).
  • an import residue is serine, alanine or threonine.
  • the original residue for the formation of the cavity has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan.
  • a mutation to introduce a "cavity" may be referred to as a "hole mutation.”
  • the protuberance is "positionable" in the cavity which means that the spatial location of the protuberance and cavity on the interface of a first polypeptide and second polypeptide respectively and the sizes of the protuberance and cavity are such that the protuberance can be located in the cavity without significantly perturbing the normal association of the first and second polypeptides at the interface.
  • protuberances such as Tyr, Phe and Trp do not typically extend perpendicularly from the axis of the interface and have preferred conformations
  • the alignment of a protuberance with a corresponding cavity may, in some instances, rely on modeling the protuberance/cavity pair based upon a three-dimensional structure such as that obtained by X-ray crystallography or nuclear magnetic resonance (NMR). This can be achieved using widely accepted techniques in the art.
  • a knob mutation in an IgGl constant region is T366W.
  • a hole mutation in an IgGl constant region comprises one or more mutations selected from T366S, L368A and Y407V.
  • a hole mutation in an IgGl constant region comprises T366S, L368A and Y407V.
  • SEQ ID NOs: 391 and 393 show exemplary IgGl constant regions with knob mutations (in addition to LALAPG and
  • SEQ ID NOs: 390 and 392 show exemplary IgGl constant region with hole mutations (in addition to LALAPG and LALAPG.YTE, discussed herein).
  • a knob mutation in an IgG4 constant region is T366W.
  • a hole mutation in an IgG4 constant region comprises one or more mutations selected from T366S, L368A, and Y407V.
  • a hole mutation in an IgG4 constant region comprises T366S, L368A, and Y407V.
  • amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
  • Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen- binding.
  • antibody variants having one or more amino acid substitutions are provided.
  • Sites of interest for substitutional mutagenesis include the HV s and FRs.
  • amino acid side chain classes amino acids side chain classes.
  • Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC
  • Amino acids may be grouped according to common side-chain properties:
  • Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
  • substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
  • a parent antibody e.g. a humanized or human antibody
  • the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody.
  • An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
  • Alterations may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity.
  • HVR "hotspots” i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity.
  • Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al.
  • variable genes chosen for maturation are introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or
  • HVR-directed approaches in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CD -H3 and CDR-L3 in particular are often targeted.
  • substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen.
  • conservative alterations e.g., conservative substitutions as provided herein
  • Such alterations may, for example, be outside of antigen contacting residues in the HVRs.
  • each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
  • a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
  • a residue or group of target residues e.g., charged residues such as arg, asp, his, lys, and glu
  • a neutral or negatively charged amino acid e.g., alanine or polyalanine
  • Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions.
  • a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution.
  • Variants may be screened to determine whether they contain the desired properties.
  • Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
  • terminal insertions include an antibody with an N-terminal methionyl residue.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
  • an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated.
  • Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
  • the carbohydrate attached thereto may be altered.
  • Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997).
  • the oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary
  • modifications of the oligosaccharide in an antibody of the invention may be made in order to create antibody variants with certain improved properties.
  • antibody variants having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region.
  • the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%.
  • the amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
  • Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about ⁇ 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
  • Examples of publications related to "defucosylated” or “fucose-deficient” antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621 ; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech.
  • Examples of cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al, especially at Example 11), and knockout cell lines, such as alpha- 1 ,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
  • Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean-Mairet et al.); US Patent No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided.
  • Such antibody variants may have improved CDC function.
  • Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 ( aju, S.); and WO 1999/22764 (Raju, S.).
  • one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
  • the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious.
  • In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
  • Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
  • NK cells express Fc(RIII only, whereas monocytes express Fc(RI, Fc(RII and Fc(RIII.
  • FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991).
  • Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc.
  • non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox 96 ® non-radioactive cytotoxicity assay (Promega, Madison, WI).
  • Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
  • ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. Proc. Nat 'l Acad. Sci. USA 95:652-656 (1998).
  • Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402.
  • a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol.
  • FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int 'l. Immunol.
  • Nonlimiting examples of antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056).
  • Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).
  • an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
  • alterations are made in the Fc region that result in altered ⁇ i.e., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in US Patent No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
  • CDC Complement Dependent Cytotoxicity
  • Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn.
  • Such nonlimiting Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371,826).
  • cysteine engineered antibodies e.g., "thioMAbs”
  • one or more residues of an antibody are substituted with cysteine residues.
  • the substituted residues occur at accessible sites of the antibody.
  • reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
  • any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region.
  • Cysteine engineered antibodies may be generated as described, e.g., in U.S. Patent No. 7,521,541.
  • an antibody provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
  • the moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers.
  • Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol,
  • polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
  • the polymer may be of any molecular weight, and may be branched or unbranched.
  • the number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
  • conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided.
  • the nonproteinaceous moiety is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600- 11605 (2005)).
  • the radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
  • Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4,816,567.
  • isolated nucleic acid encoding an anti-TfR/BACEl multispecific antibody described herein is provided.
  • Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
  • one or more vectors e.g., expression vectors
  • a host cell comprising such nucleic acid is provided.
  • a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
  • the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NSO, Sp20 cell).
  • a method of making an anti- TfR/BACEl multispecific antibody comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
  • a method of making a multispecific antibody comprises culturing in a host cell comprising nucleic acid encoding the multispecific antibody under conditions suitable for expression of the antibody, and optionaly recovering the multispecific antibody from the host cell (or host cell culture medium).
  • a method of making a multispecific antibody comprises culturing a first host cell comprising nucleic acid encoding a first VH/VL unit of the multispecific antibody (including constant region, if any, sometimes referred to as a "hemimer,” “half-antibody,” or “arm”) under conditions suitable for expression of the first VH/VL unit, and optionaly recovering the first VH/VL unit from the host cell (or host cell culture medium), and culturing a second host cell comprising nucleic acid encoding a second VH/VL unit of the multispecific antibody (including constant region, if any) under conditions suitable for expression of the second VH/VL unit, and optionaly recovering the second VH/VL unit from the host cell (or host cell culture medium).
  • the method further comprises assembling the multispecific antibody from an isolated first VH/VL unit and an isolated second VH/VL unit.
  • Such assembly may comprise, in some embodiments, a redox step to form intramolecular disulfides between the two VH/VL units (or hemimers).
  • Nonlimiting exemplary methods of producing multispecific antibodies are described, e.g., in US 2011/0287009, US 2007/0196363,
  • nucleic acid encoding an antibody is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
  • nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
  • Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
  • prokaryotic or eukaryotic cells described herein.
  • antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
  • expression of antibody fragments and polypeptides in bacteria see, e.g., U.S. Patent Nos. 5,648,237,
  • the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
  • eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, Nat. Biotech.
  • Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
  • Plant cell cultures can also be utilized as hosts. See, e.g., US Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
  • Vertebrate cells may also be used as hosts.
  • mammalian cell lines that are adapted to grow in suspension may be useful.
  • useful mammalian host cell lines are monkey kidney CVl line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod.
  • monkey kidney cells (CVl); African green monkey kidney cells (VE O-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TPJ cells, as described, e.g., in Mather et al Annals N Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells.
  • Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR " CHO cells (Urlaub et al Proc. Natl. Acad. Sci.
  • Anti-TfR/BACEl multispecific antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
  • ELISA enzyme linked immunosorbent assay
  • an antibody of the invention is tested for its antigen binding activity, e.g., by known methods such as ELISA, Western blot, etc.
  • competition assays may be used to identify an antibody that competes with any of the antibodies of the invention for binding to TfR and/or BACEl.
  • a competing antibody binds to the same epitope (e.g., a linear or a
  • conformational epitope that is bound by any of the antibodies of the invention, more specifically, any of the epitopes specifically bound by antibodies in class I, class II, class III or class IV as described herein (see, e.g., Example 1).
  • Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris (1996) "Epitope Mapping Protocols," in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).
  • immobilized TfR or BACEl i.e., antigen
  • a solution comprising a first labeled antibody (e.g., one or more of the antibodies disclosed herein) and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to antigen.
  • the second antibody may be present in a hybridoma supernatant.
  • immobilized antigen is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to antigen, excess unbound antibody is removed, and the amount of label associated with immobilized antigen is measured.
  • assays are provided for identifying antibodies having biological activity.
  • Biological activity may include, e.g., transporting a compound associated with/conjugated to the antibody across the BBB into the brain and/or CNS.
  • Antibodies having such biological activity in vivo and/or in vitro are also provided.
  • an antibody of the invention is tested for such biological activity.
  • the invention also provides immunoconjugates comprising an antibody herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
  • cytotoxic agents such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
  • the antibody herein is coupled with a neurological disorder drug, a chemotherapeutic agent and/or an imaging agent in order to more efficiently transport the drug, chemotherapeutic agent and/or the imaging agent across the BBB.
  • Covalent conjugation can either be direct or via a linker.
  • direct conjugation is by construction of a protein fusion (i.e., by genetic fusion of the two genes encoding the antibody and e.g., the neurological disorder drug and expression as a single protein).
  • direct conjugation is by formation of a covalent bond between a reactive group on one of the two portions of the antibody and a corresponding group or acceptor on the, e.g., neurological drug.
  • direct conjugation is by modification (i.e., genetic modification) of one of the two molecules to be conjugated to include a reactive group (as nonlimiting examples, a sulfhydryl group or a carboxyl group) that forms a covalent attachment to the other molecule to be conjugated under appropriate conditions.
  • a reactive group as nonlimiting examples, a sulfhydryl group or a carboxyl group
  • a molecule i.e., an amino acid
  • a desired reactive group i.e., a cysteine residue
  • Non-covalent conjugation can be by any nonconvalent attachment means, including hydrophobic bonds, ionic bonds, electrostatic interactions, and the like, as will be readily understood by one of ordinary skill in the art.
  • Conjugation may also be performed using a variety of linkers.
  • an antibody and a neurological drug may be conjugated using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4- (N-maleimidomethyl) cyclohexane-l-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HC1), active esters (such as
  • SPDP N-succinimidyl-3-(2-pyridyldithio) propionate
  • SMCC succinimidyl-4- (N-maleimidomethyl) cyclohexane-l-carboxylate
  • IT iminothiolane
  • bifunctional derivatives of imidoesters such as dimethyl adipimidate HC1
  • active esters such as
  • a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987).
  • Carbon- 14-labeled 1- isothi ocyanatobenzy 1-3 -methyldi ethylene triaminepentaacetic acid is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See W094/11026.
  • Peptide linkers comprised of from one to twenty amino acids joined by peptide bonds, may also be used.
  • the amino acids are selected from the twenty naturally-occurring amino acids.
  • one or more of the amino acids are selected from glycine, alanine, proline, asparagine, glutamine and lysine.
  • the linker may be a "cleavable linker" facilitating release of the neurological drug upon delivery to the brain.
  • a "cleavable linker” facilitating release of the neurological drug upon delivery to the brain.
  • an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Res. 52: 127-131 (1992); U.S. Patent No. 5,208,020) may be used.
  • the invention herein expressly contemplates, but is not limited to, conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo- KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4- vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., ockford, IL., U.S.A).
  • cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SB
  • an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Patent Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 Bl); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Patent Nos. 5,635,483 and 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Patent Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710,
  • an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
  • an enzymatically active toxin or fragment thereof including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (
  • an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate.
  • a variety of radioactive isotopes are available for the production of radioconjugates. Examples include At 211 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu.
  • the radioconjugate When used for detection, it may comprise a radioactive atom for scintigraphic studies, for example tc99m or 1123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine-123 again, iodine-131, indium-I l l, fluorine-19, carbon-13, nitrogen- 15, oxygen- 17, gadolinium, manganese or iron.
  • NMR nuclear magnetic resonance
  • any of the antibodies provided herein is useful for detecting the presence of antigen in a biological sample.
  • the term "detecting” as used herein encompasses quantitative or qualitative detection.
  • a biological sample comprises a cell or tissue, such as blood (i.e., immature red blood cells), CSF, and BBB-containing tissue.
  • an anti-TfR/BACEl multispecific antibody for use in a method of diagnosis or detection.
  • a method of detecting the presence of TfR and/or BACE1 in a biological sample comprises contacting the biological sample with an antibody as described herein under conditions permissive for binding of the antibody to antigen, and detecting whether a complex is formed between the antibody and antigen.
  • Such method may be an in vitro or in vivo method.
  • an antibody described herein is used to select subjects eligible for therapy with an anti-TfR/BACEl multispecific antibody, e.g. where TfR and/or BACE1 is a biomarker for selection of patients.
  • Exemplary disorders that may be diagnosed using an antibody of the invention includedisorders involving immature red blood cells, due to the fact that TfR is expressed in reticulocytes and is therefore detectable by any of the antibodies of the invention.
  • Such disorders include anemia and other disorders arising from reduced levels of reticulocytes, or congenital polycythemia or neoplastic polycythemia vera, where raised red blood cell counts due to hyperproliferation of, e.g., reticulocytes, results in thickening of blood and concomitant physiological symptoms. .
  • labeled anti-TfR/BACEl multispecific antibodies include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction.
  • Exemplary labels include, but are not limited to, the radioisotopes 32 P, 14 C, 125 1, 3 H, and 131 I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Patent No.
  • luciferin 2,3- dihydrophthalazinediones
  • horseradish peroxidase HRP
  • alkaline phosphatase alkaline phosphatase
  • ⁇ -galactosidase glucoamylase
  • lysozyme saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase
  • heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
  • the intact antibody lacks effector function.
  • the inact antibody has reduced effector function.
  • the intact antibody is engineered to have reduced effector function.
  • the antibody is a Fab.
  • the antibody has one or more Fc mutations reducing or eliminating effector function.
  • the antibody has modified glycosylation due, e.g., to producing the antibody in a system lacking normal human glycosylation enzymes.
  • the Ig backbone is modified to one which naturally possesses limited or no effector function.
  • ELISA enzyme linked immunosorbent assay
  • Assays for evaluating uptake of systemically administered antibody and other biological activity of the antibody can be performed as disclosed in the examples or as known for the anti-CNS antigen antibody of interest.
  • assays are provided for identifying anti-TfR/BACEl multispecific antibodies having biological activity.
  • Biological activity may include, e.g., inhibition of BACE1 aspartyl protease activity.
  • Antibodies having such biological activity in vivo and/or in vitro are also provided, e.g. as evaluated by homogeneous time-resolved fluorescence HTRF assay or a microfluidic capillary electrophoretic (MCE) assay using synthetic substrate peptides, or in vivo in cell lines which express BACE1 substrates such as APP.
  • MCE microfluidic capillary electrophoretic
  • compositions of an anti-TfR/BACEl multispecific antibody as described herein are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers, excipients or stabilizers ⁇ Remington 's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized
  • Pharmaceutically acceptable carriers, excipients, or stabilizers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol;
  • buffers such as phosphate, citrate, and other organic acids
  • antioxidants including ascorbic acid and methionine
  • preservatives such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or
  • resorcinol cyclohexanol; 3-pentanol; and m-cresol
  • low molecular weight polypeptides polypeptides
  • proteins such as serum albumin, gelatin, or immunoglobulins
  • hydrophilic polymers such as polyvinylpyrrolidone
  • amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine
  • chelating agents such as EDTA
  • sugars such as sucrose, mannitol, trehalose or sorbitol
  • salt-forming counter-ions such as sodium
  • metal complexes ⁇ e.g.
  • sHASEGP soluble neutral-active hyaluronidase glycoproteins
  • rHuPH20 HYLENEX ® , Baxter International, Inc.
  • Certain exemplary sHASEGPs and methods of use, including rHuPH20, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968.
  • a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
  • Aqueous antibody formulations include those described in US Patent No. 6,171,586 and WO2006/044908, the latter formulations including a histidine-acetate buffer.
  • the formulation herein may also contain more than one active ingredient as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
  • active ingredients for treating a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, an amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder or CNS inflammation.
  • active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
  • Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
  • One or more active ingredients may be encapsulated in liposomes that are coupled to anti-Tf /BACEl multispecific antibodies described herein ⁇ see e.g., U.S. Patent Application Publication No. 20020025313).
  • Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
  • Nonlimiting examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ⁇ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUP ON DEPOTTM (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D- (-)-3-hydroxybutyric acid.
  • polyesters for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)
  • polylactides U.S. Pat. No. 3,773,919
  • the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
  • any of the anti-TfR/BACEl multispecific antibodies provided herein may be used in therapeutic methods.
  • an anti-TfR/BACEl multispecific antibody for use as a medicament is provided.
  • the invention provides a method of transporting a therapeutic compound across the blood-brain barrier with reduced or eliminated impact on red blood cell populations comprising exposing the anti-TfR/BACE 1 multispecific antibody to the BBB such that the antibody is transported across the BBB.
  • the invention provides a method of transporting a neurological disorder drug across the blood-brain barrier comprising exposing an anti-TfR/BACEl multispecific antibody of the invention to the BBB such that the antibody is transported across the BBB with reduced or eliminated impact on red blood cell populations.
  • the BBB is in a mammal (e.g. a human), e.g. one which has a neurological disorder, including, without limitation: Alzheimer's disease (AD), stroke, dementia, muscular dystrophy (MD), multiple sclerosis (MS), amyotrophic lateral sclerosis (ALS), cystic fibrosis, Angelman's syndrome, Liddle syndrome, Parkinson's disease, Pick's disease, Paget's disease, cancer, traumatic brain injury, etc.
  • a neurological disorder including, without limitation: Alzheimer's disease (AD), stroke, dementia, muscular dystrophy (MD), multiple sclerosis (MS), amyotrophic lateral sclerosis (ALS), cystic fibrosis, Angelman's syndrome, Liddle syndrome, Parkinson's disease, Pick's disease, Paget's disease, cancer, traumatic brain injury, etc.
  • the neurological disorder is selected from: a neuropathy, an amyloidosis, cancer (e.g. involving the CNS or brain), an ocular disease or disorder, a viral or microbial infection, inflammation (e.g. of the CNS or brain), ischemia, neurodegenerative disease, seizure, behavioral disorder, lysosomal storage disease, etc.
  • the antibodies of the invention are particularly suited to treatment of such neurological disorders due to their ability to transport one or more associated active ingredients/coupled therapeutic compounds across the BBB and into the CNS/brain where such disorders find their molecular, cellular, or viral/microbial basis.
  • Neuropathy disorders are diseases or abnormalities of the nervous system characterized by inappropriate or uncontrolled nerve signaling or lack thereof, and include, but are not limited to, chronic pain (including nociceptive pain), pain caused by an injury to body tissues, including cancer-related pain, neuropathic pain (pain caused by abnormalities in the nerves, spinal cord, or brain), and psychogenic pain (entirely or mostly related to a psychological disorder), headache, migraine, neuropathy, and symptoms and syndromes often accompanying such neuropathy disorders such as vertigo or nausea.
  • chronic pain including nociceptive pain
  • pain caused by an injury to body tissues including cancer-related pain
  • neuropathic pain pain caused by abnormalities in the nerves, spinal cord, or brain
  • psychogenic pain include, but are not limited to, headache, migraine, neuropathy, and symptoms and syndromes often accompanying such neuropathy disorders such as vertigo or nausea.
  • a neurological drug may be selected that is an analgesic including, but not limited to, a narcotic/opioid analgesic (i.e., morphine, fentanyl, hydrocodone, meperidine, methadone, oxymorphone, pentazocine, propoxyphene, tramadol, codeine and oxycodone), a nonsteroidal anti-inflammatory drug (NSAID) (i.e., ibuprofen, naproxen, diclofenac, diflunisal, etodolac, fenoprofen, flurbiprofen, indomethacin, ketorolac, mefenamic acid, meloxicam, nabumetone, oxaprozin, piroxicam, sulindac, and tolmetin), a corticosteroid (i.e., cortisone, prednisone, prednisolone
  • NSAID nonsteroidal anti-
  • a neurological drug may be selected that is an anti-vertigo agent including, but not limited to, meclizine, diphenhydramine, promethazine and diazepam.
  • a neurological drug may be selected that is an anti-nausea agent including, but not limited to, promethazine, chlorpromazine, prochlorperazine, trimethobenzamide, and metoclopramide.
  • Amyloidoses are a group of diseases and disorders associated with extracellular proteinaceous deposits in the CNS, including, but not limited to, secondary amyloidosis, age- related amyloidosis, Alzheimer's Disease (AD), mild cognitive impairment (MCI), Lewy body dementia, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type); the Guam Parkinson-Dementia complex, cerebral amyloid angiopathy, Huntington's disease, progressive supranuclear palsy, multiple sclerosis; Creutzfeld Jacob disease, Parkinson's disease, transmissible spongiform encephalopathy, HIV-related dementia, amyotropic lateral sclerosis (ALS), inclusion-body myositis (IBM), and ocular diseases relating to beta-amyloid deposition (i.e., macular degeneration, drusen-related optic neuropathy, and cataract).
  • AD Alzheimer's Disease
  • MCI mild cognitive impairment
  • Lewy body dementia Down's
  • a neurological drug may be selected that includes, but is not limited to, an antibody or other binding molecule (including, but not limited to a small molecule, a peptide, an aptamer, or other protein binder) that specifically binds to a target selected from: beta secretase, tau, presenilin, amyloid precursor protein or portions thereof, amyloid beta peptide or oligomers or fibrils thereof, death receptor 6 (D 6), receptor for advanced glycation endproducts (RAGE), parkin, and huntingtin; a cholinesterase inhibitor (i.e., galantamine, donepezil, rivastigmine and tacrine); an NMDA receptor antagonist (i.e., memantine), a monoamine depletor (i.e.,
  • tetrabenazine an ergoloid mesylate; an anticholinergic antiparkinsonism agent (i.e., procyclidine, diphenhydramine, trihexylphenidyl, benztropine, biperiden and trihexyphenidyl); a dopaminergic antiparkinsonism agent (i.e., entacapone, selegiline, pramipexole, bromocriptine, rotigotine, selegiline, ropinirole, rasagiline, apomorphine, carbidopa, levodopa, pergolide, tolcapone and amantadine); a tetrabenazine; an anti-inflammatory (including, but not limited to, a nonsteroidal anti-inflammatory drug (i.e., indomethicin and other compounds listed above); a hormone (i.e., estrogen, progesterone and leuprolide); a vitamin (i.e., folate
  • Cancers of the CNS are characterized by aberrant proliferation of one or more CNS cell (i.e., a neural cell) and include, but are not limited to, glioma, glioblastoma multiforme, meningioma, astrocytoma, acoustic neuroma, chondroma, oligodendroglioma, medulloblastomas, ganglioglioma, Schwannoma, neurofibroma, neuroblastoma, and extradural, intramedullary or intradural tumors.
  • glioma glioblastoma multiforme
  • meningioma astrocytoma
  • acoustic neuroma chondroma
  • oligodendroglioma oligodendroglioma
  • medulloblastomas ganglioglioma
  • Schwannoma neurofibroma
  • neurofibroma neuroblastoma
  • a neurological drug may be selected that is a chemotherapeutic agent.
  • chemotherapeutic agents include alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphor- amide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); delta-9- tetrahydrocannabinol (dronabinol, MARINOL®); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including
  • calicheamicin especially calicheamicin gammall and calicheamicin omegall
  • dynemicin including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin, cyanomorph
  • androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfomithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pen
  • TAXOTERE® doxetaxel (Rhone-Poulenc Rorer, Antony, France); chloranbucil; gemcitabine (GEMZAR®); 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carbop latin; vinblastine (VELBAN®); platinum; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine (ONCOVIN®); oxaliplatin; leucovovin; vinorelbine (NAVELBINE®); novantrone; edatrexate; daunomycin; aminopterin; ibandronate; topoisomerase inhibitor RFS 2000;
  • DMFO difluorometlhylornithine
  • retinoids such as retinoic acid
  • capecitabine XELODA®
  • pharmaceutically acceptable salts, acids or derivatives of any of the above as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin (ELOXATINTM) combined with 5-FU and leucovovin.
  • ELOXATINTM oxaliplatin
  • chemotherapeutic agents are anti-hormonal agents that act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer, and are often in the form of systemic, or whole-body treatment. They may be hormones themselves. Examples include anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX® tamoxifen), EVISTA® raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and
  • SERMs selective estrogen receptor modulators
  • LHRH le
  • chemotherapeutic agents includes bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), DIDROCAL® etidronate, NE-58095, ZOMETA® zoledronic acid/zoledronate, FOSAMAX® alendronate, AREDIA® pamidronate, SKELID® tiludronate, or ACTONEL® risedronate; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha, af, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine; LURTOTECAN
  • anti-cancer immunoglobulins including, but not limited to, trastuzumab, pertuzumab, bevacizumab, alemtuxumab, cetuximab, gemtuzumab ozogamicin, ibritumomab tiuxetan, panitumumab and rituximab.
  • antibodies in conjunction with a toxic label or conjugate may be used to target and kill desired cells (i.e., cancer cells), including, but not limited to, tositumomab with a 131 I radiolabel, or trastuzumab emtansine.
  • Ocular diseases or disorders are diseases or disorders of the eye, which for the purposes herein is considered a CNS organ segregated by the BBB.
  • Ocular diseases or disorders include, but are not limited to, disorders of sclera, cornea, iris and ciliary body (i.e., scleritis, keratitis, corneal ulcer, corneal abrasion, snow blindness, arc eye, Thygeson's superficial punctate keratopathy, corneal neovascularisation, Fuchs' dystrophy, keratoconus, keratoconjunctivitis sicca, ulceris and uveitis), disorders of the lens (i.e., cataract), disorders of choroid and retina (i.e., retinal detachment, retinoschisis, hypertensive retinopathy, diabetic retinopathy, retinopathy, retinopathy of prematurity, age-related macular degeneration, macular degeneration (wet or dry), epi
  • a neurological drug may be selected that is an anti- angiogenic ophthalmic agent (i.e., bevacizumab, ranibizumab and pegaptanib), an ophthalmic glaucoma agent (i.e., carbachol, epinephrine, demecarium bromide, apraclonidine, brimonidine, brinzolamide, levobunolol, timolol, betaxolol, dorzolamide, bimatoprost, carteolol, metipranolol, dipivefrin, travoprost and latanoprost), a carbonic anhydrase inhibitor (i.e., methazolamide and acetazolamide), an ophthalmic antihistamine (i.e., naphazoline, phenylephrine and tetrahydrozoline), an ocular lubricant,
  • an ophthalmic anesthetic i.e., lidocaine, proparacaine and tetracaine
  • an ophthalmic anti-infective i.e., levofloxacin, gatifloxacin, ciprofloxacin, moxifloxacin, chloramphenicol, bacitracin/polymyxin b, sulfacetamide, tobramycin, azithromycin, besifloxacin, norfloxacin, sulfisoxazole, gentamicin, idoxuridine, erythromycin, natamycin, gramicidin, neomycin, ofloxacin, trifluridine, ganciclovir, vidarabine), an ophthalmic anti-inflammatory agent (i.e., nepafenac, ketorolac, flurbiprofen, suprofen, cyclosporine, triamcinolone, diclofenac and
  • Viral or microbial infections of the CNS include, but are not limited to, infections by viruses (i.e., influenza, HIV, poliovirus, rubella, ), bacteria (i.e., Neisseria sp., Streptococcus sp., Pseudomonas sp., Proteus sp., E. coli, S. aureus, Pneumococcus sp., Meningococcus sp.,
  • viruses i.e., influenza, HIV, poliovirus, rubella,
  • bacteria i.e., Neisseria sp., Streptococcus sp., Pseudomonas sp., Proteus sp., E. coli, S. aureus, Pneumococcus sp., Meningococcus sp.
  • viruses i.e., influenza, HIV, poliovirus, rubella,
  • bacteria
  • Haemophilus sp., and Mycobacterium tuberculosis and other microorganisms such as fungi (i.e., yeast, Cryptococcus neoformans), parasites (i.e., toxoplasma gondii) or amoebas resulting in CNS pathophysiologies including, but not limited to, meningitis, encephalitis, myelitis, vasculitis and abscess, which can be acute or chronic.
  • fungi i.e., yeast, Cryptococcus neoformans
  • parasites i.e., toxoplasma gondii
  • amoebas resulting in CNS pathophysiologies including, but not limited to, meningitis, encephalitis, myelitis, vasculitis and abscess, which can be acute or chronic.
  • a neurological drug may be selected that includes, but is not limited to, an antiviral compound (including, but not limited to, an adamantane antiviral (i.e., rimantadine and amantadine), an antiviral interferon (i.e., peginterferon alfa-2b), a chemokine receptor antagonist (i.e., maraviroc), an integrase strand transfer inhibitor (i.e., raltegravir), a neuraminidase inhibitor (i.e., oseltamivir and zanamivir), a non-nucleoside reverse transcriptase inhibitor (i.e., efavirenz, etravirine, delavirdine and nevirapine), a nucleoside reverse transcriptase inhibitors (tenofovir, abacavir, lamivudine, zidovudine, stavudin
  • an antiviral compound including, but not limited to
  • carbapenem/penem i.e., imipenem, meropenem, ertapenem, faropenem and doripenem
  • a monobactam i.e., aztreonam, tigemonam, norcardicin A and tabtoxinine-beta- lactam
  • a beta- lactamase inhibitor i.e., clavulanic acid, tazobactam and sulbactam
  • an aminoglycoside i.e., amikacin, gentamicin, kanamycin, neomycin, netilmicin, streptomycin, tobramycin, and paromomycin
  • an ansamycin i.e., geldanamycin and herbimycin
  • a carbacephem i.e., loracarbef
  • a glycopeptides i.e., teicoplanin and vancomycin
  • a macrolide i.
  • Inflammation of the CNS includes, but is not limited to, inflammation that is caused by an injury to the CNS, which can be a physical injury (i.e., due to accident, surgery, brain trauma, spinal cord injury, concussion) and an injury due to or related to one or more other diseases or disorders of the CNS (i.e., abscess, cancer, viral or microbial infection).
  • an injury to the CNS which can be a physical injury (i.e., due to accident, surgery, brain trauma, spinal cord injury, concussion) and an injury due to or related to one or more other diseases or disorders of the CNS (i.e., abscess, cancer, viral or microbial infection).
  • a neurological drug may be selected that addresses the inflammation itself (i.e., a nonsteroidal anti-inflammatory agent such as ibuprofen or naproxen), or one which treats the underlying cause of the inflammation (i.e., an anti-viral or anti-cancer agent).
  • a nonsteroidal anti-inflammatory agent such as ibuprofen or naproxen
  • an anti-viral or anti-cancer agent i.e., an anti-viral or anti-cancer agent
  • Ischemia of the CNS refers to a group of disorders relating to aberrant blood flow or vascular behavior in the brain or the causes therefor, and includes, but is not limited to: focal brain ischemia, global brain ischemia, stroke (i.e., subarachnoid hemorrhage and intracerebral hemorrhage), and aneurysm.
  • a neurological drug may be selected that includes, but is not limited to, a thrombolytic (i.e., urokinase,reteplase, reteplase and tenecteplase), a platelet aggregation inhibitor (i.e., aspirin, cilostazol, clopidogrel, prasugrel and dipyridamole), a statin (i.e., lovastatin, pravastatin, fluvastatin, rosuvastatin, atorvastatin, simvastatin, cerivastatin and pitavastatin), and a compound to improve blood flow or vascular flexibility, including, e.g., blood pressure medications.
  • a thrombolytic i.e., urokinase,reteplase, reteplase and tenecteplase
  • a platelet aggregation inhibitor i.e., aspirin, cilostazol,
  • Neurodegenerative diseases are a group of diseases and disorders associated with neural cell loss of function or death in the CNS, and include, but are not limited to:
  • adrenoleukodystrophy Alexander's disease, Alper's disease, amyotrophic lateral sclerosis, ataxia telangiectasia, Batten disease, cockayne syndrome, corticobasal degeneration, degeneration caused by or associated with an amyloidosis, Friedreich's ataxia, frontotemporal lobar degeneration, Kennedy's disease, multiple system atrophy, multiple sclerosis, primary lateral sclerosis, progressive supranuclear palsy, spinal muscular atrophy, transverse myelitis, efsum's disease, and spinocerebellar ataxia.
  • a neurological drug may be selected that is a growth hormone or neurotrophic factor; examples include but are not limited to brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, TGF-beta, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-lra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet- derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, glial cell line derived neurotrophic factor (GFPv), granulocyte-colony stimulating factor
  • BDNF brain-derived neurotrophic factor
  • Seizure diseases and disorders of the CNS involve inappropriate and/or abnormal electrical conduction in the CNS, and include, but are not limited to epilepsy (i.e., absence seizures, atonic seizures, benign Rolandic epilepsy, childhood absence, clonic seizures, complex partial seizures, frontal lobe epilepsy, febrile seizures, infantile spasms, juvenile myoclonic epilepsy, juvenile absence epilepsy, Lennox-Gastaut syndrome, Landau-Kleffher Syndrome, Dravet's syndrome, Otahara syndrome, West syndrome, myoclonic seizures, mitochondrial disorders, progressive myoclonic epilepsies, psychogenic seizures, reflex epilepsy, Rasmussen's Syndrome, simple partial seizures, secondarily generalized seizures, temporal lobe epilepsy, toniclonic seizures, tonic seizures, psychomotor seizures, limbic epilepsy, partial-onset seizures, generalized- onset seizures, status epilepticus, abdominal epilepsy, akinetic seizures, autonomic seizures
  • a neurological drug may be selected that is an anticonvulsant or antiepileptic including, but not limited to, barbiturate anticonvulsants (i.e., primidone, metharbital, mephobarbital, allobarbital, amobarbital, aprobarbital, alphenal, barbital, brallobarbital and phenobarbital), benzodiazepine anticonvulsants (i.e., diazepam, clonazepam, and lorazepam), carbamate anticonvulsants (i.e.
  • barbiturate anticonvulsants i.e., primidone, metharbital, mephobarbital, allobarbital, amobarbital, aprobarbital, alphenal, barbital, brallobarbital and phenobarbital
  • benzodiazepine anticonvulsants i.e., diazepam, clonazepam,
  • felbamate carbonic anhydrase inhibitor anticonvulsants (i.e., acetazolamide, topiramate and zonisamide), dibenzazepine anticonvulsants (i.e., rufinamide, carbamazepine, and oxcarbazepine), fatty acid derivative anticonvulsants (i.e., divalproex and valproic acid), gamma-aminobutyric acid analogs (i.e., pregabalin, gabapentin and vigabatrin), gamma-aminobutyric acid reuptake inhibitors (i.e., tiagabine), gamma-aminobutyric acid transaminase inhibitors (i.e., vigabatrin), hydantoin anticonvulsants (i.e.
  • phenytoin, ethotoin, fosphenytoin and mephenytoin miscellaneous anticonvulsants (i.e., lacosamide and magnesium sulfate), progestins (i.e., progesterone), oxazolidinedione anticonvulsants (i.e., paramethadione and trimethadione), pyrrolidine anticonvulsants (i.e., levetiracetam), succinimide anticonvulsants (i.e., ethosuximide and methsuximide), triazine anticonvulsants (i.e., lamotrigine), and urea
  • progestins i.e., progesterone
  • oxazolidinedione anticonvulsants i.e., paramethadione and trimethadione
  • pyrrolidine anticonvulsants i.e., levetiracetam
  • anticonvulsants i.e., phenacemide and pheneturide.
  • Behavioral disorders are disorders of the CNS characterized by aberrant behavior on the part of the afflicted subject and include, but are not limited to: sleep disorders (i.e., insomnia, parasomnias, night terrors, circadian rhythm sleep disorders, and narcolepsy), mood disorders (i.e., depression, suicidal depression, anxiety, chronic affective disorders, phobias, panic attacks, obsessive-compulsive disorder, attention deficit hyperactivity disorder (ADHD), attention deficit disorder (ADD), chronic fatigue syndrome, agoraphobia, post-traumatic stress disorder, bipolar disorder), eating disorders (i.e., anorexia or bulimia), psychoses, developmental behavioral disorders (i.e., autism, Rett's syndrome, Aspberger's syndrome), personality disorders and psychotic disorders (i.e., schizophrenia, delusional disorder, and the like).
  • sleep disorders i.e., insomnia, parasomnias, night terrors, circadian rhythm sleep disorders, and narcolepsy
  • mood disorders i
  • a neurological drug may be selected from a behavior- modifying compound including, but not limited to, an atypical antipsychotic (i.e., risperidone, olanzapine, apripiprazole, quetiapine, paliperidone, asenapine, clozapine, iloperidone and ziprasidone), a phenothiazine antipsychotic (i.e., prochlorperazine, chlorpromazine, fluphenazine, perphenazine, trifluoperazine, thioridazine and mesoridazine), a thioxanthene (i.e., thiothixene), a miscellaneous antipsychotic (i.e., pimozide, lithium, molindone, haloperidol and loxapine), a selective serotonin reuptake inhibitor (i.e., citalopram,
  • atypical antipsychotic i
  • antidepressant i.e., mirtazapine and maprotiline
  • a phenylpiperazine antidepressant i.e., trazodone and nefazodone
  • a monoamine oxidase inhibitor i.e., isocarboxazid, phenelzine, selegiline and tranylcypromine
  • a benzodiazepine i.e., alprazolam, estazolam, flurazeptam, clonazepam, lorazepam and diazepam
  • a norepinephrine-dopamine reuptake inhibitor i.e., bupropion
  • a CNS stimulant i.e., phentermine, diethylpropion, methamphetamine
  • dextroamphetamine amphetamine, methylphenidate, dexmethylphenidate, lisdexamfetamine, modafinil, pemoline, phendimetrazine, benzphetamine, phendimetrazine, armodafinil, diethylpropion, caffeine, atomoxetine, doxapram, and mazindol
  • anxiolytic/sedative/hypnotic including, but not limited to, a barbiturate (i.e., secobarbital, phenobarbital and mephobarbital), a benzodiazepine (as described above), and a miscellaneous anxiolytic/sedative/hypnotic (i.e.
  • Lysosomal storage disorders are metabolic disorders which are in some cases associated with the CNS or have CNS-specific symptoms; such disorders include, but are not limited to: Tay-Sachs disease, Gaucher's disease, Fabry disease, mucopolysaccharidosis (types I, II, III, IV, V, VI and VII), glycogen storage disease, GM1 -gangliosidosis, metachromatic leukodystrophy, Farber's disease, Canavan's leukodystrophy, and neuronal ceroid lipofuscinoses types 1 and 2, Niemann-Pick disease, Pompe disease, and Krabbe's disease.
  • a neurological drug may be selected that is itself or otherwise mimics the activity of the enzyme that is impaired in the disease.
  • Exemplary recombinant enzymes for the treatment of lysosomal storage disorders include, but are not limited to those set forth in e.g., U.S. Patent Application publication no.
  • 2005/0142141 i.e., alpha-L- iduronidase, iduronate-2-sulphatase, N-sulfatase, alpha-N-acetylglucosaminidase, N-acetyl- galactosamine-6-sulfatase, beta-galactosidase, arylsulphatase B, beta-glucuronidase, acid alpha- glucosidase, glucocerebrosidase, alpha-galactosidase A, hexosaminidase A, acid
  • sphingomyelinase beta-galactocerebrosidase, beta-galactosidase, arylsulfatase A, acid ceramidase, aspartoacylase, palmitoyl-protein thioesterase 1 and tripeptidyl amino peptidase 1).
  • diseases related to or caused by inappropriate overproduction of red blood cells, or wherein the overproduction of red blood cells is an effect of the disease can be prevented or treated by the reticulocyte-depleting effect recognized herein of anti-TfR antibodies retaining at least partial effector function.
  • the reticulocyte-depleting effect recognized herein of anti-TfR antibodies retaining at least partial effector function.
  • elevated red blood cell counts due to hyperproliferation of, e.g., reticulocytes results in thickening of blood and concomitant physiological symptoms (d'Onofrio et al., Clin. Lab. Haematol. (1996) Suppl. 1 : 29-34).
  • an anti-TfR/BACEl multispecific antibody of the invention wherein at least partial effector function of the antibody was preserved would permit selective removal of immature reticulocyte populations without impacting normal transferrin transport into the CNS. Dosing of such an antibody could be modulated such that acute clinical symptoms could be minimized (ie, by dosing at a very low dose or at widely-spaced intervals), as well-understood in the art.
  • an antibody of the invention is used to detect a neurological disorder before the onset of symptoms and/or to assess the severity or duration of the disease or disorder.
  • the antibody permits detection and/or imaging of the neurological disorder, including imaging by radiography, tomography, or magnetic resonance imaging (MRI).
  • an anti-TfR/BACEl multispecific antibody for use as a medicament is provided.
  • the anti-TfR/BACEl multispecific antibody has low affinity for TfR.
  • an anti-TfR/BACEl multispecific antibody for use in treating a neurological disease or disorder e.g., Alzheimer's disease
  • red blood cells ie, reticulocytes
  • a modified anti-TfR/BACEl multispecific antibody with low affinity for TfR for use in a method of treatment as described herein is provided.
  • the invention provides an anti-TfR/BACEl multispecific antibody that has been modified to improve its safety for use in a method of treating an individual having a neurological disease or disorder comprising administering to the individual an effective amount of the anti-TfR/BACEl antibody. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent. In further embodiments, the invention provides an anti-TfR/BACEl multispecific antibody modified to improve its safety for use in reducing or inhibiting amlyoid plaque formation in a patient at risk or suffering from a neurological disease or disorder (e.g., Alzheimer's disease). An "individual" according to any of the above embodiments is optionally a human. In certain aspects, the anti- TfR/BACEl multispecific antibody of the invention for use in the methods of the invention improves uptake of the neurological disorder drug with which it is coupled.
  • the invention provides for the use of an anti-TfR/BACEl multispecific antibody of the invention in the manufacture or preparation of a medicament.
  • the anti-TfR/BACEl multispecific antibody has low affinity for TfR.
  • the medicament is for treatment of neurological disease or disorder.
  • the medicament is for use in a method of treating neurological disease or disorder comprising administering to an individual having neurological disease or disorder an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent.
  • the invention provides a method for treating Alzheimer's disease.
  • the method comprises administering to an individual having Alzheimer's disease an effective amount of an anti-TfR/BACEl multispecific antibody of the invention. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent.
  • An "individual" according to any of the above embodiments may be a human.
  • the anti-TfR/BACEl multispecific antibodies of the invention can be used either alone or in combination with other agents in a therapy.
  • the anti-TfR/BACEl multispecific antibody of the invention may be co-administered with at least one additional therapeutic agent.
  • an additional therapeutic agent is a therapeutic agent effective to treat the same or a different neurological disorder as the anti-TfR/BACEl multispecific antibody is being employed to treat.
  • Exemplary additional therapeutic agents include, but are not limited to: the various neurological drugs described above, cholinesterase inhibitors (such as donepezil, galantamine, rovastigmine, and tacrine), NMDA receptor antagonists (such as memantine), amyloid beta peptide aggregation inhibitors, antioxidants, ⁇ -secretase modulators, nerve growth factor (NGF) mimics or NGF gene therapy, PPARy agonists, HMS-CoA reductase inhibitors (statins), ampakines, calcium channel blockers, GABA receptor antagonists, glycogen synthase kinase inhibitors, intravenous immunoglobulin, muscarinic receptor agonists, nicrotinic receptor modulators, active or passive amyloid beta peptide immunization, phosphodiesterase inhibitors, serotonin receptor antagonists and anti-amyloid beta peptide antibodies.
  • the at least one additional therapeutic agent is selected for its ability to mitigate one or more side effects of the neurological drugs described
  • certain anti-TfR/BACEl multispecific antibodies may have side effects that negatively impact reticulocyte populations in a subject treated with the anti- TfR/BACEl multispecific antibody.
  • at least one further therapeutic agent selected for its ability to mitigate such negative side effect on reticulocyte populations is coadministered with an anti-TfR/BACEl multispecific antibody of the invention.
  • agents to increase red blood cell (ie, reticulocyte) populations agents to support growth and development of red blood cells (ie, reticulocytes), and agents to protect red blood cell populations from the effects of the anti- TfR/BACEl multispecific antibody
  • agents to protect red blood cell populations from the effects of the anti- TfR/BACEl multispecific antibody include, but are not limited to, erythropoietin (EPO), iron supplements, vitamin C, folic acid, and vitamin B12, as well as physical replacement of red blood cells (ie, reticulocytes) by, for example, transfusion with similar cells, which may be from another individual of similar blood type or may have been previously extracted from the subject to whom the anti-TfR/BACEl multispecific antibody is administered.
  • EPO erythropoietin
  • iron supplements iron supplements
  • vitamin C folic acid
  • vitamin B12 vitamin B12
  • agents intended to protect existing red blood cells are preferably administered to the subject preceding or concurrent with the anti-TfR/BACEl multispecific antibody therapy, while agents intended to support or initiate the regrowth/development of red blood cells or blood cell populations (ie, reticulocytes or reticulocyte populations) are preferably administered concurrent with or after the anti-TfR/BACEl multispecific antibody therapy such that such blood cells can be replenished after the anti- TfR/BACEl multispecific antibody treatment.
  • the at least one further therapeutic agent is selected for its ability to inhibit or prevent the activation of the complement pathway upon administration of the anti-TfR/BACEl multispecific antibody.
  • therapeutic agents include, but are not limited to, agents that interfere with the ability of the anti-TfR/BACEl multispecific antibody to bind to or activate the complement pathway and agents that inhibit one or more molecular interactions within the complement pathway, and are described generally in Mollnes and
  • administration where two or more therapeutic agents are included in the same or separate formulations
  • separate administration in which case, administration of the antibody of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant.
  • administration of the anti-TfR/BACEl multispecific antibody and administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five or six days, of each other.
  • Antibodies of the invention can also be used in combination with other interventional therapies such as, but not limited to, radiation therapy, behavioral therapy, or other therapies known in the art and appropriate for the neurological disorder to be treated or prevented.
  • An anti-TfR/BACEl multispecific antibody of the invention (and any additional therapeutic agent) can be administered by any suitable means, including parenteral,
  • parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
  • Antibodies of the invention would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
  • the antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question or to prevent, mitigate or ameliorate one or more side effects of antibody administration.
  • the effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
  • an antibody of the invention when used alone or in combination with one or more other additional therapeutic agents, will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
  • the antibody is suitably administered to the patient at one time or over a series of treatments.
  • about 1 ⁇ g/kg to 15 mg/kg (e.g. 0.1 mg/kg- lOmg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
  • One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
  • One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 40 mg/kg.
  • one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg, 5.0 mg/kg, 7.5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg or 40 mg/kg (or any combination thereof) may be administered to the patient.
  • Such doses may be administered intermittently, e.g.
  • one method to reduce impact on reticulocyte populations by administration of anti-Tf /BACEl multispecific antibodies is to modify the amount or timing of the doses such that overall lower quantities of circulating antibody are present in the bloodstream to interact with reticulocytes.
  • a lower dose of the anti-TfR/BACEl multispecific antibodies may be administered with greater frequency than a higher dose would be.
  • the dosage used may be balanced between the amount of antibody necessary to be delivered to the CNS (itself related to the affinity of the CNS antigen-specific portion of the antibody), the affinity of that antibody for TfR, and whether or not red blood cell (ie, reticulocyte) -protecting, growth and development-stimulating, or complement pathway-inhibiting compound(s) are being co- or serially administered with the antibody.
  • red blood cell ie, reticulocyte
  • an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above comprises a container and a label or package insert on or associated with the container.
  • Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
  • the containers may be formed from a variety of materials such as glass or plastic.
  • the container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
  • At least one active agent in the composition is an antibody of the invention.
  • the label or package insert indicates that the composition is used for treating the condition of choice.
  • the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent.
  • the article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
  • the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically- acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
  • BWFI bacteriostatic water for injection
  • phosphate-buffered saline such as bacterio
  • any of the above articles of manufacture may include a bispecific antibody immunoconjugate of the invention in place of or in addition to a bispecific antibody of the invention.
  • EXAMPLE 1 GENERATION, CHARACTERIZATION AND HUMANIZATION OF HUMAN/CYNO CROSS-REACTIVE ANTI-TFR ANTIBODIES
  • a naive antibody phage panning process was performed in an attempt to identify antibodies cross-reactive with both human Tf and Tf from cynomolgous (“cyno") monkeys that further did not compete with Tf for binding to TfR ⁇ Lee et al. JMB (2004) 1073- 1093). No such cross-reactive, non-Tf-competing clone was identified from this phage panning process. However, two antibodies were identified that were useful in characterizing subsequently generated hybridoma clones.
  • a species cross-reactive antibody was identified that competes with Tf for binding to human or cyno TfR (Tf-competing antibody).
  • Tf-competing antibody The epitope of another clone, specific for human TfR, was mapped to the apical domain of huTfR using mouse/human chimeric TfR receptors ( Figure 1). This apical domain-binding clone lost binding to huTfR when the mouse TfR sequence in the apical domain was substituted into huTfR.
  • Human and cyno cross-reactive TfR antibodies were generated by immunizing 5 Balb/C mice in the footpad with 6 doses (twice per week) containing 2 ⁇ g each of cynoTfR and huTfR ecd. All mice sera were FACS positive and all mice were fused. Of 1632 hybridomas screened, 111 were ELISA positive for binding to both human and cyno TfR.
  • the resulting ELISA-positive hybridomas were screened by FACS in the presence of 1 ⁇ human holo-Tf for binding to 293 cells transiently expressing human or cyno TfR. Briefly, FACS analysis was performed using 293 cells transfected with full length human or cyno TfR using lipofectamin 2000 plus (Invitrogen) 48-72 h before FACS analysis.
  • Non-transfected (control) and transfected 293 cells were washed twice with FACS buffer (PBS containing 1% BSA), 50 ⁇ of hybridoma supernatant (normalized to 10 ⁇ g/ml) was added to 293 cells in the presence of 1 ⁇ human holo-Tf and incubated on ice for 30 min. Cells were washed twice with FACS buffer, 50 ⁇ of PE-Goat-anti-murine Fey (Jackson ImmunoResearch) was added to cells and they were incubated on ice for 30 min. Cells were washed with FACS buffer and resuspended in ⁇ FACS buffer for analysis.
  • FACS buffer PBS containing 1% BSA
  • Anti-His antibody (Qiagen) was coupled onto four different flow cells of a BIACORETM CM5 sensor chip (Biacore, Inc., Piscataway, NJ) at between 6000 and 8000 RU. Immobilization was achieved by random coupling through amino groups using a protocol provided by the manufacturer. 10X HBS-P (Biacore, Inc., Piscataway, NJ) was diluted in water and served as the dilution and running buffer. Purified human or cyno TfR was captured, followed by a 3-fold dilution series of IgG or Fab that was injected at a flow rate of 30 ml/min using the single cycle kinetics method.
  • Affinity constants were determined using a simple 1 : 1 Langmuir binding model or using a steady state model when kon or k 0 ff was beyond the detection limit.
  • the equilibrium dissociation constant (KD) was calculated as the ratio of association rate constant (kon) and dissociation rate constant (k 0 ff). The results are shown in Figure 2C.
  • Humanized 15G11 variant 15G1 l.v5 contains selected vernier positions in VL (positions 43 and 48) and VH (positions 48, 67, 69, 71 and 73) as outlined in Figure 4A.
  • the N-terminus of VH was changed from Q to E.
  • an HVR graft was made using the 7A4 heavy chain and 8A2 light chain HVRs (7A4 and 8A2 are related clones, Figure 3A). HVRs were grafted into the IGKV4-1*01 and IGHVl-2*02 human variable domains. Combinations of different mouse vernier positions were included in the humanized variants as outlined in Figure 4E.
  • Humanized 7A4 variant, 7A4.vl5 contains selected vernier positions in VL (position 68) and VH (positions 24 and 71) and the CDR- L3 change G94A, as outlined in Figure 4B.
  • 7G7 was humanized by grafting the HVRs into the kappa 4 and subgroup I human consensus variable domains along with selected vernier positions in VH (position 93) as outlined in Figure 4C.
  • This humanized variant is called 7G7.vl .
  • 16F6 was humanized by grafting the HVRs into the IGKV1-9*01 and IGHV4-59*01 human variable domains. Combinations of different mouse vernier positions were included in the humanized variants as outlined in Figure 4E.
  • Humanized 16F6 variant 16F6.v4 contains 2 changes in VL (I48L and F71 Y) as well as selected vernier positions in VL (positions 43 and 44) and VH (positions 71 and 78) as outlined in Figure 4D.
  • a titration of hu7A4.vl5, hul5Gl l .v5, Tf competiting antibody, human holo-Tf andcontrol IgG 400 ⁇ g for all antibody, 8000 ⁇ g/ml for holo transferrin, 1 :3 serial dilution
  • human holo-Tf andcontrol IgG 400 ⁇ g for all antibody, 8000 ⁇ g/ml for holo transferrin, 1 :3 serial dilution
  • the mixture was then added to the HFE coated plate for 1 h at room temperature.
  • Immobilized 15G1 lv.5 and anti-TfR C12 were evaluated for binding to biotinylated human TfR ECD or monovalent Ml 3 phage displaying the human TfR apical domain.
  • Anti-TfR C12 was derived from a synthetic antibody phage library that was panned against human TfR ECD and binds to a site on the human TfR which competes with transferrin binding.
  • Antibodies were coated at 1 ⁇ g/ml in PBS on Maxisorp plates.
  • Bound biotinylated human TfR ECD or TfR-apical domain phage were detected with HRP-streptavidin (GE health care, RPN 4401V) or HRP-anti-M13 (GE health care, 27-9421-01), respectively.
  • Figure 20 shows that 15G1 lv.5 binds to human TfR apical domain. The 15G1 lv.5 binding site was mapped to the apical domain, a site distant from the TfR ligand binding sites.
  • affinity engineered variants were made. Exemplified herein is affinity engineering of 15G1 l .v5 and 7A4.vl5.
  • Affinity variants were generated by making individual alanine substitutions in CDR-L3 or CDR- H3 using standard techniques. These variants were screened as IgG by ELISA and SPR to identify positions important for binding to human and cyno TfR; the monovalent affinity of selected variants as Fab was also determined. Ala scan variant IgGs or Fab were expressed in 293 cells and binding to human or cyno TfR quantified by ELISA in maxisorp plates coated with 1.8 ⁇ g/ml of goat anti-human Fey (Jackson ImmunoResearch) in PBS at 4°C overnight.
  • Cell culture supematants containing the expressed Ala scan variant IgGs were serially diluted 1 :5 and added to the wells for 1 h. Plates were washed with PBS/0.05% Tween 20 and 1 : 1000 diluted HRP-Goat-anti human Fey (Jackson ImmunoResearch) was added the plate and incubated for 1 hour at room temperature. Plates were washed with PBS/0.05% Tween 20 and detected using TMB substrate (BioFX Laboratories, Owings Mills).
  • the knob and hole half-antibodies were purified separately from E.coli and combined at a 1 : 1.1 ratio of anti-TfR to prevent formation of anti-TfR homodimers. Assembly of the bispecific antibody was completed by reductive annealing for at least three days at room temperature in a buffer containing reduced glutathione at a lOOx ratio to antibody and 200 niM arginine pH 8.0. Following assembly, bispecific antibodies were purified by hydrophobic interaction
  • the assembly was confirmed by liquid chromatography mass spectroscopy and SDS-PAGE.
  • the purified antibodies were confirmed to be homogeneous and monodisperse by size exclusion and multi angle laser light spectroscopy.
  • the resulting bispecific antibodies were called 15Gl l .v5 (anti-TfR 1 ), hul5Gl 1.W92A (hul5Gl l .LC92A or anti-TfR 2 ), hul5Gl l .N52A (anti-TfR 52A ) and hul5Gl l .T53A (anti-TfR 53A ).
  • the monovalent affinity and kinetics for human and cyno TfR was determined for 115G1 l.v5 and 115G11.W92A by SPR, as above (see Table 9).
  • Anti-TfR 1 and anti-TfR 2 possess similar monovalent binding affinities as anti-TfR A and anti-TfR D do for binding to mouse TfR (see Atwal et al., Sci. Transl. Med. 3, 84ra43 (2011); Yu et al., Sci. Transl. Med. 25 May 2011 : Vol. 3, Issue 84, p. 84ra44).
  • the binding affinity of the anti-TfR 1 , anti-TfR 2 , Hul5Gl 1.N52A and Hul 5G11.T53A bispecific antibodies were measured against human and cyno TfR by SPR as previously described. As shown in Table 9 below, Anti-TfR 52A and anti-TfR 53A have binding affinities to human and cyno TfR between TfRl hl5Gl l v5 and TfR2 LC92A .
  • PBMCs peripheral blood mononuclear cells
  • HEL human erythroleukemia cell line
  • AllCells, Inc. primary human bone marrow mononuclear cells
  • PBMCs were isolated by density gradient centrifugation using Uni-SepTM blood separation tubes (Accurate Chemical & Scientific Corp.; Westbury, NY).
  • Target cells in 50 of assay medium RPMI-1640 with 1% BSA and 100 units/mL penicillin and streptomycin
  • assay medium RPMI-1640 with 1% BSA and 100 units/mL penicillin and streptomycin
  • Serial dilutions of test and control antibodies 50 ⁇ were added to the plates containing the target cells, followed by incubation at 37 ° C with 5% CO2 for 30 minutes to allow opsonization.
  • the final concentrations of antibodies ranged from 0.0051 to 10,000 ng/mL following 5-fold serial dilutions for a total of 10 data points.
  • the reaction was terminated with 1 M H3PO4, and absorbance was measured at 490 nm (the background, measured at 650 nm was subtracted for each well) using a SpectraMax Plus microplate reader. Absorbance of wells containing only the target cells served as the control for the background (low control), whereas wells containing target cells lysed with Triton-X100 provided the maximum signal available (high control). Antibody-independent cellular cytotoxicity (AICC) was measured in wells containing target and effector cells without the addition of antibody. The extent of specific ADCC was calculated as follows:
  • A490 (High Control) - A490 (Low Control) ADCC values of sample dilutions were plotted against the antibody concentration, and the dose- response curves were fitted to a four-parameter model using SoftMax Pro.
  • the ADCC activity of various anti-human Tf constructs were assessed using either a human erythroleukemia cell line (HEL cells) or primary human bone marrow mononuclear cells as the target cells.
  • HEL cells human erythroleukemia cell line
  • Bivalent IgGl effector function-competent anti- human Tf l antibody 15G11, and a bispecific form of this antibody with an anti-BACEl arm in a human IgGl format containing D265A and N297G mutations to abrogate effector function (see Example 3) were tested at various concentrations in the ADCC assay, using anti-gD WT IgGl as a negative control and murine anti-human HLA (class I) as a positive control.
  • the somewhat lower level observed in the bone marrow mononuclear cells experiment is likely due to the fact that only a portion of the heterogeneous mixture of myeloid and erythroid lineage PBMC cells used in the experiment express high levels of Tf , whereas the HEL cells have consistently high Tf expression throughout the clonal cell population.
  • the bispecific effectorless anti- humanTfR/BACEl antibody did not display any ADCC activity in either HEL or bone marrow mononuclear cells, similar to the negative control.
  • Anti-TfR/gD with the wild-type IgGl induced robust ADCC in HEL cells, while the anti-TfR/gD with the effectorless IgGl did not show any ADCC activity in HEL cells, replicating the results from the first set of experiments.
  • anti-TfR/gD of the IgG4 isotype showed a mild ADCC activity. This activity was not observed in the anti-Abeta IgG4 results, indicating that TfR binding was required for the ADCC activity.
  • This finding correlates with previous reports that IgG4 has minimal, but measurable, effector function (Adolffson et al., J. Neurosci. 32(28):9677-9689 (2012); van der Zee et al. Clin Exp. Immunol. 64: 415-422 (1986)); Tao et al., J. Exp. Med.
  • EXAMPLE 5 ASSESSMENT OF BISPECIFIC ANTI-HUMAN TfR/BACEl BISPECIFIC ANTIBODIES IN VIVO
  • an anti-gD molecule on human IgGl was used as a control. This study was performed in non-human primates because crossreactivity of these anti-TfR antibodies is limited to non-human primates and humans. In addition, studies have shown that the mechanisms of drug transport between the cerebrospinal fluid (CSF) and plasma compartments may be similar between humans and primates (Pop lack et al, 1977).
  • the antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cisterna magna catheters. At various timepoints up to 60 days post-dose, plasma, serum, and (CSF) were sampled. Sample analysis included hematology (whole blood), clinical chemistry (serum), antibody concentrations (serum and CSF), and pharmacodynamic response to the antibody (plasma and CSF). See Figure 10 for a detailed sampling scheme.
  • the concentrations of the dosed antibodies in cynomolgus monkey serum and CSF were measured with an ELISA using a sheep anti-human IgG monkey absorbed antibody coat, followed by adding serum samples starting at a dilution of 1 : 100, and finished by adding a goat anti-human IgG antibody conjugated to horseradish peroxidase monkey adsorbed for detection.
  • the assay had a standard curve range of 0.78-50 ng/mL and a limit of detection of 0.08 ⁇ g/mL. Results below this limit of detection were reported as less than reportable (LTR).
  • Figures 11A-B shows the results of the pharmacokinetic analysis for anti-TfRl/BACEl and anti-TfR2/BACEl.
  • the pharmacokinetic profile for anti-gD was as expected for a typical human IgGl antibody in cynomolgus monkey with a mean clearance of 3.98 mL/day/kg. Both anti-TfR/BACEl antibodies cleared faster than anti-gD, likely due to peripheral target-mediated clearance.
  • Anti-Tf l/BACEl had the fastest clearance, consistent with it having the highest binding affinity to Tf , whereas anti-Tf 2/BACEl showed an improved pharmacokinetic profile (ie, prolonged exposure in serum) as compared to anti-Tf l/BACEl, likely due to its reduced affinity for TfR.
  • the clearance for anti-TfRl/BACEl and anti-TfR2/BACEl were 18.9 mL/day/kg and 8.14 mL/day/kg, respectively. All antibodies were detected in the CSF at approximately one one-thousandth of the serum concentration. However, there was high variability, and overall no detectable difference in the CSF antibody concentrations across the molecules.
  • Antibody (day* ⁇ g/mL) (day* ⁇ g/mL) fog/mL) (mL/day/kg) (mL/kg) anti-gD 7640 ⁇ 3.98 ⁇ 51.3 ⁇
  • SD standard deviation
  • IV intravenous
  • AUCaii area under the concentration-time curve from time 0 to the time of last measurable concentration
  • AUCmf area under the
  • CSF concentrations of sAPPa and sAPPp were determined using the sAPPa/sAPPp Multi-spot assay (Mesoscale Discovery (Gaithersburg, MD)). CSF was thawed on ice, then diluted 1 :10 into 1% BSA in TBS-T (10 mM Tris buffer, pH 8.0, 150 mM NaCl, 0.1% Tween-20). The assay was performed as per the manufacturer's protocol. The assay had lower limit of quantification values of 0.05 ng/ml for sAPPa and 0.03 ng/mL for sAPPp.
  • Figures 12A-E summarize the pharmacodynamics behavior of the antibodies.
  • plasma levels remained unchanged following anti-gD adiminstration, but transiently decreased following anti-TfR/BACEl administration.
  • Both variants reduced plasma Abetai-40 levels, with a maximal inhibition of 50% achieved 1 day post-dosing.
  • Plasma Abetai-40 levels gradually recovered, with animals given anti-TfRVBACEl returning to baseline Abetai-40 levels around 14 days post-dose.
  • Abetai-40 levels returned to baseline levels between 21 and 30 days post-dose in animals treated with anti-Tf 2 /BACEl .
  • SAPPa and sAPPp are the primary processing products of amyloid precursor protein (APP), and their levels are highly correlated.
  • the ratio of sAPPp/sAPPa normalizes the results to potential changes in basal APP expression or potential preanalytical differences in CSF collection and handling over the course of the study.
  • the ratio of CSF sAPPp/sAPPa with anti-TfRVBACEl demonstrated a more robust PD effect than anti-TfR 2 /BACEl.
  • BACE1 target engagement by the anti-TfR/BACEl antibodies.
  • EXAMPLE 6 ASSESSMENT OF BISPECIFIC ANTI-HUMAN TfR BACEl BISPECIFIC ANTIBODIES IN VIVO
  • the antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cistema magna catheters.
  • Baseline CSF samples were collected 24 and 48 hours prior to dosing, and another CSF sample was collected 24 hours post-dose (as shown schematically in Figure 14).
  • animals were perfused with saline and brains were harvested for analysis of antibody concentrations. Different brain regions were homogenized in 1% NP-40 (Cal-Biochem) in PBS containing Complete Mini EDTA-free protease inhibitor cocktail tablets (Roche Diagnostics).
  • Anti-TfR 2 /BACEl had ⁇ 3-fold improved brain uptake over control IgG (average ⁇ 2 nM), and anti-TfRVBACEl had the best brain uptake, ⁇ 15 -fold greater than control IgG (average -10 nM).
  • the brain antibody concentrations for the different antibodies correlated with the pharmacodynamics response seen in CSF in our studies, with anti- TfRVBACEl having the best brain uptake and most robust pharmacodynamics effect, and anti- TfRVBACEl having less brain uptake and a more modest effect.
  • TfR 2 /BACEl has improved clearance properties, but appears to have such low binding for TfR as to not be able to be efficiently transported by TfR (much in the same way that the lowest-affinity anti-TfR antibody TfR E in US2012/0171120 passes some affinity threshold beyond which the affinity is too low to permit sufficient interaction between the antibody and TfR such that the antibody would remain associated with TfR as TfR begins the translocation process). From the results of this experiment, an anti- human/cyno TfR/BACEl bispecific antibody having affinity for TfR between that of TfR 1 and TfR 2 would be predicted to have improved uptake and clearance properties over either anti- TfRVBACEl or anti-Tf 2 /BACEl in this system.
  • EXAMPLE 7 CREATION OF ADDITIONAL EFFECTORLESS MUTATIONS IN THE CONTEXT OF A BISPECIFIC TRANSFERRIN RECEPTOR ANTIBODY
  • N297G and D265A were tested for their ability to reduce or prevent depletion of Tf -expressing reticulocytes.
  • the Fc mutations L234A, L235A and P329G which are described in US Application Publication No 2012/0251531, which is incorporated herein by reference, were incorporated into the anti-Tf D /BACEl antibody (which is described in
  • mice Pharmacokinetic analysis and reticulocyte count following a single antibody administration in mice were performed as follows. Wild type female C57B/6 mice ages 6-8 weeks were used for all studies. The animals' care was in accordance with institutional guidelines. Mice were dosed intravenously with a single 50mg/kg dose of either an anti-gD antibody (murine IgG2a) with the LALAPG mutations, an anti-Tf D /BACEl antibody (rat/murine chimera) with the LALAPG mutations. Total injection volume did not exceed 250 ⁇ and antibodies were diluted in D-PBS when necessary (Invitrogen). After 24 hours, whole blood was collected prior to perfusion in EDTA microtainer tubes (BD Diagnostics), allowed to sit for 30 minutes at room temperature, and spun down at 5000x g for 10 minutes. The top layer of plasma was transferred to new tubes for antibody measurements.
  • EDTA microtainer tubes BD Diagnostics
  • Bound biotin- conjugated antibody was detected with horseradish peroxidase-conjugated streptavidin (GE Helathcare Life Sciences, Pittsburgh, PA). Samples were developed using 3,3',5,5'- tetramethyl benzidine (TMB) (KPL, Inc., Gaithersburg, MD) and absorbance measured at 450 nm on a Multiskan Ascent reader (Thermo Scientific, Hudson, NH). Concentrations were determined from the standard curve using a four-parameter non-linear regression program. The assay had lower limit of quantification (LLOQ) values of 78.13 ng/ml in plasma. Statistical analysis of differences between experimental groups was performed using a two-tailed unpaired t-test.
  • mice Upon administration of the anti-Tf D /BACEl antibodies containing the Fc LALAPG mutations, the mice displayed no clinical symptoms as had been previously observed using antibodies with full effector function. See Couch et al., Sci. Trans. Med. 5:183ra57 (2013). Figure 17 shows the results of the pharmacokinetic analysis.
  • EXAMPLE 8 GENERATION OF ANTI-BACE1 ANTIBODIES
  • Fully -human antibodies specifically binding to BACE1 were generated using a yeast- based human antibody display library, selected against human BACE1 extracellular domain (BACE1-ECD), amino acids 1-457 of SEQ ID NO: 179.
  • WO2009036379; WO2010105256; WO2012009568 For the first two rounds of selection, a magnetic bead sorting technique utilizing the Miltenyi MACs system was performed, as described (see, e.g., Siegel et al., 2004, J. Immunol. Methods, 286: 141-53). Briefly, yeast cells ( ⁇ 10 10 cells/library) were incubated with 200 nM biotinylated BACE1-ECD for 15 min at room temperature in FACS wash buffer (phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)).
  • PBS phosphate-buffered saline
  • BSA bovine serum albumin
  • the cell pellet was resuspended in 40 mL wash buffer, and Streptavidin MicroBeads (500 ⁇ ) were added to the yeast and incubated for 15 min at 4°C.
  • Streptavidin MicroBeads 500 ⁇
  • the yeast were pelleted, resuspended in 5 mL wash buffer, and loaded onto a Miltenyi LS column. After the 5 mL was loaded, the column was washed 3 times with 3 ml FACS wash buffer. The column was then removed from the magnetic field, and the yeast were eluted with 5 mL of growth media and then grown overnight. The following rounds of sorting were performed using flow cytometry.
  • yeast Approximately 1 x 10 s yeast were pelleted, washed three times with wash buffer, and incubated with decreasing concentrations of biotinylated BACEl-ECD (100 to 1 nM) under equilibrium conditions at room temperature. Yeast were then washed twice and stained with LC-FITC (diluted 1 : 100) and either SA-633 (diluted 1 :500) or EA-PE (diluted 1 :50) secondary reagents for 15 min at 4°C. After washing twice with ice-cold wash buffer, the cell pellets were resuspended in 0.4 mL wash buffer and transferred to strainer-capped sort tubes. Sorting was performed using a FACS ARIA sorter (BD Biosciences) and sort gates were determined to select for binders. After the final round of sorting, yeast were plated and individual colonies were picked for characterization.
  • LC-FITC diluted 1 : 100
  • SA-633 diluted 1 :500
  • EA-PE diluted 1 :50
  • Light chain diversification Heavy chain plasmids were extracted and transformed into a light chain library with a diversity of approximately 1 x 10 6 . Selections were performed as described above with one round of MACS sorting and two rounds of FACS sorting using biotinylated BACEl-ECD titrations so select for higher affinity.
  • Heavy chain diversification The CDRH3 of was recombined into a premade library with CDRH1 and CDRH2 variants of a diversity of 1 x 10 s and selections were performed as described above. Affinity pressures were applied by incubating the antigen antibody yeast complex with parental Fab or unbiotinylated antigen for different amounts of time to select for the highest affinity antibodies. Additional cycles of diversification utilized error prone PCR-based mutagenesis of the heavy chain and the light chain. Selections were performed similar to previous cycles using FACS sorting for all three rounds and with increased times for Fab pressure.
  • Seventy-eight antibodies were chosen from the selection process for sequencing and further characterization.
  • the heavy chain and light chain HVRs for the seventy-eight antibodies are shown in Figures 21 and 22, respectively.
  • the heavy chain and light chain variable region sequences are shown in Figures 23 and 24, respectively.
  • the antibodies were determined to be in two separate epitope bins.
  • the epitope bin for each antibody (either bin "2" or bin "3") is shown in Figures 21 to 24.
  • Example 8 The anti-BACEl antibodies selected in Example 8 were further characterized using the assays described below.
  • the binding affinities for the 78 anti-BACEl antibodies selected in Example 1 for human and murine BACE1 ECD were determined using an Octet® System (ForteBio) as follows. Anti-BACEl antibodies were loaded onto anti -human capture (AHC) sensors (tips) followed by 60 seconds baseline in assay buffer. Tips were then exposed to 200 nM of human BACE1 ECD (produced in CHO cells or purchased from R&D Systems) or murine BACE1 ECD (produced in CHO cells; SEQ ID NO: 389). Tips were transferred to assay buffer for 5 minutes, 30 minutes, or 120 minutes depending on the off-rate, for off-rate measurement. Assay buffer was either PBS + 0.1% BSA, pH 7.5; or PBS + 0.1% BSA, pH 5.0. Kinetics were analyzed using a 1 : 1 binding model.
  • Binding affinities of certain anti-BACEl IgGs were measured by surface plasmon resonance (SRP) using a BIAcoreTM-T100 instrument.
  • Anti-BACEl human IgGs were captured by mouse anti-human Fc antibody (GE Healthcare, cat# BR-1008-39) coated on CM5 biosensor chips to achieve approximately 150 response units (RU).
  • RU response units
  • two-fold serial dilutions (125nM to OnM) of human BACE1 (R&D Systems) were injected in HBS-P buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 0.05% v/v Surfactant P20, GE Healthcare) at 25°C with a flow rate of 30 ⁇ /min.
  • Association rates (km) and dissociation rates (kos) were calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2).
  • the equilibrium dissociation constant (KD) was calculated as the ratio ka/kn.
  • Epitope binning of the 78 antibodies was performed using the Octet® System. Briefly, a first antibody is loaded onto multiple AHC tips followed by 60 seconds baseline in assay buffer, pH 7.5. Tips are then exposed to 200 nM human BACE1 for 180 seconds to allow for antigen binding. Tips are transferred to wells containing 50 ⁇ g/ml second antibody in assay buffer for 90 seconds. If the second antibody shows clear binding, it is considered to be a non-competitor (i.e., in a different epitope bin from the first antibody). If the second antibody does not show clear binding, it is considered to be a competitor (i.e., in the same epitope bin as the first antibody). The binding determination is made by comparing the second antibody binding to BACE1 in the presence of the first antibody to the first antibody blocking itself. To choose the first antibodies, an assay similar to the assay described above is carried out, and antibodies showing mutually exclusive binding are selected.
  • the proteolytic reaction mixture was incubated at ambient temperature for 75 minutes and was quenched by the addition of 5 HTRF detection mixture containing 2 nM Streptavidin-D2 and 150 nM of 6E10 anti-amyloid beta antibody (Covance, Emoryville, CA) labeled with Europium cryptate in detection buffer (200 mM Tris pH 8.0, 20 mM EDTA, 0.1% BSA, and 0.8M KF).
  • detection buffer 200 mM Tris pH 8.0, 20 mM EDTA, 0.1% BSA, and 0.8M KF.
  • the final reaction mixture was incubated at ambient temperature for 60 minutes and the TR-FRET signal was measured using an EnVision Multilabel Plate ReaderTM (Perkin-Elmer) at an excitation wavelength of 320 nm and emission wavelengths of 615 and 665 nm.
  • a synthetic peptide inhibitor of BACEl, OM99-2 (CalBiochem®, Catalog # 496000) was used as a control.
  • the resulting fluorogenic products from the control reactions were measured as above, but at an excitation wavelength of 545 nm and an emission wavelength of 585 nm. Obtained data were analyzed using GraphPad Prism 5TM (LaJolla, CA).
  • modulation of enzyme activity by allosteric inhibitors may, in some instances, result in either activation or inhibition of activity depending on the substrate.
  • a change in conformation caused by an allosteric inhibitor may cause better binding of one substrate and may interfere with binding of another substrate, resulting in differing, or even opposite, activity modulation.
  • half-antibodies contained mutations in the Fc region that abrogated effector function, including (N297G) or L234A/L235A/P329G.
  • Fc Receptor-neonate (FcRn) binding domain mutations including M252Y, S254T and T256E (YTE) have been described to increase FcRn binding and thus increase the half-life of antibodies. See U.S.
  • bispecific antibody was completed by reductive annealing for at least three days at room temperature in a buffer containing reduced glutathione at a lOOx ratio to antibody and 200 niM arginine pH 8.0. Following assembly, bispecific antibodies were purified by hydrophobic interaction
  • the assembly was confirmed by liquid chromatography mass spectroscopy and SDS-PAGE.
  • the purified antibodies were confirmed to be homogeneous and monodisperse by size exclusion and multi angle laser light spectroscopy.
  • Affinity of the bispecific antibodies for human and cynomolgus monkey TfR was determined using surface plasmon resonance (SPR) (BiacoreTM, GE Healthcare). Streptavidin (Sigma) was coupled onto four different flow cells of a variety S BIACORETM CM5 sensor chip (Biacore, Inc., Piscataway, NJ) at between 2000 and 3000 RU. Immobilization was achieved by random coupling through amino groups using a protocol provided by the manufacturer. 10X HBS- P (Biacore, Inc., Piscataway, NJ) was diluted in water and served as the dilution and running buffer.
  • SPR surface plasmon resonance
  • Antibody 6266 had an ICso of 1.7 nM and a maximum inhibition of 74%, compared to an ICso of 2.9 nM and a maximum inhibition of 62% exhibited by antibody YW412.8.31.
  • Bispecific antibody Tf 2 /6266 had an ICso of 1.7 nM and a maximum inhibition of 79%, compared to an ICso of 11 nM and a maximum inhibition of 54% for bispecific antibody TfR 2 /YW412.8.31.
  • EXAMPLE 12 PHARMACOKINETICS AND PHARMACODYNAMICS OF BISPECIFIC ANTIBODIES IN MICE
  • mice Pharmacokinetic and pharmacodynamic analyses following a single antibody administration in mice were performed as follows. Wild type female C57B/6 mice ages 6-8 weeks were used for all studies. The animals' care was in accordance with institutional guidelines. Mice were dosed intravenously with a single 25 mg/kg dose of an anti-gD antibody (human IgGl), an anti-TfR D /YW412.8.31 antibody (rat/human chimera), or an anti-Tf D /6266 antibody (rat/human chimera), each formatted as a hulgGI N297G isotype. Total injection volume did not exceed 250 ⁇ ⁇ and antibodies were diluted in D-PBS when necessary (Invitrogen). After 24 hours, whole blood was collected prior to perfusion in EDTA microtainer tubes (BD Diagnostics), allowed to sit for 30 minutes at room temperature, and spun down at 5000x g for 10 minutes. The top layer of plasma was transferred to new tubes for antibody measurements.
  • an anti-gD antibody human IgGl
  • mice Upon administration of the anti-TfR D /BACEl antibodies containing the Fc N297G mutations, the mice displayed no clinical symptoms as had been previously observed using antibodies with full effector function. See Couch et al., Sci. Trans. Med. 5:183ra57 (2013).
  • Figure 30 shows the results of the pharmacokinetic analysis.
  • the anti- TfR D /YW412.8.31 bispecific antibody and the anti-TfR D /6266 bispecific antibody showed similar pharmacokinetics.
  • Figure 31 shows the results of the pharmacokinetic (A) and pharmacodynamics (B) analysis in mouse brain following the single injection of bispecific antibody.
  • the anti-TfR D /YW412.8.31 bispecific antibody showed slightly higher brain antibody concentrations than and the anti-TfR D /6266 bispecific antibody.
  • Figure 3 IB brain ⁇ 40 was significantly lower in mice administered the anti-TfR D /6266 bispecific antibody (55% reduction from control IgG) as compared to the anti-TfR D /YW412.8.31 bispecific antibody (41% reduction from control IgG) at day 2 (p ⁇ 0.05).
  • EXAMPLE 13 PHARMACOKINETICS AND PHARMACODYNAMICS OF BISPECIFIC ANTIBODIES IN CYNOMOLGUS MONKEYS
  • the antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cisterna magna catheters.
  • IV intravenous
  • CSF plasma, serum, and
  • Figures 32A shows the results of the pharmacokinetic analysis for anti- TfRVYW412.8.31 and anti-TfRV6266. Both anti-TfR/BACEl antibodies cleared at a similar rate, and both cleared faster than anti-gD, likely due to peripheral target-mediated clearance. Table 13 shows the PK parameters for each of the antibodies in this experiment.
  • SD standard deviation
  • IV intravenous
  • AUCaii area under the concentration -time curve from time 0 to the time of last measurable concentration
  • AUCinf area under the concentration -time curve extrapolated to infinity
  • Cmax observed maximum serum concentration
  • CL clearance
  • V ss volume of distribution at steady state
  • Min minimum
  • Max maximum.
  • FIG 32B shows the pharmacodynamics behavior of the bispecific antibodies in CSF.
  • CSF ⁇ 40 was significantly lower in animals administered anti-TfRV6266 bispecific antibody (67% reduction from baseline) than in animals administered anti-Tf 1 /YW412.8.31 bispecific antibody (56% reduction from baseline). The duration of the effect was similar for both antibodies.
  • EXAMPLE 14 PHARMACOKINETICS AND PHARMACODYNAMICS OF FCRN HIGH BISPECIFIC ANTIBODIES IN CYNOMOLGUS MONKEYS
  • the antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cisterna magna catheters.
  • IV intravenous
  • CSF plasma, serum, and
  • Sample analysis included hematology (whole blood), clinical chemistry (serum), antibody concentrations (serum and CSF), and pharmacodynamic response to the antibody (plasma and CSF). See Figure 33 for a detailed sampling scheme.
  • the concentrations of the dosed antibodies in cynomolgus monkey serum and CSF were measured with an ELISA using a sheep anti-human IgG monkey absorbed antibody coat, followed by adding serum samples starting at a dilution of 1 : 100, and finished by adding a goat anti-human IgG antibody conjugated to horseradish peroxidase monkey adsorbed for detection.
  • the assay had a standard curve range of 0.78-50 ng/mL and a limit of detection of 0.08 ⁇ g/mL. Results below this limit of detection were reported as less than reportable (LTR). Additionally, immature and total reticulocyte counts were determined using the AD VIA 120 Hematology System (Siemans Healthcare, Siemans AG, Er Weg, Germany) according to manufacturer's instructions.
  • Figures 34A-B shows the results of the pharmacokinetic analysis for the bispecific antibodies in serum.
  • the peripheral exposure with the FcRn HIGH bispecific antibodies was improved for both the anti-TfR 2 /6266 and anti-TfR 52A /6266 antibodies.
  • Table 14 shows the PK parameters for each of the antibodies in this experiment.
  • SD standard deviation
  • IV intravenous
  • AUCaii area under the concentration-time curve from time 0 to the time of last measurable concentration
  • AUCinf area under the concentration-time curve extrapolated to infinity
  • Cmax observed maximum serum concentration
  • CL clearance
  • Vss volume of distribution at steady state
  • Min minimum
  • Max maximum.
  • Figures 36A-B show reticulocyte levels in in cynomolgus monkeys administered bispecific antibodies, as described above.
  • Antibody 6266 was affinity matured as follows.
  • N any of the four natural nucleotides
  • K 50% T (thymine) and 50% G (guanine).
  • the NNK codon can encode any of the 20 natural amino acids.
  • Binding clones were selected by incubating the phage display libraries with 5, 0.5, and 0.1 nM biotinylated BACE1 in successive rounds of selection, and then competed with 100 nM non-biotinylated BACE1 at room temperature or 37°C to reduce binding of the lower affinity clones to BACE1. Bound clones were captured on ELISA plates coated with neutravidin, washed and eluted in 1 OOmM HC1 for 20 minutes at room temperature. The eluted phage was neutralized with 1/10 volume of 1 M Tris pH 8.0 and used to infect E. coli for amplification for the next round of selection.
  • phagemid DNA was isolated from selected rounds.
  • the VH and the VL segment from each sample were amplified by an 18 cycle PCR amplification using Phusion DNA polymerase (New England Biolabs).
  • the amplicon was purified on a 2% agarose gel.
  • Amplicons were prepared with standard lllumina library prep methods, using TruSeq DNA Sample Prep (lllumina). Adapter-ligated libraries were subjected to a single cycle of PCR and sequenced on the lllumina MiSeq, paired-end 200bp or 300bp as appropriate to cover the entire length of the amplicon. Sequencing data where analyzed using the statistical programming language and the ShortRead package. Quality control was performed on identified CDR sequences, were each CDR sequence was checked for the correct length and was allowed to carry only up to one N K mutation and no non-NNK mutations. Calculating the frequency of all mutations of every randomized position generated position weight matrices.
  • Enrichment ratios for all single mutations were calculated by dividing the frequency of a given mutation at a given position in the sorted sample by the frequency of the very same mutation in the unsorted sample, as described previously by Fowler and colleagues.
  • the enrichment ratios of double mutations were obtained by calculating the enrichment ratio of all clones that carry NNK mutations at two given positions, ignoring the third NNK mutation. In order to filter out sampling effects, mutation pairs that had less than 10 sequence counts either in the sorted or unsorted sample, were removed from the analysis.
  • Figures 37 and 38 show the heavy chain and light chain variable region sequences of affinity matured antibody 6266 variants 1 to 15.
  • binding affinity of anti-BACEl Fab antibodies by single-cycle kinetics was determined using surface plasmon resonance (SRP) measurement with a BIAcoreTM T200 instrument. Briefly, series S sensor chip CM5 was activated with EDC and NHS reagents according to the supplier's instructions, and anti-His antibody was coupled to achieve approximately 1000 response units (RU), then following by blocking un-reacted groups with 1M ethanolamine.
  • SRP surface plasmon resonance
  • His-tagged BACE1 protein was first injected at ⁇ /min flow rate to capture approximately 100 RU at 3 different flow cells (FC), except for FC1 (reference), and then 5-fold serial dilutions of Fab in HBS-P buffer (0.01M HEPES pH 7.4, 0.15M NaCl, 0.005% surfactant P20) from low (0.08nM) to high (50nM) were injected (flow rate:
  • Tm Thermal melt temperature
  • DSF monitors thermal unfolding of proteins in the presence of a fluorescent dye and is typically performed by using a real-time PCR instrument (e.g., Bio-Rad CFX).
  • SYPRO orange dye (Invitrogen, cat. no. S6650) is diluted 1 :20 in PBS.
  • One ⁇ of diluted dye is added to 24 ⁇ 1 Fab protein ( ⁇ 100ug/ml) in a well.
  • the fluorescence intensity is plotted and the inflection point of the transition curve (Tm) is calculated using, for example, the Boltzmann equation. See Nature Protocols, 2007, 2:2212-2221.
  • Figure 39 shows the association rate, dissociation rate, dissociation constant, and melting temperature for the affinity matured antibody 6266 variants 1 to 15. All of the variants showed improved affinity (KD) compared to antibody 6266.
  • a mutation in heavy chain variable region FR4, methionine at position 108 changed to leucine (M108L), may be incorporated to promote stability of an anti-TfR/BACEl bispecific antibody. Binding affinity of an anti-TfR Fab comprising the M108L mutation was similar to the unmodified Fab, as shown in Table 15.
  • a bispecific antibody comprising an anti-TfR arm comprising an anti- TfR 2 .hIgGl .LALAPG.YTE heavy chain having an M108L mutation (SEQ ID NO: 394) will be more stable than the bispecific antibody comprising the same anti-TfR arm without the M108L heavy chain mutation, while also retaining binding affinity for TfR.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Biomedical Technology (AREA)
  • Neurology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Neurosurgery (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Urology & Nephrology (AREA)
  • Diabetes (AREA)
  • Psychology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Physical Education & Sports Medicine (AREA)
  • General Engineering & Computer Science (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Physics & Mathematics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)

Abstract

The present invention relates to bispecific antibodies that bind to transferrin receptor and BACE1 and methods of using the same.

Description

ANTI-TRANSFERRIN RECEPTOR / ANTI-BACE1 MULTISPECIFIC
ANTIBODIES AND METHODS OF USE
CROSS-REFERENCE TO RELATED APPLICATIONS
[001] The present application claims the benefit of priority of US Provisional Application No. 62/081,965, filed November 19, 2014, which is incorporated by reference herein in its entirety for any purpose.
SEQUENCE LISTING
[002] The present application is filed with a Sequence Listing in electronic format. The
Sequence Listing is provided as a file entitled "2015-l l-18_01146-0041-00PCT_ST25.txt" created on November 18, 2015, which is 352,040 bytes in size. The information in the electronic format of the sequence listing is incorporated herein by reference in its entirety.
FIELD OF THE INVENTION
[003] The present invention relates to multispecific antibodies that bind to transferrin receptor and BACE1 and methods of using the same.
BACKGROUND
[004] Brain penetration of large molecule drugs is severely limited by the largely impermeable blood-brain barrier (BBB). Among the many strategies to overcome this obstacle is to utilize transcytosis trafficking pathways of endogenous receptors expressed at the brain capillary endothelium. Recombinant proteins such as monoclonal antibodies have been designed against these receptors to enable receptor-mediated delivery of large molecules to the brain. Strategies to maximize brain uptake while minimizing reverse transcytosis back to the blood, and to also maximize the extent of accumulation after therapeutic dosing have been addressed with the finding that antibodies with low affinity to BBB receptors offer the potential to substantially increase BBB transport and CNS retention of associated therapeutic moieties/molecules relative to typical high- affinity antibodies to such receptors (Atwal et al., Sci. Transl. Med. 3, 84ra43 (2011); Yu et al., Sci. Transl. Med. 25 May 2011 : Vol. 3, Issue 84, p. 84ra44). However, those antibodies did not specifically bind to human and primate TfR.
SUMMARY
[005] Monoclonal antibodies have vast therapeutic potential for treatment of neurological or central nervous system (CNS) diseases, but their passage into the brain is restricted by the blood- brain barrier (BBB). Past studies have shown that a very small percentage (approximately 0.1%) of an IgG circulating in the bloodstream crosses through the BBB into the CNS (Felgenhauer, Klin. Wschr. 52: 1158-1164 (1974)), where the CNS concentration of the antibody may be insufficient to permit a robust effect. It was previously found that the percentage of the antibody that distributes into the CNS could be improved by exploiting BBB receptors (ie, transferrin receptor, insulin receptorand the like) (see, e.g., WO9502421). For example, the anti-BBB receptor antibody can be made multispecific to target one or more desired antigens in the CNS, or one or more heterologous molecules can be coupled to the anti-BBB receptor antibody; in either case, the anti-BBB receptor antibody can assist in delivering a therapeutic molecule into the CNS across the BBB.
[006] However, targeting a BBB receptor with a traditional specific high-affinity antibody generally resulted in limited increase in BBB transport. It was later found by Applicants that the magnitude of antibody uptake into and distribution in the CNS is inversely related to its binding affinity for the BBB receptor amongst the anti-BBB antibodies studied. For example, a low- affinity antibody to transferrin receptor (Tf ) dosed at therapeutic dose levels greatly improves BBB transport and CNS retention of the anti-Tf antibody relative to a higher-affinity anti-Tf antibody, and makes it possible to more readily attain therapeutic concentrations in the CNS (Yu et al., Sci. Transl. Med. 3, 84ra44 (2011)). Proof of such BBB transport was achieved using a bispecific antibody that binds both Tf and the amyloid precursor protein (APP) cleavage enzyme, β-secretase (BACE1). A single systemic dose of the bispecific anti-TfR/BACEl antibody engineered using the methodology of the invention not only resulted in significant antibody uptake in brain, but also dramatically reduced levels of brain Αβι-40 compared to monospecific anti- BACE1 alone, suggesting that BBB penetrance affects the potency of anti-BACEl . (Atwal et al., Sci. Transl. Med. 3, 84ra43 (2011); Yu et al., Sci. Transl. Med. 3, 84ra44 (2011)).
[007] Those data and experiments highlighted several causative mechanisms behind increasing uptake of an antibody into the CNS using a lower-affinity antibody approach. First, high affinity anti-BBB receptor (BBB- ) antibodies (e.g., anti-TfRA from Yu et al., supra) limit brain uptake by quickly saturating the BBB-R in the brain vasculature, thus reducing the total amount of antibody taken up into the brain and also restricting its distribution to the vasculature. Strikingly, lowering affinity for the BBB-R improves brain uptake and distribution, with a robust shift observed in localization from the vasculature to neurons and associated neuropil distributed within the CNS. Second, the lower affinity of the antibody for the BBB-R is proposed to impair the ability of the antibody to return to the vascular side of the BBB via the BBB-R from the CNS side of the membrane because the overall affinity of the antibody for the BBB-R is low and the local concentration of the antibody on the CNS side of the BBB is non-saturating due to the rapid dispersal of the antibody into the CNS compartment. Third, in vivo, and as observed for the TfR system, antibodies with less affinity for the BBB-R are not cleared from the system as efficiently as those with greater affinity for the BBB-R, and thus remain at higher circulating concentrations than their higher-affinity counterparts. This is advantageous because the circulating antibody levels of the lower-affinity antibody are sustained at therapeutic levels for a longer period of time than the higher-affinity antibody, which consequently improves uptake of antibody in brain for a longer period of time. Furthermore, this improvement in both plasma and brain exposure may reduce the frequency of dosing in the clinic, which would have potential benefit not only for patient compliance and convenience but also in lessening any potential side effects or off-target effects of the antibody and/or of a therapeutic compound coupled thereto.
[008] The low-affinity BBB- antibodies described in the above-referenced work were selected /engineered to avoid interference with the natural binding between transferrin and the TfR, and thus to avoid potential iron transport-related side effects. Nonetheless, upon administration of certain of these antibodies in mice, some marked side effects were observed. The mice displayed a primary response of robust depletion of reticulocyte populations accompanied by rapid onset acute clinical symptoms. Though the mice recovered from both the acute clinical symptoms and the decreased reticulocyte levels in due course, avoiding or otherwise mitigating this impact on reticulocytes is clearly desirable for an anti-TfR antibody to be able to be used safely as a therapeutic molecule. It was found that the primary response to anti-TfR administration (robust reticulocyte depletion and acute clinical signs) is driven in large part by the antibody-dependent cell-mediated cytotoxicity (ADCC) activity of the antibody, while the residual reticulocyte depletion effect is mediated by the complement pathway. See, e.g., Couch et al., 2013, Sci. Transl. Med., 5: 183ra57.
[009] These prior studies utilized mouse antibodies which bound specifically to mouse TfR, but which did not specifically recognize primate or human TfR. Accordingly, antibodies and functional parts thereof are provided which do specifically recognize both primate and human TfR, in order to facilitate safety and efficacy studies in primates with the antibodies prior to therapeutic or diagnostic use in humans. In vitro studies using a human erythroblast cell line and primary bone marrow cells treated with the anti-human TfR antibodies provided herein demonstrated that a robust depletion of TfR-positive erythroid cells is also observable in human/primate cellular systems as it is in mice (see, e.g., Example 4). Accordingly, also provided herein are modifications to the antibodies to greatly reduce or eliminate the unwanted reduction in the TfR-expressing reticulocyte population upon anti-TfR administration while still enabling the enhanced BBB transport, increased CNS distribution and CNS retention provided by the anti-human/primate TfR antibodies administered at therapeutic concentrations. Several general approaches to mitigate the observed effect of the anti-TfR antibodies on both the primary and residual reticulocyte depletion are provided herein, and may be used singly or in combination. [0010] In one approach, the effector function of the anti-human/cyno TfR antibody is reduced or eliminated in order to reduce or eliminate ADCC activity. In another approach, the affinity of the anti-human/cyno TfR antibody for human or primate TfR is further lessened such that interactions of the antibody with the reticulocyte population are less detrimental to that population. A third approach is directed to reducing the amount of anti-human/cyno TfR antibody that is present in the plasma to reduce exposure of the reticulocyte population to potentially detrimental concentrations of the antibody. A fourth approach seeks to protect, stabilize and/or replenish reticulocyte populations such that any potential depletion of the reticulocyte population in circulation or in bone marrow by administration of the anti-human/cyno TfR antibody is avoided, lessened, or mitigated.
[0011] Effector function reduction or elimination, as described herein, may be accomplished by: (i) reduction or elimination of wild-type mammalian glycosylation of the antibody, (for example, by producing the antibody in an environment where such glycosylation cannot occur, by mutating one or more carbohydrate attachment points such that the antibody cannot be glycosylated, or by chemically or enzymatically removing one or more carbohydrates from the antibody after it has been glycosylated); (ii) by reduction or elimination of the Fc receptor-binding capability of the anti-human/cyno TfR antibody (for example, by mutation of the Fc region, by deletion within the Fc region or elimination of the Fc region); or (iii) by utilization of an antibody isotype known to have minimal or no effector function (ie., including but not limited to IgG4).
[0012] Decreasing antibody complement activation, as described herein, may be accomplished by reduction or elimination of the Clq binding capability of the anti-human/cyno TfR antibody (for example, by mutation of, deletion within or elimination of the Fc region, or by modifying the non- Fc portion of the anti-human/cyno TfR antibody), or by otherwise suppressing activation or activity of the complement system (for example, by co-administering one or more complement pathway activation or complement pathway activity inhibitors).
[0013] When binding of anti-human/cyno TfR antibody to human or cyno TfR on reticulocytes or other cell types expressing high levels of TfR triggers their depletion, as with the anti-human/cyno TfR antibodies exemplified herein, reduction of binding of the antibodies to the human or cyno TfR on the reticulocytes or other cell types should in turn decrease the amount of reticulocyte or other cell type depletion in circulation or in bone marrow observed upon antibody administration. The affinity of the anti-human/cyno TfR antibody for primate or human TfR may be modified using any of the methods described herein and as shown in the Examples.
[0014] Reducing the amount of anti-human/cyno TfR antibody present in the plasma in order to reduce exposure of the reticulocyte population to potentially detrimental concentrations of the antibody may be accomplished in several ways. One method is to simply decrease the amount of the antibody that is dosed, potentially while also increasing the frequency of the dosing, such that the maximal concentration in the plasma is lowered but a sufficient serum level is maintained for efficacy, while still below the threshold of the cell-depleting side effect. Another method, which may be combined with dosing modifications, is to select or engineer an anti-Tf antibody that has pH-sensitive binding to TfR such that it binds to cell surface TfR in the plasma at pH 7.4 with desirably low affinity as described herein, but upon internalization into an endosomal
compartment, such binding to TfR is rapidly and significantly reduced at the relatively lower pH of that compartment (pH 5.5-6.0). Such dissociation may protect the antibody from antigen-mediated clearance, or increase the amount of antibody that is either delivered to the CNS or recycled back across the BBB - in either case, the effective concentration of the antibody is increased relative to an anti-TfR antibody that does not comprise such pH sensitivity, without increasing the administered dose of the antibody, and in turn potentially permitting a lower dose of the antibody with concomitantly lesser risk of side effects.
[0015] Protecting, stabilizing and/or replenishing reticulocyte populations may be accomplished using pharmaceutical or physical methods. In addition to the anti-human/cyno TfR antibody, at least one further therapeutic agent may be coadministered (simultaneously or sequentially) that mitigates negative side effects of the antibody on reticulocyte populations. Examples of such therapeutic agents include, but are not limited to, erythropoietin (EPO), iron supplements, vitamin C, folic acid, and vitamin B12. Physical replacement of red blood cells (ie, reticulocytes) is also possible by, for example, transfusion with similar cells, which may be from another individual of similar blood type or may have been previously extracted from the subject to whom the anti- human/cyno TfR antibody is administered.
[0016] One of ordinary skill in the art will appreciate that any combination of the foregoing methods may be employed to engineer an antibody (and/or dosage regimen for same) with the optimum balance between (i) the desirably low affinity for primate or human TfR that will maximize transport of the antibody and any conjugated compounds into the CNS; (ii) the affinity of the conjugated compound (including as a nonlimiting example, a second or further antigen- binding specificity in the anti-human/cyno TfR antibody) for its CNS antigen, since this is relevant to the amount of the compound that needs to be present in the CNS to have a therapeutic effect; (iii) the clearance rate of the anti-human/cynoTfR antibody; (iv) the lability of the anti- TfR/conjugated compound at low pH to facilitate release of the conjugated compound on the CNS/brain side of the BBB, and (v) the impact on reticulocyte populations.
[0017] It will also be appreciated that the reticulocyte-depleting effect recognized herein of anti- TfR antibody administration may be useful in the treatment of any disease or disorder where overproliferation of reticulocytes is problematic. For example, in congenital polycythemia or neoplastic polycythemia vera, raised red blood cell counts due to hyperproliferation of, e.g., reticulocytes, results in thickening of blood and concomitant physiological symptoms.
Administration of an anti-human/cyno TfR antibody wherein at least partial effector function of the antibody was preserved would permit selective removal of immature reticulocyte populations without impacting normal transferrin transport into the CNS. Dosing of such an antibody could be modulated such that acute clinical symptoms could be minimized (ie, by dosing at a very low dose or at widely-spaced intervals), as well-understood in the art.
[0018] Anti-TfR/BACEl and anti-TfR/Abeta are each promising and novel therapeutic candidates for the treatment of Alzheimer's disease. Furthermore, receptor mediated transport (RMT)-based bispecific targeting technology opens the door for a wide range of potential therapeutics for CNS diseases. The invention provides methods of engineering BBB-penetrant therapeutics that greatly improve transport across the BBB and CNS distribution of the therapeutic without depletion of reticulocytes.
[0019] Accordingly, in some embodiments, an isolated multispecific antibody that binds to human transferrin receptor (TfR) and primate TfR is provided, wherein the antibody does not inhibit the binding of transferrin to TfR, and wherein the antibody also binds BACE1. In some aspects, the binding is specific binding. In some embodiments, one or more properties of the antibody have been modified to reduce or eliminate the impact of the antibody on reticulocytes and/or reduce the severity or presence of acute clinical symptoms in a subject or mammal treated with the antibody. In another aspect, the antibody further does not inhibit the binding of human hemachromatosis protein ("HFE") to TfR. In some aspects, the binding is specific binding. In some aspects, the antibody is a monoclonal antibody. In another aspect, the antibody is a human antibody. In another aspect, the antibody is a humanized antibody. In another aspect, the antibody is a chimeric antibody. In another aspect, the antibody is an antibody fragment that binds human TfR and primate TfR, and also binds BACE1. In another aspect, the primate TfR is from cynomolgous monkey.
[0020] In some aspects of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 31, 33 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 36, 38 and 39. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 36, 40 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs:42, 43 and 44. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 31, 33 and 34. In another aspect of the above embodiment, the anti- TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 46, 48 and 49. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs:52, 54 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 52, 58 and 59. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 62, 63 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs:52, 65 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 68, 69 and 70. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 73, 75 and 76. In another aspect of the above embodiment, the anti- TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 79, 81 and 82. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 79, 83 and 84. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 87, 89 and 90. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 93, 95 and 96. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 99, 101 and 102. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 127, 33 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 52, 156 and 55. In another aspect of the above embodiment, the anti- TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 52, 157 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L3, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 155, 54 and 55
[0021] In some aspects of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2 and HVR-H3, respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 38 and 39. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 40 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- Hl, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 43 and 44. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34. In another aspect of the above embodiment, the anti- TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 47, 48 and 49. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 54 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 58 and 59. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 63 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 65 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- Hl, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 69 and 70. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 74, 75 and 76. In another aspect of the above embodiment, the anti- TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 81 and 82. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 83 and 84. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 88, 89 and 90. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 94, 95 and 96. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 100, 101 and 102. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- Hl, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 156 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 157 and 55.
[0022] In some aspects of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 35, 30 and 36. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 41, 30 and 42. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 45, 30 and 46. In another aspect of the above embodiment, the anti- TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 56, 57 and 52. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 61 and 62. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 64 and 52. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 66, 67 and 68. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 71, 72 and 73. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs:77, 78 and 79. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 85, 86 and 87. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 91, 92 and 93. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 97, 98 and 99. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 127. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 155.
[0023] In some aspects of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31 and HVR-H1, HVR-H2 and HVR-H3, respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 35, 30 and 36 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 38 and 39. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 35, 30 and 36 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 40 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 41, 30 and 42 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 37, 43 and 44 In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 31 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 45, 30 and 46 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 47, 48 and 49. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 54 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 56, 57 and 52 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 58 and 59. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 61 and 62 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 63 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 60, 64 and 52 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 65 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 66, 67 and 68 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 69 and 70. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 71, 72 and 73 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 74, 75 and 76. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs:77, 78 and 79 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 81 and 82. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2 and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 77, 78 and 79, and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 80, 83 and 84. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 85, 86 and 87 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 88, 89 and 90. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-L1, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 91, 92 and 93 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 94, 95 and 96. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 97, 98 and 99 and HVR-H1, HVR-H2, and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 100, 101 and 102. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 29, 30 and 127 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 32, 33 and 34. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 156 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR- Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 52 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 157 and 55. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises HVR-Ll, HVR-L2, and HVR-L3 respectively comprising the amino acid sequences of SEQ ID NOs: 50, 51 and 155 and HVR-Hl, HVR-H2 and HVR-H3 respectively comprising the amino acid sequences of SEQ ID NOs: 53, 54 and 55.
[0024] In some aspects of the above embodiment, the anti-TfR arm of the multispecific antibody comprises at least one HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, or HVR-L3 sequence selected from the group of sequences consisting of an HVR-Hl sequence of SEQ ID NO: 47, 53, or 100; an HVR-H2 sequence of SEQ ID NO: 48, 69, 101, 156 or 157;an HVR-H3 sequence of SEQ ID NO: 49, 76, or 102; an HVR-Ll sequence of SEQ ID NO: 45, 66 or 97; an HVR-L2 sequence of SEQ ID NOs: 30, 67 or 98; and an HVR-L3 sequence of SEQ ID NOs: 46, 68 or 102.
[0025] In some aspects of the above embodiment, the anti-TfR arm of the multispecific antibody comprises (a) a VH sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, 15, 16, 17, 18, 20, 25, 26, 27, 28, 108, 114, 120, 126, 403, or 404; (b) a VL sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4, 5, 6, 11, 12, 13, 14, 19, 21, 22, 23, 24, 105, 111, 117, 123, 401, or 402; or (c) a VH sequence as in (a) and a VL sequence as in (b). In one such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 4 and a VH sequence of SEQ ID NO: 7. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 5 and a VH sequence of SEQ ID NO: 8. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 5 and a VH sequence of SEQ ID NO: 9. In another such aspect, the anti-Tf arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 6 and a VH sequence of SEQ ID NO: 10. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 11 and a VH sequence of SEQ ID NO: 15. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 12 and a VH sequence of SEQ ID NO: 16. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 13 and a VH sequence of SEQ ID NO: 17. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 14 and a VH sequence of SEQ ID NO: 18. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 19 and a VH sequence of SEQ ID NO: 20. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 21 and a VH sequence of SEQ ID NO: 25. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 22 and a VH sequence of SEQ ID NO: 26. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 23 and a VH sequence of SEQ ID NO: 27. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 24 and a VH sequence of SEQ ID NO: 28. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 105 and a VH sequence of SEQ ID NO: 108. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO:
401 and a VH sequence of SEQ ID NO: 108. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 111 and a VH sequence of SEQ ID NO: 114. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 117 and a VH sequence of SEQ ID NO: 120. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 123 and a VH sequence of SEQ ID NO: 126. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 105 and a VH sequence of SEQ ID NO: 403. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of SEQ ID NO: 401 and a VH sequence of SEQ ID NO: 403. In another such aspect, the antibody comprises a VL sequence of SEQ ID NO: 105 and a VH sequence of SEQ ID NO: 404. In another such aspect, the antibody comprises a VL sequence of SEQ ID NO: 401 and a VH sequence of SEQ ID NO: 404. In another such aspect, the antibody comprises a VL sequence of SEQ ID NO:
402 and a VH sequence of SEQ ID NO: 108. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VH sequence of (a) SEQ ID NO: 108, (b) SEQ ID NO: 114, (c) SEQ ID NO: 120, (d) SEQ ID NO: 126, (e) SEQ ID NO: 403, or (f) SEQ ID NO: 404. In another such aspect, the anti-TfR arm of the multispecific antibody comprises a VL sequence of (a) SEQ ID NO: 105, (b) SEQ ID NO: 111, (c) SEQ ID NO: 117, (d) SEQ ID NO: 123, (e) SEQ ID NO: 401, or (f) SEQ ID NO: 402.
[0026] In some aspects of the embodiment above, the anti-TfR arm of the multispecific antibody is selected from the group consisting of antibodies 7A4, 8A2, 15D2, 10D11, 7B10, 15G11, 16G5, 13C3, 16G4, 16F6, 7G7, 4C2, 1B12, and 13D4. In one such aspect, the anti-TfR arm of the multispecific antibody is 7A4. In another such aspect, the anti-TfR arm of the multispecific antibody is 8A2. In another such aspect, the anti-TfR arm of the multispecific antibody is 15D2. In another such aspect, the anti-TfR arm of the multispecific antibody is 10D11. In another such aspect, the anti-TfR arm of the multispecific antibody is 7B10. In another such aspect, the anti- TfR arm of the multispecific antibody is 15G11. In another such aspect, the anti-TfR arm of the multispecific antibody is 16G5. In another such aspect, the anti-TfR arm of the multispecific antibody is 13C3. In another such aspect, the anti-TfR arm of the multispecific antibody is 16G4. In another such aspect, the anti-TfR arm of the multispecific antibody is 16F6. In another such aspect, the anti-TfR arm of the multispecific antibody is 7G7. In another such aspect, the anti-TfR arm of the multispecific antibody is 4C2. In another such aspect, the anti-TfR arm of the multispecific antibody is IB 12. In another such aspect, the anti-TfR arm of the multispecific antibody is 13D4.
[0027] In some aspects of any of the foregoing, the antibody is further affinity matured. In one such aspect, the anti-TfR arm of the multispecific antibody is selected from the group consisting of 15Gl l .vl, 15Gl l .v2, 15Gl l .v3, 15Gl l .v4, 15Gl l .v5, 7A4.vl; 7A4.v2, 7A4.v3, 7A4.v4, 7A4.v5, 7A4.v6, 7A4.v7, 7A4.v8, 7A4.v9, 7A4.vlO, 7A4.vl l, 7A4.vl2, 7A4.vl3, 7A4.vl4, 7A4.vl5, 7G7.vl, 16F6.vl, 16F6.v2, 16F6.v3, 16F6.v4, 15G11.N52A, 15G11.T53A and 15G11.W92A. In one such aspect, the anti-TfR arm of the multispecific antibody is 15G11.vl . In another such aspect, the anti-TfR arm of the multispecific antibody is 15G1 l.v2. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.v3. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.v4. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.v5. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl . In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v2. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v3. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v4. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v5. In another such aspect, the anti- TfR arm of the multispecific antibody is 7A4.v6. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v7. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v8. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.v9. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vlO. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl 1. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl2. In another such aspect, the anti- TfR arm of the multispecific antibody is 7A4.vl3. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl4. In another such aspect, the anti-TfR arm of the multispecific antibody is 7A4.vl5. In another such aspect, the anti-TfR arm of the multispecific antibody is 7G7.vl . In another such aspect, the anti-TfR arm of the multispecific antibody is 16F6.vl. In another such aspect, the anti-TfR arm of the multispecific antibody is 16F6.v2. In another such aspect, the anti-TfR arm of the multispecific antibody is 16F6.v3. In another such aspect, the anti- TfR arm of the multispecific antibody is 16F6.v4. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.N52A. In another such aspect, the anti-TfR arm of the multispecific antibody is 15G11.T53A. In another such aspect, the antibody is 15G11.W92A.
[0028] In some aspects of the above embodiment, the antibody is modified at one or more amino acid positions in the VH or VL to the amino acid indicated for that position in Figures 4E-1 and 4E-2. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises a sequence or one or more HVR sequences corresponding to that of or one or more of those set forth for any one of the clones in Figures 3 and 4 and Figures 4E-1 and 4E-2. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises a VH or VL sequence corresponding to that of set forth for any one of the clones in Figures 3 and 4 and Figures 4E-1 and 4E-2. In another aspect of the above embodiment, the anti-TfR arm of the multispecific antibody comprises one or more HVR sequences corresponding to one or more of those set forth for any one of the clones in Figures 3 and 4 and Figures 4E-1 and 4E-2.
[0029] In some embodiments, a multispecific antibody TfR is provided, comprising a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (TfR) and primate, wherein the antibody does not inhibit the binding of transferrin to TfR; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the second antigen binding site comprises:
a) an HVR-Hl sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201 ; an HVR-L1 sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248; or
b) an HVR-Hl sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385; an HVR-Ll sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247.
[0030] In some embodiments, a multispecific antibody is provided, comprising a first half antibody comprising a first antigen binding site that binds to human TfR and primate TfR, wherein the antibody does not inhibit the binding of transferrin to TfR, and wherein one or more properties of the antibody have been modified to reduce or eliminate the impact of the antibody on reticulocytes and/or reduce the severity or presence of acute clinical symptoms in a subject or mammal treated with the antibody; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the second antigen binding site comprises:
a) an HVR-H1 sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201; an HVR-Ll sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248; or
b) an HVR-H1 sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385; an HVR-Ll sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247.
[0031] In some embodiments, the second antigen binding site comprises the HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody selected from the antibodies in Table 1. In some embodiments, the antibody from Table 1 is antibody 6266. In some embodiments, the antibody comprises an HVR-Hl of SEQ ID NO: 15; an HVR-H2 sequence of SEQ ID NO: 29; an HVR-H3 sequence of SEQ ID NO: 52; an HVR-Ll sequence of SEQ ID NO: 65; an HVR-L2 sequence of SEQ ID NO: 71; and an HVR-L3 sequence of SEQ ID NO: 80.
[0032] In some embodiments, the second binding site comprises:
a) a heavy chain variable region sequence having at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374; or
b) a light chain variable region sequence having at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366; or c) a heavy chain variable region sequence as in (a) and a light chain variable domain sequence as in (b).
In some embodiments, the second binding site comprises:
a) a heavy chain variable region sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374; or
b) a light chain variable region sequence selected from SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366; or
c) a heavy chain variable region sequence as in (a) and a light chain variable domain sequence as in (b).
[0033] In some embodiments, the second binding site comprises:
a) a heavy chain variable domain sequence having at least 90% sequence identity to a sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374; or
b) a light chain variable domain sequence having at least 90% sequence identity to a sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366; or
c) a heavy chain variable domain sequence as in (a) and a light chain variable domain sequence as in (b).
In some embodiments, the second binding site comprises:
a) a heavy chain variable domain sequence having a sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374; or
b) a light chain variable domain sequence having a sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366; or
c) a heavy chain variable domain sequence as in (a) and a light chain variable domain sequence as in (b) ; or
d) a heavy chain variable domain sequence and a light chain variable domain sequence of an antibody selected from 6266 and 6266 variants 1-15.
[0034] In some embodiments, the isolated antibody modulates the activity of BACEl. In some embodiments, the antibody inhibits the activity of BACEl . In some embodiments, BACEl activity is measured using a homogeneous time-resolved fluorescence (HTRF) assay. In some embodiments, BACEl activity is measured using a cell line that expresses a BACEl substrate. In some embodiments, the BACEl substrate is amyloid precursor protein (APP). In some embodiments, BACEl activity is measured in tissue from an animal that has been administered the multispecific antibody. In some embodiments, the tissue is brain tissue. In some embodiments, the animal is selected from a mouse, rat, rabbit, dog, monkey, and non-human primate.
[0035] In some embodiments, the antibody is an allosteric inhibitor of BACEl activity. In some embodiments, the antibody binds BACEl with an affinity (KD) of between 0.1 nM and 10 nM, or between 0.1 nM and 8 nM, or between 0.1 nM and 7 nM, or between 0.1 nM and 5 nM, or between 0.5 nM and 5 nM, or between 0.1 nM and 3 nM, or between 0.5 nM and 3 nM, as measured by surface plasmon resonance (SP ). In some embodiments, the antibody achieves a maximum inhibition of BACE1 activity of greater than 60%, greater than 70%, greater than 75%, or greater than 80%, as measured, for example, using the dissociated cortical neuron culture assay.
[0036] In some aspects of the above embodiment, the one or more properties of the multispecific antibody are selected from the effector function of the antibody Fc region, the complement activation function of the antibody and the affinity of the antibody for TfR and/or BACE1. In one such aspect, the property is the effector function of the antibody Fc region. In another such aspect, the property is the complement activation function of the antibody. In another such aspect, the property is the affinity of the antibody for TfR and/or BACE1. In one such aspect, the effector function or complement activation function has been reduced or eliminated relative to a wild-type antibody of the same isotype. In some aspects, the effector function is reduced or eliminated by a method selected from reduction of glycosylation of the antibody, modification of the antibody isotype to an isotype that naturally has reduced or eliminated effector function, and modification of the Fc region.
[0037] In one such aspect, the effector function is reduced or eliminated by reduction of glycosylation of the antibody. In one such aspect, the glycosylation of the antibody is reduced by a method selected from: production of the antibody in an environment that does not permit wild-type glycosylation; removal of carbohydrate groups already present on the antibody; and modification of the antibody such that wild-type glycosylation does not occur. In one such aspect, the glycosylation of the antibody is reduced by a production of the antibody in an environment that does not permit wild-type glycosylation, such as production in a non-mammalian cell production system or where the antibody is produced synthetically. In one such aspect, the antibody is produced in a non-mammalian cell production system. In another such aspect, the antibody is produced synthetically. In another such aspect, the glycosylation of the antibody is reduced by modification of the antibody such that wild-type glycosylation does not occur, such as wherein the Fc region of the antibody comprises a mutation at position 297 such that the wild-type asparagine residue at that position is replaced with another amino acid that interferes with glycosylation at that position.
[0038] In another such aspect, the effector function is reduced or eliminated by at least one modification of the Fc region. In one such aspect, the effector function or complement activation function is reduced or eliminated by deletion of all or a portion of the Fc region, or by engineering the antibody such that it does not include an Fc region or non-Fc region competent for effector function or complement activation function. In another such aspect, the at least one modification of the Fc region is selected from: a point mutation of the Fc region to impair binding to one or more Fc receptors selected from the following positions: 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 297, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438, and 439; a point mutation of the Fc region to impair binding to Clq selected from the following positions: 270, 322, 329, and 321; eliminating some or all of the Fc region, and a point mutation at position 132 of the CHI domain. In one such aspect, the modification is a point mutation of the Fc region to impair binding to Clq selected from the following positions: 270, 322, 329, and 321. In another such aspect, the modification is elimination of some or all of the Fc region. In another such aspect, complement- triggering function is reduced or eliminated by deletion of all or a portion of the Fc region, or by engineering the antibody such that it does not include an Fc region that engages the complement pathway. In one such aspect, the antibody is selected from a Fab or a single chain antibody. In another such aspect, the non-Fc region of the antibody is modified to reduce or eliminate activation of the complement pathway by the antibody. In one such aspect, the modification is a point mutation of the CHI region to impair binding to C3. In one such aspect, the point mutation is at position 132 (see, e.g., Vidarte et al., (2001) J. Biol. Chem. 276(41): 38217-38223).
[0039] In some aspects, the antibody the half-life of the antibody is increased by a modification in the FcRn binding region. In some aspects, the modification is a substitution in an amino acid selected from the following positions: 251 256, 285, 290, 308, 314, 385, 389, 428, 434, 436, 238, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434. In some aspects the modification is a substitution selected from the following: M252Y, S254T, T256E, N434A and Y436I.
In some aspects, the antibody is combined with a further compound that mitigates or contributes to the reduction of impact on reticulocyte levels or acute clinical symptoms. In one such aspect, the further compound protects reticulocytes from antibody-related depletion or supports the growth, development, or reestablishment of reticulocytes. In another such aspect, the further compound is selected from erythropoietin (EPO), an iron supplement, vitamin C, folic acid, and vitamin B12, or is red blood cells or reticulocytes.
[0040] In some aspects of the above embodiment, the affinity of the antibody for Tf is decreased, as measured relative to a wild-type antibody of the same isotype not having lowered affinity for TfR. In one such aspect, the antibody has a KD or IC50 for Tf of about 1 pM to about 100 μΜ. In another aspect, the dose amount and/or frequency of administration of the antibody is modulated to reduce the concentration of the antibody to which the red blood cells are exposed.
[0041] In some aspects of the above embodiment, the antibody is coupled to a therapeutic compound. In another aspect of the above embodiment, the antibody is coupled to an imaging agent or a label. In one such aspect, the antibody is a multispecific antibody and the therapeutic compound optionally forms one portion of the multispecific antibody comprising a first antigen binding site that binds Tf and a second antigen binding site that binds BACE1.
[0042] In some embodiments, the multispecific antibody is an IgG antibody. In some
embodimetns, the antibody is an IgGl or IgG4 antibody. In some embodiments, the antibody is an IgGl antibody. In some embodiments, the antibody comprises a first heavy chain constant region and a second heavy chain constant region, wherein the first heavy chain constant region comprises a knob mutation and the second heavy chain constant region comprises a hole mutation. In some embodiments, the first heavy chain constant region is fused to the first antigen binding site. In some embodiments, the second heavy chain constant region is fused to the second antigen binding site. In some embodiments, the first heavy chain constant region is fused to the second antigen binding site. In some embodiments, the second heavy chain constant region is fused to the first antigen binding site. In some embodiments, the antibody is an IgGl antibody and wherein the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgGl antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V. In some embodiments, the antibody is an IgG4 antibody and wherein the knob mutation comprises a T366W mutation. In some embodiments, the antibody is an IgG4 antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations.In some embodiments, a multispecific antibody is provided, comprising a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (Tf ) and primate, wherein the antibody does not inhibit the binding of transferrin to TfR; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein:
a) the first heavy chain and the first light chain are selected from SEQ ID NOs: 329 and 330, SEQ ID NOs: 333 and 334, SEQ ID NOs: 337 and 338, SEQ ID NOs: 341 and 342, and SEQ ID NOs: 394 and 342; and
b) the second heavy chain and the second light chain are selected from SEQ ID NOs:
331 and 332, SEQ ID NOs: 335 and 336, SEQ ID NOs: 339 and 340, and SEQ ID NOs: 343 and 344.
[0043] In some embodiments, the antibody comprises:
a) the first heavy chain and the first light chain are selected from SEQ ID NOs: 333 and 334, SEQ ID NOs: 341 and 342, and SEQ ID NOs: 394 and 342; and b) the second heavy chain and the second light chain are selected from SEQ ID NOs:
335 and 336, and SEQ ID NOs: 343 and 344. [0044] In some embodiments, a multispecific antibody comprises a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (Tf ) and primate Tf , and a second half antibody comprising a second antigen binding site that binds BACE1, wherein:
a) the first half antibody comprises a first heavy chain having the sequence of SEQ ID NO: 394 and a first light chain having the sequence of SEQ ID NO: 342, and the second half antibody comprises a second heavy chain having the sequence of SEQ ID NO: 343 and a second light chain having the sequence of SEQ ID NO: 344; or b) the first half antibody comprises a first heavy chain variable region comprising the sequence of SEQ ID NO: 396 and a first light chain variable region comprising the sequence of SEQ ID NO: 398, and the second half antibody comprises a second heavy chain variable region comprising the sequence of SEQ ID NO: 399 and a second light chain variable region comprising the sequence of SEQ ID NO: 400.
[0045] In some embodiments, the multispecific antibody comprises a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (TfR) and primate TfR, and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the first half antibody comprises a first heavy chain variable region comprising the sequence of SEQ ID NO: 395 and a first light chain variable region comprising the sequence of SEQ ID NO: 397, and the second half antibody comprises a second heavy chain variable region comprising the sequence of SEQ ID NO: 399 and a second light chain variable region comprising the sequence of SEQ ID NO: 400.
[0046] In some embodiments, the invention provides an isolated nucleic acid encoding any of the foregoing antibodies. In another aspect, the invention provides a host cell comprising such nucleic acid. In another aspect, the invention provides a method of producing any of the foregoing antibodies comprising culturing such host cell so that the antibody is produced and optionally further comprising recovering the antibody from the host cell.
[0047] In some aspects of the above embodiment, the invention provides a pharmaceutical formulation comprising any of the foregoing antibodies and a pharmaceutically acceptable carrier.
[0048] In some aspects of the above embodiment, the invention provides any of the foregoing antibodies for use as a medicament. In another aspect of the above embodiment, the invention provides the use of any of the foregoing antibodies in the manufacture of a medicament for treating a neurological disorder. In one such aspect, the neurological disorder is selected from the group consisting of a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder, and CNS inflammation. [0049] In another aspect of the above embodiment, the invention provides any of the foregoing antibodies for use in treating a neurological disorder. In one such aspect, the neurological disorder is selected from the group consisting of a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder, and CNS inflammation.
[0050] In another aspect of the above embodiment, the invention provides any of the foregoing antibodies for use in transporting one or more compounds across the BBB. In another aspect of the above embodiment, use of any of the foregoing antibodies in the manufacture of a medicament for transporting one or more compounds across the BBB is provided.
[0051] In some aspects of the above embodiment, a method of transporting a compound across the BBB in a subject is provided, comprising exposing any of the foregoing antibodies to the BBB such that the antibody transports the compound coupled thereto across the BBB. In another such aspect, the BBB is in a human subject. In another such aspect, the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which red blood cells are exposed. In another such aspect, the method further comprises the step of monitoring the subject for depletion of red blood cells. In another such aspect, the antibody coupled to the compound is administered at a therapeutic dose. In one such aspect, the therapeutic dose is Tf -saturating. In another such aspect, administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
[0052] In another aspect of the above embodiment, a method of increasing exposure of the CNS of a subject to a compound is provided, comprising exposing any of the foregoing antibodies to the BBB such that the antibody transports the compound coupled thereto across the BBB. In another such aspect, the BBB is in a human subject. In another such aspect, the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which red blood cells are exposed. In another such aspect, the method further comprises the step of monitoring the subject for depletion of red blood cells. In another such aspect, the antibody coupled to the compound is administered at a therapeutic dose. In one such aspect, the therapeutic dose is Tf -saturating. In another such aspect, administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
[0053] In some aspects of the above embodiment, a method of increasing rentention in the CNS of a compound administered to a subject is provided, comprising exposing any of the foregoing antibodies to the BBB such that the retention in the CNS of the compound is increased. In another such aspect, the BBB is in a human subject. In another such aspect, the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which red blood cells are exposed. In another such aspect, the method further comprises the step of monitoring the subject for depletion of red blood cells. In another such aspect, the antibody coupled to the compound is administered at a therapeutic dose. In one such aspect, the therapeutic dose is Tf -saturating. In another such aspect, administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
[0054] In some aspects of the above embodiment, a method of treating a neurological disorder in a mammal is provided, comprising treating the mammal with any of the foregoing antibodies. In one such aspect, the neurological disorder is selected from the group consisting of a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder, and CNS inflammation. In another such aspect, the neurological disorder is in a human subject. In another such aspect, the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which the re blood cells are exposed. In another such aspect, the method further comprises the step of monitoring the subject for depletion of red blood cells. In another such aspect, the antibody coupled to the compound is administered at a therapeutic dose. In one such aspect, the therapeutic dose is Tf -saturating. In another such aspect, administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
[0055] In another embodiment, the invention provides an isolated multispecific antibody comprising an anti-Tf arm that binds to the same epitope on Tf as an antibody selected from the group consisting of antibodies 7A4, 8A2, 15D2, 10D11, 7B10, 15G11, 16G5, 13C3, 16G4, 16F6, 7G7, 4C2, 1B12, 13D4, 15Gl l.vl, 15Gl l.v2, 15Gl l.v3, 15Gl l.v4, 15Gl l .v5, 7A4.vl ; 7A4.v2, 7A4.v3, 7A4.v4, 7A4.v5, 7A4.v6, 7A4.v7, 7A4.v8, 7A4.v9, 7A4.vlO, 7A4.vl l, 7A4.vl2, 7A4.vl3, 7A4.vl4, 7A4.vl5, 7G7.vl, 16F6.vl, 16F6.v2, 16F6.v3, 16F6.v4, 15G11.N52A, 15Gl l .T53A and 15G11W92A.
[0056] In another embodiment, a method of decreasing clearance of a compound administered to a subject is provided, wherein the compound is coupled to an antibody which binds with low affinity to TfR, such that the clearance of the compound is decreased, and wherein reduction of red blood cell levels in the subject upon compound-coupled antibody administration to the subject is decreased or eliminated.
[0057] In another embodiment, a method of optimizing the pharmcokinetics and/or
pharmacodynamics of a compound to be efficacious in the CNS in a subject is provided, wherein the compound is coupled to an antibody which binds with low affinity to TfR, and the antibody is selected such that its affinity for TfR after coupling to the compound results in an amount of transport of the antibody conjugated to the compound across the BBB that optimizes the pharmacokinetics and/or pharmacodynamics of the compound in the CNS, wherein reduction of red blood cell levels in the subject upon compound-coupled antibody administration to the subject is decreased or eliminated.
[0058] It will be understood that any of the foregoing methods and compositions of the invention may be combined with one another and/or with the further aspects of the invention described in the specification herein.
BRIEF DESCRIPTION OF THE FIGURES
[0059] Figure 1 depicts a three-dimensional crystal structure of a TfR dimer in complex with Tf, based on the pdb file 3SM9. The non-Tf-binding apical region of TfR is labeled.
[0060] Figures 2A-2B depict FACS analysis of mouse hybridoma parental clone supernatants binding to human and cynomolgus TfR transiently expressed in 293 cells in the presence of 1 μΜ human holo-Tf. Unless otherwise indicated, the filled grey trace in each graph is background from the detection antibody, the medium grey trace is binding to 293 cells that endogenously express basal levels of human TfR, the bold black trace represents binding to transiently expressed human
TfR and the thin grey trace represents binding to transiently expressed cyno TfR.
[0061] Figure 2C depicts the results of human/cynomolgous cross-reactive antibody competition assays as described in Example 1. Nine of the fourteen clones were found to block binding of the apical binding antibody displayed on phage.
[0062] Figures 3A-1, 3A-2, 3B-1, 3B-2, 3C-1, 3C-2, 3D-land 3D-2 depict the heavy and light chain variable region sequences of hybridoma clones that bind to apical and non-apical regions of TfR. The sequences can be further subdivided by epitope and sequence similarity into class I-III (apical binders) and class IV (non-apical binders). The HVRs according to Kabat are indicated by underlining.
[0063] Figures 4A-1, 4A-2, 4B-1, 4B-2, 4C-1, 4C-2, 4D-1 and 4D-2 depict alignments of humanized sequences for (A) 15G11, (B) 7A4/8A2, (C) 7G7 and (D) 16F6. Each mouse light or heavy variable domain sequence (second line) is aligned to the closest human germline or consensus variable domain (first line). The humanized version for each antibody is shown at the bottom (third line). Differences from the human germline or consensus sequences are shaded. HVR sequences that were grafted into the human framework are boxed. CDR definitions according to Kabat are indicated.
[0064] Figure 4E-1 and 4E-2 show that for the class I-III groups of antibodies, variant forms of the antibodies with modifications at one or more residues of an FR retained affinity and binding specifity. Figure 5 depicts the binding of hu7A4.vl 5, hul 5G11.v5 and hu7G7.vl to huTfR in the presence of 6.3 μΜ holo-Tf. Antibody binding to immobilized huTfR is shown in the presence (open sybols and dashed lines) or absence (filled symbols and solid lines) of 6.3 μΜ holo-Tf.
[0065] Figures 6A-B depict the results of the HFE - HuTfR binding and the HFE blocking assays described in Example 1. Figure 6A shows the binding of antibody to increasing concentrations of huTfR captured via immobilized HFE. Figure 6B shows the binding of huTfR to immobilized HFE in the presence of increasing concentrations of antibody.
[0066] Figure 7A-B depict binding analyses of 15G1 l.v5 and 7A4.v5 IgG and Fab Ala variants on cyno and human TfR, demonstrating the effects on affinity of Ala mutations in CDR-L3 and CDR- H3 of each antibody assessed as IgG by ELISA binding and IgG or Fab by SPR analysis to immobilized human or cyno TfR, as described in Example 2.
[0067] Figures 8A-B and Figures 9A-B depict the results of experiments assessing the impact of effector function status on ADCC activity of anti-human TfR ("anti-hTFR") antibodies in primary human bone marrow mononuclear cells or in a human erythroblast cell line, as described in Example 4.
[0068] Figure 10 depicts the dosing and sampling scheme for the primate study described in Example 5.
[0069] Figures 11 A-l IB depict the pharmacokinetic results of the experiments described in Example 5, specifically individual and group mean anti-TfRVBACEl, anti-TfR2/BACEl and anti- gD serum concentrations versus time following a single IV bolus administration at 30 mg/kg in cynomolgus monkeys in serum (Figure 11A) and CSF (Figure 1 IB).
[0070] Figures 12A-12E depict the pharmacodynamic results of the experiments described in Example 5, specifically individual and group mean anti-TfRVBACEl, anti-TfR2/BACEl and anti- gD plasma (A) or CSF (B-E) concentrations versus time following a single IV bolus administration at 30 mg/kg in cynomolgus monkeys. The upper panels show Abetal-40 levels in plasma (Figure 12A) and CSF (Figure 12B), while the lower panels show soluble APPa levels (Figure 12C), soluble ΑΡΡβ levels (Figure 12D), and sAPPp/sAPPa ratio (Figure 12E) over time.
[0071] Figures 13A-13D depict the results of hematological sampling performed during the studies described in Example 5. At each of the indicated time points, total reticulocytes (Figure 13 A), red blood cells (Figure 13B), hemoglobin (Figure 13D) and the percentage of immature reticulocytes in the total reticulocyte pool (Figure 13C) were measured using standard techniques.
[0072] Figure 14 depicts the dosing and sampling scheme for the primate study described in Example 6.
[0073] Figures 15A-15B depict the pharmacodynamic results (A) and brain antibody
concentrations (B) of the experiments described in Example 6. Specifically, Figure 15A shows individual and group mean anti-TfRVBACEl, anti-TfR2/BACEl , anti-gD, and anti-BACEl ration of sAPPp/sAPPa in CSF versus time following a single IV bolus administration at 30 mg/kg in cynomolgus monkeys. Figure 15B show individual anti-TfRVBACEl , anti-TfR2/BACEl , anti- gD, and anti-BACEl concentrations of antibody in various brain regions at 24 hours post-dose.
[0074] Figures 16A-B depict the light and heavy chain amino acid sequences of anti-BACEl clone YW412.8 obtained from a na'ive sort of the natural diversity phage display library and affinity- matured forms of YW412.8. Fig. 16A depicts the variable light (VL) sequence alignments (SEQ ID NOs. 132-137). Fig. 16B depicts the variable heavy (VH) sequence alignments (SEQ ID Nos. 138-139). In both figures, the HVR sequences for each clone are indicated by the boxed regions, with the first box indicating HVR-Ll (Fig. 16A) or HVR-Hl (Fig. 16B), the second box indicating HVR-L2 (Fig. 16A) or HVR-H2 (Fig. 16B), and the third box indicating HVR-L3 (Fig. 16A) or HVR-H3 (Fig. 16B).
[0075] Figure 17 depicts the pharmacokinetic properties of the murine IgG2a Anti-TfRD/BACEl and Anti-gD antibodies with the Fc effector function LALAPG mutations as described in Example 7.
[0076] Figure 18 depicts the total and immature reticulocyte count in mice 24 hours after administration of a 50mg/kg dose of the murine IgG2a Anti-TfRD/BACEl and Anti-gD antibodies with the Fc effector function LALAPG mutations as described in Example 7.
[0077] Figure 19 depicts the heavy and light chain variable region sequences of 15G1 lv.5 (light chain - SEQ ID NO: 401 and heavy chain - SEQ ID NO: 108) and affinity variants 15G11.52A (light chain - SEQ ID NO: 401 and heavy chain - SEQ ID NO: 403), 15G11.53A (light chain - SEQ ID NO: 401 and heavy chain - SEQ ID NO: 404) and 15G1 1.92A (light chain - SEQ ID NO: 402 and heavy chain - SEQ ID NO: 108). The HVRs according to Kabat are indicated by underlining.
[0078] Figure 20 depicts a competition assay between 15G1 lv.5 and anti-TfRcl2as described in Example 1.
[0079] Figures 21A-21D show the epitope bin and heavy chain HVR-Hl , HVR-H2, and HVR-H3 sequences of certain anti-BACEl antibodies described herein.
[0080] Figures 22A-22C show the epitope bin and light chain HVR-Ll, HVR-L2, and HVR-L3 sequences of certain anti-BACEl antibodies described herein.
[0081] Figures 23A-23G show the epitope bin and heavy chain variable region (VH) sequences of certain anti-BACEl antibodies described herein.
[0082] Figures 24A-24F show the epitope bin and light chain variable region (VL) sequences of certain anti-BACEl antibodies described herein. [0083] Figures 25A-25D show the affinity (KD) of certain anti-BACEl antibodies for human BACEl at pH 7.5 (column 2), murine BACEl at pH 7.5 (column 3), human BACEl at pH 5.0 (column 4), and murine BACEl at pH 5.0 (column 5) using an Octet® system (ForteBio); and the affinity (KD) of certain anti-BACEl antibodies for human BACEl by surface plasmon resonance (Biacore™). For certain antibodies, affinities deteremined in two separate assays are shown.
[0084] Figure 26 shows modulation of BACEl activity by the anti-BACEl antibodies using a short substrate assay.
[0085] Figures 27A-27B shows modulation of BACEl activity by the anti-BACEl antibodies using a long substrate assay and a short substrate assay.
[0086] Figures 28A-28C show in vitro modulation of APP processing in cells by the anti-BACEl antibodies.
[0087] Figure 29 shows inhibition of BACEl activity in mouse cortical neurons with anti-BACEl antibody 6266, anti-BACEl antibody YW412.8.13, and bispecific antibodies Tf 2/6266 and Tf 2/YW412.8.31.
[0088] Figure 30 shows plasma pharmacokinetics (PK) in mice following a 25 mg/kg intravenous dose or bispecific antibody Tf D/YW412.8.31 or bispecific antibody Tf D/6266.
[0089] Figures 31 A and 3 IB show brain (A) pharmacokinetics and (B) pharmacodynamics in mice following a 25 mg/kg intravenous dose or bispecific antibody Tf D/YW412.8.31 or bispecific antibody Tf D/6266.
[0090] Figures 32A and 32B show (A) pharmacokinetics and (B) pharmacodynamics in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibody Tf VYW412.8.31 or bispecific antibody Tf V6266.
[0091] Figure 33 depicts the dosing and sampling scheme for the primate study described in Example 14.
[0092] Figures 34A and 34B show pharmacokinetics in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibodies (A) Tf 2/6266 or Tf 2/6266 FcRnHIGH, or (B) Tf 52A/6266 or Tf 52A/6266 FcRnHIGH.
[0093] Figures 35A and 35B show pharmacodynamics in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibodies (A) Tf 2/6266 or Tf 2/6266 FcRnHigh, or (B) TfR52A/6266 or TfR52A/6266 FcRnHigh.
[0094] Figure 36A-B show reticulocyte levels in cynomolgus monkeys following a single 30 mg/kg intravenous dose of bispecific antibodies TfR2/6266, TfR2/6266 FcRnHigh, TfR52A/6266, or TfR52A/6266 FcRnHigh, or control antibody.
[0095] Figure 37A-B show the (A) light chain variable region sequences and (B) heavy chain variable region sequences of the affinity -matured variants 1-7 of antibody 6266. [0096] Figure 38A-B show the (A) light chain variable region sequences and (B) heavy chain variable region sequences of the affinity -matured variants 8-15 of antibody 6266.
[0097] Figure 39 shows affinity constants and melting temperature for the affinity-matured variants of antibody 6266.
DETAILED DESCRIPTION OF EMBODIMENTS OF THE INVENTION
I. DEFINITIONS
[0098] "Affinity" refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., and antibody) and its binding partner (e.g., an antigen). Unless indicted otherwise, as used herein, "binding affinity" refers to intrinsic binding affinity which reflects a 1 :1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD, which is a ratio of the off-rate of X from Y (kd or Koff) to the on-rate of X to Y (ka or kon)). A surrogate measurement for the affinity of one or more antibodies for its target is its half maximal inhibitory concentration (IC50), a measure of how much of the antibody is needed to inhibit the binding of a known ligand to the antibody target by 50%. Affinity can be measured by common methods known in the art, including those described herein. Specific illustrative and exemplary embodiments for measuring binding affinity are described herein. The "blood-brain barrier" or "BBB" refers to the physiological barrier between the peripheral circulation and the brain and spinal cord (i.e., the CNS) which is formed by tight junctions within the brain capillary endothelial plasma membranes, creating a tight barrier that restricts the transport of molecules into the brain, even very small molecules such as urea (60 Daltons). The blood-brain barrier within the brain, the blood-spinal cord barrier within the spinal cord, and the blood-retinal barrier within the retina are contiguous capillary barriers within the CNS, and are herein collectively referred to a the blood-brain barrier or BBB. The BBB also encompasses the blood-CSF barrier (choroid plexus) where the barrier is comprised of ependymal cells rather than capillary endothelial cells.
[0099] The terms "amyloid beta," "beta-amyloid," "Abeta," "amyloidp," and "Αβ", used interchangeably herein, refer to the fragment of amyloid precursor protein ("APP") that is produced upon β-secretase 1 ("BACEl") cleavage of APP, as well as modifications, fragments and any functional equivalents thereof, including, but not limited to, Αβ1-40, and Αβ1-42. Αβ is known to exist in monomeric form, as well as to associate to form oligomers and fibril structures, which may be found as constituent members of amyloid plaque. The structure and sequences of such Αβ peptides are well known to one of ordinary skill in the art and methods of producing said peptides or of extracting them from brain and other tissues are described, for example, in Glenner and Wong, Biochem Biophys Res. Comm. 129: 885-890 (1984). Moreover, Αβ peptides are also commercially available in various forms.
[00100] "Anti-Abeta immunoglobulin," "anti-Abeta antibody," and "antibody that binds
Abeta" are used interchangeably herein, and refer to an antibody that specifically binds to human Abeta. A nonlimiting example of an anti-Abeta antibody is crenezumab. Other non-limiting examples of anti-Abeta antibodies are solanezumab, bapineuzumab, gantenerumab, aducanumab, ponezumab, and any anti-Abeta antibodies disclosed in the following publications:
WO2000162801, WO2002046237, WO2002003911, WO2003016466, WO2003016467,
WO2003077858, WO2004029629, WO2004032868, WO2004032868, WO2004108895,
WO2005028511, WO2006039470, WO2006036291, WO2006066089, WO2006066171,
WO2006066049, WO2006095041, WO2009027105.
[00101] The terms "crenezumab" and "MABT5102A" are used interchangeably herein, and refer to a specific anti-Abeta antibody that binds to monomeric, oligomeric, and fibril forms of Abeta, and which is associated with CAS registry number 1095207.
[00102] "Apolipoprotein E4 carrier" or "ApoE4 carrier," used interchangeably herein with
"apolipoprotein E4 positive" or "ApoE4 positive," refers to an individual having at least one apolipoprotein E4 (or "ApoE4") allele. An individual with zero ApoE4 alleles is referred to herein as being "ApoE4 negative" or an "ApoE4 non-carrier." See also Prekumar, et al., 1996, Am. J Pathol. 148:2083-95.
[00103] The term "cerebral vasogenic edema" refers to an excess accumulation of intravascular fluid or protein in the intracellular or extracellular spaces of the brain. Cerebral vasogenic edema is detectable by, e.g., brain MRI, including, but not limited to FLAIR MRI, and can be asymptomatic ("asymptomatic vasogenic edema") or associated with neurological symptoms, such as confusion, dizziness, vomiting, and lethargy ("symptomatic vasogenic edema") (see Sperling et al. Alzheimer's & Dementia, 7:367, 2011).
[00104] The term "cerebral macrohemorrhage" refers to an intracranial hemorrhage, or bleeding in the brain, of an area that is more than about 1 cm in diameter. Cerebral
macrohemorrhage is detectable by, e.g., brain MRI, including but not limited to T2*-weighted GRE MRI, and can be asymptomatic ("asymptomatic macrohemorrhage") or associated with symptoms such as transient or permanent focal motor or sensory impairment, ataxia, aphasia, and dysarthria ("symptomatic macrohemorrhage") (see, e.g., Chalela JA, Gomes J. Expert Rev.
Neurother. 2004 4:267, 2004 and Sperling et al. Alzheimer's & Dementia, 7:367, 2011).
[00105] The term "cerebral microhemorrhage" refers to an intracranial hemorrhage, or bleeding in the brain, of an area that is less than about 1 cm in diameter. Cerebral microhemorrhage is detectable by, e.g., brain MRI, including, but not limited to T2*-weighted GRE MRI, and can be asymptomatic ("asymptomatic microhemorrhage") or can potentially be associated with symptoms such as transient or permanent focal motor or sensory impairment, ataxia, aphasia, and dysarthria ("symptomatic microhemorrhage"). See, e.g., Greenberg, et al., 2009, Lancet Neurol. 8:165-74.
[00106] The term "sulcal effusion" refers to an effusion of fluid in the furrows, or sulci, of the brain. Sulcal effusions are detectable by, e.g., brain MRI, including but not limited to FLAIR MRI. See Sperling et al. Alzheimer's & Dementia, 7:367, 2011.
[00107] The term "superficial siderosis of the central nervous system" refers to bleeding or hemorrhage into the subarachnoid space of the brain and is detectable by, e.g., brain MRI, including but not limited to T2* -weighted GRE MRI. Symptoms indicative of superficial siderosis of the central nervous system include sensorineural deafness, cerebellar ataxia, and pyramidal signs. See Kumara-N, Am J Neuroradiol. 31 :5, 2010.
[00108] The term "amyloidosis," as used herein, refers to a group of diseases and disorders caused by or associated with amyloid or amyloid-like proteins and includes, but is not limited to, diseases and disorders caused by the presence or activity of amyloid-like proteins in monomeric, fibril, or polymeric state, or any combination of the three, including by amyloid plaques. Such diseases include, but are not limited to, secondary amyloidosis and age-related amyloidosis, such as diseases including, but not limited to, neurological disorders such as Alzheimer's Disease ("AD"), diseases or conditions characterized by a loss of cognitive memory capacity such as, for example, mild cognitive impairment (MCI), Lewy body dementia, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type), the Guam Parkinson-Demential complex and other diseases which are based on or associated with amyloid-like proteins such as progressive supranuclear palsy, multiple sclerosis, Creutzfeld Jacob disease, Parkinson's disease, HIV-related dementia, ALS (amyotropic lateral sclerosis), inclusion-body myositis (IBM), adult onset diabetes, endocrine tumor and senile cardiac amyloidosis, and various eye diseases including macular degeneration, drusen-related optic neuropathy, glaucoma, and cataract due to beta-amyloid deposition.
[00109] Glaucoma is a group of diseases of the optic nerve involving loss of retinal ganglion cells (RGCs) in a characteristic pattern of optic neuropathy. RGCs are the nerve cells that transmit visual signals from the eye to the brain. Caspase-3 and Caspase-8, two major enzymes in the apoptotic process, are activated in the process leading to apoptosis of RGCs. Caspase-3 cleaves amyloid precursor protein (APP) to produce neurotoxic fragments, including Abeta.
Without the protective effect of APP, Abeta accumulation in the retinal ganglion cell layer results in the death of RGCs and irreversible loss of vision.
[00110] Glaucoma is often, but not always, accompanied by an increased eye pressure, which may be a result of blockage of the circulation of aqueous, or its drainage. Although raised intraocular pressure is a significant risk factor for developing glaucoma, no threshold of intraocular pressure can be defined which would be determinative for causing glaucoma. The damage may also be caused by poor blood supply to the vital optic nerve fibers, a weakness in the structure of the nerve, and/or a problem in the health of the nerve fibers themselves. Untreated glaucoma leads to permanent damage of the optic nerve and resultant visual field loss, which can progress to blindness.
[00111] The term "mild Alzheimer's Disease" or "mild AD" as used herein (e.g., a "patient diagnosed with mild AD") refers to a stage of AD characterized by an MMSE score of 20 to 26.
[00112] The term "mild to moderate Alzheimer's Disease" or "mild to moderate AD" as used herein encompasses both mild and moderate AD, and is characterized by an MMSE score of 18 to 26.
[00113] The term "moderate Alzheimer's Disease" or "moderate AD" as used herein (e.g., a
"patient diagnosed with moderate AD") refers to a stage of AD characterized by an MMSE score of 18 to 19.
[00114] The "central nervous system" or "CNS" refers to the complex of nerve tissues that control bodily function, and includes the brain and spinal cord.
[00115] A "blood-brain barrier receptor" (abbreviated "BBB- " herein) is a transmembrane receptor protein expressed on brain endothelial cells which is capable of transporting molecules across the blood-brain barrier. Examples of BBB-R include, but are not limited to: transferrin receptor (TfR), insulin receptor, insulin-like growth factor receptor (IGF-R), low density lipoprotein receptors including without limitation low density lipoprotein receptor-related protein 1 (LRP1) and low density lipoprotein receptor-related protein 8 (LRP8), glucose transporter 1 (Glutl) and heparin-binding epidermal growth factor-like growth factor (HB-EGF). An exemplary BBB-R herein is transferrin receptor (TfR).
[00116] The term "transferrin receptor" or "TfR", as used herein, refers to any native TfR from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated. The term encompasses "full-length," unprocessed TfR as well as any form of TfR that results from processing in the cell. The term also encompasses naturally occurring variants of TfR, e.g., splice variants or allelic variants. TfR is a transmembrane glycoprotein (with a molecular weight of about 180,000) composed of two disulphide-bonded sub- units (each of apparent molecular weight of about 90,000) involved in iron uptake in vertebrates. In some embodiments, the TfR herein is human TfR ("hTfR") comprising the amino acid sequence as set forth in Schneider et al. Nature 311 : 675 - 678 (1984), for example (SEQ ID NO: 1). In another embodiment, the TfR herein is primate TfR ("pTfR") comprising the amino acid sequence as set forth in Genbank reference AFDl 8260.1 (SEQ ID NO: 2). For comparison, the mouse TfR sequence may be found in Genbank reference AAH54522.1 (SEQ ID NO: 3).
[00117] A "neurological disorder" as used herein refers to a disease or disorder which affects the CNS and/or which has an etiology in the CNS. Exemplary CNS diseases or disorders include, but are not limited to, neuropathy, amyloidosis, cancer, an ocular disease or disorder, viral or microbial infection, inflammation, ischemia, neurodegenerative disease, seizure, behavioral disorders, and a lysosomal storage disease. For the purposes of this application, the CNS will be understood to include the eye, which is normally sequestered from the rest of the body by the blood-retina barrier. Specific examples of neurological disorders include, but are not limited to, neurodegenerative diseases (including, but not limited to, Lewy body disease, postpoliomyelitis syndrome, Shy-Draeger syndrome, olivopontocerebellar atrophy, Parkinson's disease, multiple system atrophy, striatonigral degeneration, tauopathies (including, but not limited to, Alzheimer disease and supranuclear palsy), prion diseases (including, but not limited to, bovine spongiform encephalopathy, scrapie, Creutzfeldt- Jakob syndrome, kuru, Gerstmann-Straussler-Scheinker disease, chronic wasting disease, and fatal familial insomnia), bulbar palsy, motor neuron disease, and nervous system heterodegenerative disorders (including, but not limited to, Canavan disease, Huntington's disease, neuronal ceroid-lipofuscinosis, Alexander's disease, Tourette's syndrome, Menkes kinky hair syndrome, Cockayne syndrome, Halervorden-Spatz syndrome, lafora disease, Rett syndrome, hepatolenticular degeneration, Lesch-Nyhan syndrome, and Unverricht-Lundborg syndrome), dementia (including, but not limited to, Pick's disease, and spinocerebellar ataxia), cancer (e.g. of the CNS, including brain metastases resulting from cancer elsewhere in the body).
[00118] A "neurological disorder drug" is a drug or therapeutic agent that treats one or more neurological disorder(s). Neurological disorder drugs of the invention include, but are not limited to, antibodies, peptides, proteins, natural ligands of one or more CNS target(s), modified versions of natural ligands of one or more CNS target(s), aptamers, inhibitory nucleic acids (i.e., small inhibitory RNAs (siRNA) and short hairpin RNAs (shRNA)), ribozymes, and small molecules, or active fragments of any of the foregoing. Exemplary neurological disorder drugs of the invention are described herein and include, but are not limited to: antibodies, aptamers, proteins, peptides, inhibitory nucleic acids and small molecules and active fragments of any of the foregoing that either are themselves or specifically recognize and/or act upon (i.e., inhibit, activate, or detect) a CNS antigen or target molecule such as, but not limited to, amyloid precursor protein or portions thereof, amyloid beta, beta-secretase, gamma-secretase, tau, alpha-synuclein, parkin, huntingtin, DR6, presenilin, ApoE, glioma or other CNS cancer markers, and neurotrophins. Non-limiting examples of neurological disorder drugs and the disorders they may be used to treat are provided in the following Table A: TABLE A: Non-limiting examples of neurological disorder drugs and the corresponding disorders they may be used to treat
Figure imgf000035_0001
[00119] An "imaging agent" is a compound that has one or more properties that permit its presence and/or location to be detected directly or indirectly. Examples of such imaging agents include proteins and small molecule compounds incorporating a labeled moiety that permits detection.
[00120] A "CNS antigen" or "brain antigen" is an antigen expressed in the CNS, including the brain, which can be targeted with an antibody or small molecule. Examples of such antigens include, without limitation: beta-secretase 1 (BACE1), amyloid beta (Abeta), epidermal growth factor receptor (EGFR), human epidermal growth factor receptor 2 (HER2), tau, apolipoprotein E4 (ApoE4), alpha-synuclein, CD20, huntingtin, prion protein (PrP), leucine rich repeat kinase 2 (LRRK2), parkin, presenilin 1 , presenilin 2, gamma secretase, death receptor 6 (DR6), amyloid precursor protein (APP), p75 neurotrophin receptor (p75NTR), interleukin 6 receptor (IL6R), TNF receptor 1 (TNFRl), interleukin 1 beta (ILip), and caspase 6. In some embodiments, the antigen is BACE1. [00121] The term "BACEl," as used herein, refers to any native beta-secretase 1 (also called β- site amyloid precursor protein cleaving enzyme 1, membrane-associated aspartic protease 2, memapsin 2, aspartyl protease 2 or Asp2) from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g. , mice and rats), unless otherwise indicated. The term encompasses "full-length," unprocessed BACEl as well as any form of BACEl which results from processing in the cell. The term also encompasses naturally occurring variants of BACEl, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary BACEl polypeptide is shown in SEQ ID NO: 147 below, and is the sequence for human BACEl, isoform A as reported in Vassar et ah, Science 286:735-741 (1999), which is incorporated herein by reference in its entirety.
MAQALPWLLLWMGAGVLPAHGTQHGIRLPL SGLGGAPLGLRLPRETDEEPEEP GRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHP FLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIA AITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCG AGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQD LKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQ LVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYK FAISQSSTGTVMGAVIMEGFYWFDRARKRIGFAVSACHVHDEFRTAAVEGPFV TLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWCCLRCLRQQ HDDFADDISLLK (SEQ ID NO:147)
[00122] Several other isoforms of human BACEl exist including isoforms B, C and D. See UniProtKB/Swiss-Prot Entry P56817, which is incorporated herein by reference in its entirety. Isoform B is shown in SEQ ID NO: 148 and differs from isoform A (SEQ ID NO: 147) in that it is missing amino acids 190-214 (i.e. deletion of amino acids 190-214 of SEQ ID NO:147). Isoform C is shown in SEQ ID NO: 149 and differs from isoform A (SEQ ID NO:147) in that it is missing amino acids 146-189 (i.e. deletion of amino acids 146-189 of (SEQ ID NO: 147). Isoform D is shown in SEQ ID NO: 150 and differs from isoform A (SEQ ID NO:147) in that it is missing amino acids 146-189 and 190-214 (i.e. deletion of amino acids 146-189 and 190-214 of SEQ ID NO: 147).
[00123] The terms "anti-beta-secretase antibody", "anti-BACEl antibody", "an antibody that binds to beta-secretase" and "an antibody that binds to BACEl" refer to an antibody that is capable of binding BACEl with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting BACEl. In some embodiments, the extent of binding of an anti- BACEl antibody to an unrelated, non-BACEl protein is less than about 10% of the binding of the antibody to BACEl as measured, e.g., by a radioimmunoassay (RIA). In certain embodiments, an antibody that binds to BACEl has a dissociation constant (Kd) of < Ι μΜ, < 100 nM, < 10 nM, < 1 nM, < 0.1 nM, < 0.01 nM, or < 0.001 nM (e.g. 10"8 M or less, e.g. from 10"8 M to 10"13 M, e.g., from 10"9 M to 10"13 M). In certain embodiments, an anti-BACEl antibody binds to an epitope of BACE1 that is conserved among BACE1 from different species and isoforms.
[00124] In some embodiments, an antibody is provided that binds to the epitope on BACE1 bound by anti-BACEl antibody YW 412.8.31. In other embodiments, an antibody is provided that binds to an exosite within BACE1 located in the catalytic domain of BACE1. In some embodiments an antibody is provided that competes with the peptides identified in Kornacker et al., Biochem. 44: 11567-11573 (2005), which is incorporated herein by reference in its entirety, (i.e., Peptides 1, 2, 3, 1-11, 1-10, 1-9, 1-8, 1-7, 1-6, 2-12, 3-12, 4-12, 5-12, 6-12, 7-12, 8-12, 9-12, 10-12, 4, 5, 6, 5-10, 5-9, scrambled, Y5A, P6A, Y7A, F8A, I9A, P10A and LI 1A) for binding to BACE1. Exemplary BACE1 antibody sequences are depicted in Figs. 23 to 26, 38, and 39. One exemplary antibody herein comprises the variable domains of the antibody YW412.8.31 (e.g. as in Figs. 15A-B).
[00125] A "native sequence" protein herein refers to a protein comprising the amino acid sequence of a protein found in nature, including naturally occurring variants of the protein. The term as used herein includes the protein as isolated from a natural source thereof or as
recombinantly produced.
[00126] The term "antibody" herein is used in the broadest sense and encompasses various antibody stuctures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
[00127] An "antibody fragment" refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Examples of antibody fragments are well known in the art (see, e.g., Nelson, MAbs (2010) 2(1): 77-83) and include but are not limited to Fab, Fab', Fab'-SH, F(ab')2, and Fv; diabodies; linear antibodies; single-chain antibody molecules including but not limited to single-chain variable fragments (scFv), fusions of light and/or heavy-chain antigen-binding domains with or without a linker (and optionally in tandem); and monospecific or multispecific antigen-binding molecules formed from antibody fragments (including, but not limited to multispecific antibodies constructed from multiple variable domains which lack Fc regions).
[00128] The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants, e.g., containing naturally occurring mutations or that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on the antigen. The modifier "monoclonal" indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method (see, e.g., Kohler et al, Nature, 256:495 (1975)), recombinant DNA methods (see, e.g., U.S. Patent No. 4,816,567), phage-display methods (e.g., using the techniques described in Clackson et al, Nature, 352:624-628 (1991) and Marks et al, J. Mol. Biol, 222:581-597 (1991)), and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein. Specific examples of monoclonal antibodies herein include chimeric antibodies, humanized antibodies, and human antibodies, including antigen-binding fragments thereof.
[00129] The monoclonal antibodies herein specifically include "chimeric" antibodies
(immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; Morrison et al, Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)).
[00130] An "acceptor human framework" for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework "derived from" a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
[00131] A "human consensus framework" is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences. Generally, the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences. Generally, the subgroup of sequences is a subgroup as in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91- 3242, Bethesda MD (1991), vols. 1-3. In some embodiments, for the VL, the subgroup is subgroup kappa I as in Kabat et al supra. In some embodiments, for the VH, the subgroup is subgroup III as in Kabat et al supra.
[00132] "Humanized" forms of non-human {e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human antibodies. For the most part, humanized antibodies are human antibodies (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. For example, in certain embodiments, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CD s) correspond to those of a non-human antibody, and all or substantially all of the framework regions (FRs) correspond to those of a human antibody. In some instances, FR residues of the human immunoglobulin are replaced by corresponding non-human residues.
Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In certain embodiments, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human antibody and all or substantially all of the FRs are those of a human antibody, except for FR substitution(s) as noted above. The humanized antibody optionally also will comprise at least a portion of an antibody constant region, typically that of a human antibody. A "humanized form" of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization. For further details, see Jones et al, Nature 321 :522- 525 (1986); Riechmann et al, Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
[00133] A "human antibody" herein is an antibody comprising an amino acid sequence structure that corresponds with the amino acid sequence structure of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues. Such antibodies can be identified or made by a variety of techniques, including, but not limited to:
production by transgenic animals {e.g., mice) that are capable, upon immunization, of producing human antibodies in the absence of endogenous immunoglobulin production (see, e.g., Jakobovits et al, Proc. Natl. Acad. Sci. USA, 90:2551 (1993); Jakobovits et al, Nature, 362:255-258 (1993); Bruggermann et al, Year in Immuno., 7:33 (1993); and US Patent Nos. 5,591,669, 5,589,369 and 5,545,807)); selection from phage display libraries expressing human antibodies or human antibody fragments (see, for example, McCafferty et al, Nature 348:552-553 (1990); Johnson et al, Current Opinion in Structural Biology 3:564-571 (1993); Clackson et al, Nature, 352:624-628 (1991); Marks et al, J. Mol. Biol. 222:581-597 (1991); Griffith et al, EMBO J. 12:725-734 (1993);US Patent Nos. 5,565,332 and 5,573,905); generation via in vitro activated B cells (see US Patents 5,567,610 and 5,229,275); and isolation from human antibody-producing hybridomas.
[00134] The term "multispecific antibody" is used in the broadest sense and specifically covers an antibody comprising an antigen-binding domain that has polyepitopic specificity (i.e., is capable of specifically binding to two, or more, different epitopes on one biological molecule or is capable of specifically binding to epitopes on two, or more, different biological molecules). In some embodiments, an antigen-binding domain of a multispecific antibody (such as a bispecific antibody) comprises two VH/VL units, wherein a first VH/VL unit specifically binds to a first epitope and a second VH/VL unit specifically binds to a second epitope, wherein each VH/VL unit comprises a heavy chain variable domain (VH) and a light chain variable domain (VL). Exemplary multispecific antibodies may bind both a Tf and a brain antigen. In some embodiments, a multispecific antibody binds Tf and BACE1 ("anti-TfR/BACEl antibody"). Such multispecific antibodies include, but are not limited to, full length antibodies, antibodies having two or more VL and VH domains, antibody fragments such as Fab, Fv, dsFv, scFv, diabodies, bispecific diabodies and triabodies, antibody fragments that have been linked covalently or non-covalently. A VH/VL unit that further comprises at least a portion of a heavy chain variable region and/or at least a portion of a light chain variable region may also be referred to as An "arm" or "hemimer" or "half antibody." In some embodiments, a hemimer comprises a sufficient portion of a heavy chain variable region to allow intramolecular disulfide bonds to be formed with a second hemimer. In some embodiments, a hemimer comprises a knob mutation or a hole mutation, for example, to allow heterodimerization with a second hemimer or half antibody that comprises a complementary hole mutation or knob mutation. Knob mutations and hole mutations are discussed further below.
[00135] A "bispecific antibody" is a multispecific antibody comprising an antigen-binding domain that is capable of specifically binding to two different epitopes on one biological molecule or is capable of specifically binding to epitopes on two different biological molecules. A bispecific antibody may also be referred to herein as having "dual specificity" or as being "dual specific."
[00136] The term "knob-into-hole" or "KnH" technology as used herein refers to the technology directing the pairing of two polypeptides together in vitro or in vivo by introducing a protuberance (knob) into one polypeptide and a cavity (hole) into the other polypeptide at an interface in which they interact. For example, KnHs have been introduced in the Fc:Fc binding interfaces, CL:CH1 interfaces or VH/VL interfaces of antibodies (see, e.g., US 2011/0287009, US2007/0178552, WO 96/02701 1, WO 98/050431, and Zhu et al., 1997, Protein Science 6:781 - 788). In some embodiments, KnHs drive the pairing of two different heavy chains together during the manufacture of multispecific antibodies. For example, multispecific antibodies having KnH in their Fc regions can further comprise single variable domains linked to each Fc region, or further comprise different heavy chain variable domains that pair with similar or different light chain variable domains. KnH technology can be also be used to pair two different receptor extracellular domains together or any other polypeptide sequences that comprises different target recognition sequences (e.g., including affibodies, peptibodies and other Fc fusions).
[00137] The term "knob mutation" as used herein refers to a mutation that introduces a protuberance (knob) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide. In some embodiments, the other polypeptide has a hole mutation.
[00138] The term "hole mutation" as used herein refers to a mutation that introduces a cavity (hole) into a polypeptide at an interface in which the polypeptide interacts with another polypeptide. In some embodiments, the other polypeptide has a knob mutation.
[00139] Antibodies herein include "amino acid sequence variants" with altered antigen-binding or biological activity. Examples of such amino acid alterations include antibodies with enhanced affinity for antigen (e.g. "affinity matured" antibodies), and antibodies with altered Fc region, if present, e.g. with altered (increased or diminished) antibody dependent cellular cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) (see, for example, WO 00/42072, Presta, L. and WO 99/51642, Iduosogie et al.); and/or increased or diminished serum half-life (see, for example, WO00/42072, Presta, L.).
[00140] An "affinity modified variant" has one or more substituted hypervariable region or framework residues of a parent antibody (e.g. of a parent chimeric, humanized, or human antibody) that alter (increase or reduce) affinity. A convenient way for generating such substitutional variants uses phage display. Briefly, several hypervariable region sites (e.g. 6-7 sites) are mutated to generate all possible amino substitutions at each site. The antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of Ml 3 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g. binding affinity). In order to identify candidate hypervariable region sites for modification, alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding. Alternatively, or additionally, it may be beneficial to analyze a crystal structure of the antigen-antibody complex to identify contact points between the antibody and its target. Such contact residues and neighboring residues are candidates for substitution according to the techniques elaborated herein. Once such variants are generated, the panel of variants is subjected to screening and antibodies with altered affinity may be selected for further development.
[00141] A "pH-sensitive antibody variant" is an antibody variant which has a different binding binding affinity for a target antigen at a first pH than it does for that target antigen at a different pH. As a nonlimiting example, an anti-TfR/BACEl antibody of the invention may be selected for or engineered to have pH-sensitive binding to Tf such that it binds with desirably low affinity (as described herein) to cell surface Tf in the plasma at pH 7.4, but upon internalization into an endosomal compartment, rapidly dissociates from TfR at the relatively lower pH (pH 5.5-6.0); such dissociation may protect the antibody from antigen-mediated clearance, and increase the amount of antibody that is either delivered to the CNS or recycled back across the BBB - in either case, the effective concentration of the antibody is increased relative to an anti-TfR antibody that does not comprise such pH sensitivity (see, e.g., Chaparro-Riggers et al. J. Biol. Chem. 287(14): 11090-11097; Igawa et al., Nature Biotechnol. 28(11): 1203-1208). The desired combination of affinities at the serum pH and the endosomal compartment pH can be readily determined for a TfR and conjugated compound by one of ordinary skill in the art.
[00142] The antibody herein may be conjugated with a "heterologous molecule" for example to increase half-life or stability or otherwise improve the antibody. For example, the antibody may be linked to one of a variety of non-proteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, polyoxyalkylenes, or copolymers of polyethylene glycol and polypropylene glycol. Antibody fragments, such as Fab', linked to one or more PEG molecules are an exemplary embodiment of the invention. In another example, the heterologous molecule is a therapeutic compound or a visualization agent (ie., a detectable label), and the antibody is being used to transport such heterologous molecule across the BBB. Examples of heterologous molecules include, but are not limited to, a chemical compound, a peptide, a polymer, a lipid, a nucleic acid, and a protein.
[00143] The antibody herein may be a "glycosylation variant" such that any carbohydrate attached to the Fc region, if present, is altered, either modified in presence/absence, or modified in type. For example, antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 (Presta, L.). See also US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Antibodies with a bisecting N- acetylglucosamine (GlcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in WO 2003/011878, Jean-Mairet et al. and US Patent No. 6,602,684, Umana et al. Antibodies with at least one galactose residue in the oligosaccharide attached to an Fc region of the antibody are reported in WO 1997/30087, Patel et al. See, also, WO 1998/58964 (Raju, S.) and WO 1999/22764 (Raju, S.) concerning antibodies with altered carbohydrate attached to the Fc region thereof. See also US 2005/0123546 (Umana et al.) describing antibodies with modified glycosylation. Mutation of the consensus glycosylation sequence in the Fc region (Asn-X-Ser/Thr at positions 297-299, where X cannot be proline), for example by mutating the Asn of this sequence to any other amino acid, by placing a Pro at position 298, or by modifying position 299 to any amino acid other than Ser or Thr should abrogate glycosylation at that position (see, e.g., Fares Al-Ejeh et al., Clin. Cancer Res. (2007) 13:5519s-5527s; Imperiali and Shannon, Biochemistry (1991) 30(18): 4374-4380; Katsuri, Biochem J. (1997) 323(Pt 2): 415-419; Shakin-Eshleman et al., J. Biol. Chem. (1996) 271 : 6363-6366).
[00144] The term "hypervariable region" or "HVR" as used herein refers to each of the regions of an antibody variable domain which are hypervariable in sequence ("complementarity determining regions" or "CDRs") and/or form structurally defined loops ("hypervariable loops") and/or contain the antigen-contacting residues ("antigen contact"). Generally, antibodies comprise six HVRs: three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3). Exemplary HVRs herein include:
(a) hypervariable loops occurring at amino acid residues 26-32 (LI), 50-52 (L2), 91-96 (L3), 26-32 (HI), 53-55 (H2), and 96-101 (H3) (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987));
(b) CDRs occurring at amino acid residues 24-34 (LI), 50-56 (L2), 89-97 (L3), 31-35b (HI), 50-65 (H2), and 95-102 (H3) (Kabat et al Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991));
(c) antigen contacts occurring at amino acid residues 27c-36 (LI), 46-55 (L2), 89-96 (L3), 30-35b (HI), 47-58 (H2), and 93-101 (H3) (MacCallum et al. J. Mol. Biol. 262: 732-745 (1996)); and
(d) combinations of (a), (b), and/or (c), including HVR amino acid residues 46-56 (L2), 47- 56 (L2), 48-56 (L2), 49-56 (L2), 26-35 (HI), 26-35b (HI), 49-65 (H2), 93-102 (H3), and 94-102 (H3).
[00145] In some embodiments, HVR residues comprise those identified in Figures 3 and 4 and Tables 3 and 4, or elsewhere in the specification.
[00146] Unless otherwise indicated, HVR residues and other residues in the variable domain (e.g., FR residues) are numbered herein according to Kabat et al., supra.
[00147] "Framework" or "FR" residues are those variable domain residues other than the hypervariable region residues as herein defined. The FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3 and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-H2(L2)-FR3-H3(L3)-FR4. In certain embodiments, one or more FR residue may be modified to modulate the stability of the antibody or to modulate the three-dimensional positioning of one or more HV of the antibody to, e.g., enhance binding.
[00148] A "full length antibody" is one which comprises an antigen-binding variable region as well as a light chain constant domain (CL) and heavy chain constant domains, CHI, CH2 and CH3. The constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variants thereof.
[00149] The terms "full length antibody," "intact antibody," and "whole antibody" are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
[00150] A "naked antibody" refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety or radiolabel). The naked antibody may be present in a pharmaceutical formulation.
[00151] "Native antibodies" refer to naturally occurring immunoglobulin molecules with varying structures. For example, native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2 and CH3). Similarly, from N- to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain. The light chain of an antibody may be assigned to one of two types, called kappa (κ) and lambda (λ), based on the amino acid sequence of its constant domain.
[00152] Antibody "effector functions" refer to those biological activities of an antibody that result in activation of the immune system other than activation of the complement pathway. Such activities are largely found in the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include, for example, Fc receptor binding and antibody-dependent cell-mediated cytotoxicity (ADCC). In some embodiments, the antibody herein essentially lacks effector function. In another embodiment, the antibody herein retains minimal effector function. Methods of modifying or eliminating effector function are well-known in the art and include, but are not limited to, eliminating all or a portion of the Fc region responsible for the effector function (ie, using an antibody or antibody fragment in a format lacking all or a portion of the Fc region such as, but not limited to, a Fab fragment, a single- chain antibody, and the like as described herein and as known in the art; modifying the Fc region at one or more amino acid positions to eliminate effector function (Fc binding-impacting: positions 238, 239, 248, 249, 252, 254, 256, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 297, 298, 301, 303, 311, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 436, 437, 438, and 439; and modifying the glycosylation of the antibody (including, but not limited to, producing the antibody in an environment that does not permit wild-type mammalian glycosylation, removing one or more carbohydrate groups from an already- glycosylated antibody, and modifying the antibody at one or more amino acid positions to eliminate the ability of the antibody to be glycosylated at those positions (including, but not limited to N297G and N297A and D265A).
[00153] Antibody "complement activation" functions, or properties of an antibody that enable or trigger "activation of the complement pathway" are used interchangeably, and refer to those biological activities of an antibody that engage or stimulate the complement pathway of the immune system in a subject. Such activities include, e.g., Clq binding and complement dependent cytotoxicity (CDC), and may be mediated by both the Fc portion and the non-Fc portion of the antibody. Methods of modifying or eliminating complement activation function are well-known in the art and include, but are not limited to, eliminating all or a portion of the Fc region responsible for complement activation (ie., using an antibody or antibody fragment in a format lacking all or a portion of the Fc region such as, but not limited to, a Fab fragment, a single-chain antibody, and the like as described herein and as known in the art, or modifying the Fc region at one or more amino acid positions to eliminate or lessen interactions with complement components or the ability to activate complement components, such as positions 270, 322, 329 and 321, known to be involved in Clq binding), and modifying or eliminating a portion of the non-Fc region responsible for complement activation (ie, modifying the CHI region at position 132 (see, e.g., Vidarte et al., (2001) J. Biol. Chem. 276(41): 38217-38223)).
[00154] Depending on the amino acid sequence of the constant domain of their heavy chains, full length antibodies can be assigned to different "classes". There are five major classes of full length antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into "subclasses" (isotypes), e.g., IgGl, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known in the art.
[00155] The term "recombinant antibody", as used herein, refers to an antibody (e.g. a chimeric, humanized, or human antibody or antigen-binding fragment thereof) that is expressed by a recombinant host cell comprising nucleic acid encoding the antibody.
[00156] The terms "host cell," "host cell line," and "host cell culture" are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include "transformants" and "transformed cells," which include the primary transformed cells and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein. Examples of "host cells" for producing recombinant antibodies include: (1) mammalian cells, for example, Chinese Hamster Ovary (CHO), COS, myeloma cells (including Y0 and NSO cells), baby hamster kidney (BHK), Hela and Vero cells; (2) insect cells, for example, sf9, sf21 and Tn5; (3) plant cells, for example plants belonging to the genus Nicotiana (e.g. Nicotiana tabacum); (4) yeast cells, for example, those belonging to the genus Saccharomyces (e.g. Saccharomyces cerevisiae) or the genus Aspergillus (e.g. Aspergillus niger); (5) bacterial cells, for example Escherichia coli cells or Bacillus subtilis cells, etc.
[00157] As used herein, "specifically binding" or "binds specifically to" refers to an antibody selectively or preferentially binding to an antigen. The binding affinity is generally determined using a standard assay, such as Scatchard analysis, or surface plasmon resonance technique (e.g. using BIACORE®).
[00158] An "antibody that binds to the same epitope" as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more. In some embodiments, an anti-BACEl antibody forming one of the bispecific or multispecific antibodies of the invention binds to the BACEl epitope bound by antibody 6266. An exemplary competition assay is provided herein.
[00159] The term "cytotoxic agent" as used herein refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction. Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At211, 1131, 1125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof; and the various antitumor or anticancer agents disclosed herein.
[00160] An "effective amount" of an agent, e.g., a pharmaceutical formulation, refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
[00161] The term "Fc region" herein is used to define a C-terminal region of an
immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. In some embodiments, a human IgG heavy chain Fc region extends from Cys226, or from Pro230, to the carboxyl-terminus of the heavy chain. However, the C-terminal lysine (Lys447) of the Fc region may or may not be present. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
[00162] The term "FcRn receptor" or "FcRn" as used herein refers to an Fc receptor ("n" indicates neonatal) which is known to be involved in transfer of maternal IgGs to a fetus through the human or primate placenta, or yolk sac (rabbits) and to a neonate from the colostrum through the small intestine. It is also known that FcRn is involved in the maintenance of constant serum IgG levels by binding the IgG molecules and recycling them into the serum. "FcRn binding region" or "FcRn receptor binding region" refers to that portion an an antibody which interacts with the FcRn receptor. Certain modifications in the FcRn binding region of an antibody increase the affinity of the antibody or fragment thereof, for the FcRn, and also increase the in vivo half-life of the molecule. Amino acid substitutions in one or more of the following amino acid positions 251 256, 285, 290, 308, 314, 385, 389, 428, 434 and 436 increases the interaction of the antibody with the FcRn receptor. Substitutions at the following positions also increases the interaction of an antibody with the FcRn receptor 238, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of (US Patent No. 7,371,826).
[00163] An "immunoconjugate" is an antibody conjugated to one or more heterologous molecule(s), including but not limited to a label or cytotoxic agent. Optionally such conjugation is via a linker.
[00164] A "linker" as used herein is a structure that covalently or non-covalently connects an antibody to heterologous molecule. In certain embodiments, a linker is a peptide. In other embodiments, a linker is a chemical linker.
[00165] A "label" is a marker coupled with the antibody herein and used for detection or imaging. Examples of such labels include: radiolabel, a fluorophore, a chromophore, or an affinity tag. In some embodiments, the label is a radiolabel used for medical imaging, for example tc99m or 1123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine- 123 again, iodine-131, indium- 111, fluorine- 19, carbon- 13, nitrogen- 15, oxygen- 17, gadolinium, manganese, iron, etc.
[00166] An "individual" or "subject" is a mammal. Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non- human primates such as monkeys), rabbits, and rodents (e.g., mice and rats). In certain embodiments, the individual or subject is a human. [00167] An "isolated" antibody is one which has been separated from a component of its natural environment. In some embodiments, an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC) methods. For review of methods for assessment of antibody purity, see, e.g., Flatman et al., J. Chromatogr. B 848:79-87 (2007).
[00168] An "isolated nucleic acid" refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[00169] "Isolated nucleic acid encoding an antibody" refers to one ormore nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
[00170] The term "package insert" is used to refer to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
[00171] "Percent (%) amino acid sequence identity" with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTA ) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
[00172] In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
100 times the fraction X/Y
where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
[00173] The term "pharmaceutical formulation" refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
[00174] A "pharmaceutically acceptable carrier" refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject., A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
[00175] As used herein, "treatment" (and grammatical variations thereof such as "treat" or "treating") refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. In some embodiments, antibodies of the invention are used to delay development of a disease or to slow the progression of a disease.
[00176] The term "variable region" or "variable domain" refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HV s). (See, e.g., Kindt et al. Kuby Immunology, 6 ed., W.H. Freeman and Co., page 91 (2007).) A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
[00177] The term "vector," as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self- replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as
"expression vectors."
II. COMPOSITIONS AND METHODS
A. Production of Anti-TfR/BACEl Antibodies and Conjugates Thereof
[00178] In some aspects, the invention is based, in part, on anti-TfR antibodies that can be used to transport desired molecules across the BBB. In some such embodiments, an anti-TfR/BACEl antibody is provided. In certain embodiments, antibodies that bind to human TfR are provided. In certain embodiments, antibodies that bind to both human TfR and primate TfR are provided.
Antibodies of the invention are useful, e.g., for the diagnosis or treatment of diseases affecting the brain and/or CNS.
A. Exemplary Anti-TfR Antibodies
[00179] In some aspects, the invention provides isolated multispecific antibodies that bind to TfR and BACE1. In certain embodiments, an anti-TfR arm of the multispecific antibody of the invention binds specifically to both human TfR and primate TfR. In certain such embodiments, the anti-TfR arm of the multispecific antibody of the invention does not inhibit binding of transferrin to the TfR. In certain such embodiments, the anti-TfR arm of the multispecific antibody of the invention binds to an apical domain of TfR. In other certain such embodiments, the anti-TfR arm of the multispecific antibody of the invention binds to a non-apical domain of TfR. In certain aspects, the anti-TfR arm of the multispecific antibody may be used to transport one or more conjugated imaging or therapeutic compounds across the BBB, such as the anti-BACEl antibody that forms a second arm of the multispecific antibody.
[00180] In some aspects, the invention provides a multispecific antibody comprising an anti- TfR antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR- Hl comprising the amino acid sequence of SEQ ID NO:32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:33; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:29; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:31. In some aspects, the antibody comprises all six of the above- recited HVR sequences. In another aspect, the anti-TfR arm of the multispecific antibody is clone 7A4, as shown in Figure 3 A and Table 3.
[00181] In some aspects, the invention provides a multispecific antibody comprising an anti- TfR antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR- Hl comprising the amino acid sequence of SEQ ID NO:37; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:38; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:39; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:35; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:36. In some aspects, the anti-TfR arm of the multispecific antibody comprises all six of the above-recited HVR sequences. In another aspect, the antibody is clone 8A2, as shown in Figure 3 A and Table 3.
[00182] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:40; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 35; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 36. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 15D2, as shown in Figure 3 A and Table 3.
[00183] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 37; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 43; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 44; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 41 ; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 42. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 10D11, as shown in Figure 3 A and Table 3.
[00184] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 33; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 29; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:31. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 7B10, as shown in Figure 3 A and Table 3.
[00185] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:54; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:55; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:50; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:51 ; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:52. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 15G11, as shown in Figure 3B and Table 3.
[00186] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:58; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:59; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:56; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:57; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:52. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 16G5, as shown in Figure 3B and Table 3.
[00187] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:63; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:55; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:60; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:61 ; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:62. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 13C3, as shown in Figure 3B and Table 3. [00188] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:65; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:55; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:60; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:64; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:52. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 16G4, as shown in Figure 3B and Table 3.
[00189] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:74; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:75; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:76; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:71 ; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:72; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:73. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 16F6, as shown in Figure 3C and Table 3.
[00190] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:80; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:81 ; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:82; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:77; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:78; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:79. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 7G7, as shown in Figure 3D and Table 3.
In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 80; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 83; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:84; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:77; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:78; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:79. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 4C2, as shown in Figure 3D and Table 3.
[00191] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:88; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:89; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:90; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:85; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:86; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:87. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone IB 12, as shown in Figure 3D and Table 3.
[00192] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:94; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:95; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:96; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:91 ; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:92; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:93. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 13D4, as shown in Figure 3D and Table 3.
In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:32; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:33; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:34; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:29; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:127. In some aspects, the antibody comprises all six of the above-recited HVR sequences. In another aspect, the anti-TfR arm is clone 7A4.vl5, as shown in Figure 4B and Table 4.
[00193] The clones above fall into four complementation groups, with sequence similarity within the HVRs. As shown in Table 3, consensus sequences are readily derivable from the provided antibody sequences for each HVR. As one nonlimiting example, the class I antibody consensus HVRs are as follows:
HVR-Ll : Arg-Ala-Ser-Glu-Ser-Val-Asp-[Ser or Asp]-Tyr-Gly-[Asn or Pro]-Ser-Phe-Met- His (SEQ ID NO: 45); HVR-L2: Arg-Ala-Ser-Asn-Leu-Glu-Ser (SEQ ID NO: 30);
HVR-L3: Gln-[Gln or His]-Ser-Asn-Glu-[Ala, Gly or Asp]-Pro-Pro-Thr (SEQ ID NO: 46); HVR-H1 : Asp-Tyr-[Ala or Gly]-Met-His (SEQ ID NO: 47);
HVR-H2: [Gly or Val]-Ile-Ser-[Thr, Phe or Pro]-Tyr-[Phe or Ser]-Gly-[Arg or Lys]-Thr- Asn-Tyr-[Asn or Ser]-Gln-[Lys or Asn]-Phe-[Lys or Met]-Gly (SEQ ID NO: 48);
HVR-H3: Gly-Leu-Ser-Gly-Asn-[Tyr or Phe]-Val-[Met or Val]-Asp-[Tyr or Phe] (SEQ ID NO: 49). (see Table 3). The consensus sequences for class II and IV are also provided in Table 3.
[00194] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:47; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:48; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:49; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:45; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:30; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:46. In some aspects, the antibody comprises all six of the above-recited HVR sequences.
[00195] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO:53; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO:69; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO:70; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:66; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:67; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:68. In some aspects, the antibody comprises all six of the above-recited HVR sequences.
[00196] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising an anti-TfR arm comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 100; (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 101 ; (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 102; (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO:97; (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO:98; and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO:99. In some aspects, the antibody comprises all six of the above-recited HVR sequences.
[00197] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising at least one, at least two, or all three VH HVR sequences of any of the antibodies described above. In some embodiments, the antibody comprises the HVR-H3 sequence of any one of the antibodies described above. In another embodiment, the antibody comprises the HVR-H3 and HVR-L3 sequences of any one of the antibodies described above. In a further embodiment, the antibody comprises the HVR-H3, HVR-L3 and HVR-H2 sequences of any one of the antibodies described above. In another embodiment, the antibody comprises the HVR-H1, HVR- H2 and HVR-H3 sequences of any one of the antibodies described above. In another aspect, the invention provides an antibody comprising at least one, at least two or all three VL HVR sequences of any of the antibodies described above. In some embodiments, the antibody comprises the HVR- Ll, HVR-L2, and HVR-L3 sequences of any one of the antibodies described above.
[00198] In another aspect, a multispecific antibody of the invention comprises (a) a VH domain comprising at least one, at least two, or all three VH HVR sequences selected from the HVR-H1, HVR-H2, and HVR-H3 sequences of any one of the antibodies described above; and (b) a VL domain comprising at least one, at least two, or all three VL HVR sequences selected from the HVR-Ll, HVR-L2 and HVR-L3 sequences of any one of the antibodies described above.
[00199] In any of the above embodiments, an anti-TfR arm of a multispecific antibody is humanized. In some embodiments, an anti-TfR arm of a multispecific antibody comprises HVRs as in any of the above embodiments, and further comprises an acceptor human framework, e.g. a human immunoglobulin framework or a human consensus framework. In another embodiment, an anti-TfR arm of a multispecific antibody comprises HVRs as in any of the above embodiments, and further comprises a VH or VL comprising one or more amino acid substitutions in one or more FR regions. Per Example 2 herein, Applicants performed alanine scanning on certain antibodies selected from those above, and determined that similar or improved binding was obtained despite amino acid modifications at selected FR positions. As shown in Figures 4E-1 and 4E-2 and Example 2 herein, for the class I-III groups of antibodies, variant forms of the antibodies with modifications at one or more residues of an FR retained affinity and binding specifity. For example, for antibody 15G11, positions 43 and 48 in the light chain FR2, position 48 in the heavy chain FR2 and positions 67, 69, 71 and 73 in the heavy chain FR3 could be modified as shown in Figures 4E- 1 and 4E-2 and the resulting antibody still retained specificity and strong binding affinity for human/primate TfR. In another example, for antibody 7A4, positions 58 and 68 of the light chain FR3, position 24 in the heavy chain FR1 and position 71 in the heavy chain FR3 could be modified as shown in Figures 4E-1 and 4E-2 and the resulting antibody still retained specificity and strong binding affinity for human/primate TfR. In a third example, for antibody 16F6, positions 43 and 44 of the light chain FR2 and positions 71 and 78 of the heavy chain FR3 could be modified as shown in Figures 4E-1 and 4E-2 and the resulting antibody still retained specificity and strong binding affinity for human/primate TfR. In another aspect, an anti-TfR/BACEl bispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs: 7-10, 15-18, 20, 25-28, 108, 114, 120, 126, 403, and 404. In certain embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to Tf . In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NOs:7-10, 15- 18, 20, 25-28, 108, 114, 120 and 126. In certain embodiments, substitutions, insertions, or deletions occur in regions outside the HV s (i.e., in the FRs). Optionally, the anti-TfR/BACEl bispecific antibody comprises the VH sequence of any one of SEQ ID NOs: 7-10, 15-18, 20 25-28, 108, 114, 120, 126, 403, and 404, including post-translational modifications of that sequence. In a particular embodiment, the VH for a particular antibody comprises one, two or three HVRs selected from: the HVRs set forth above and in Table 3 or 4 for that particular antibody. VH sequences for the antibodies of the invention are shown in Figures 3 and 4 herein.
[00200] In another aspect, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of any one of SEQ ID NOs:4-6, 11-14, 19, 21-24, 105, 111, 117, 123, 401, or 402. In certain embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to TfR. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NOs:4-6, 11-14, 19, 21-24, 105, 111, 117, 123, 401, or 402. In certain embodiments, the substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs). Optionally, the anti-TfR/BACEl multispecific antibody comprises the VL sequence in any of SEQ ID NOs:4-6, 11-14, 19, 21-24, 105, 111, 117, 123, 401, or 402, including post-translational modifications of that sequence. In a particular embodiment, the VL comprises one, two or three HVRs selected from the HVRs set forth above and in Table 3 or 4 for that particular antibody. VL sequences for the antibodies of the invention are shown in Figures 3 and 4 herein.
[00201] In another aspect, an anti-TfRBACEl multispecific antibody is provided, wherein the antibody comprises a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above. In some embodiments, the antibody comprises the VL and VH sequences, respectively, in SEQ ID NOs: 4 and 7; 5 and 8; 5 and 9; 6 and 10; 4 and 7; 11 and 15; 12 and 16; 13 and 17; 14 and 18; 19 and 20; 21 and 25; 22 and 26; 23 and 27; 24 and 28; 105 and 108; 402 and 108; 401 and 108; 401 and 403; 401 and 404; 105 and 403; 105 and 404; 111 and 114; 117 and 120; and 123 and 126 , including post-translational modifications of those sequences.
[00202] In a further aspect, the invention provides an antibody that binds to the same epitope as an anti-Tf antibody provided herein. For example, in certain embodiments, an antibody is provided that binds to the same epitope as an anti-Tf antibody comprising VL and VH sequences, respectively, of SEQ ID NOs: 4 and 7; 5 and 8; 5 and 9; 6 and 10; 4 and 7; 11 and 15; 12 and 16; 13 and 17; 14 and 18; 19 and 20; 21 and 25; 22 and 26; 23 and 27; 24 and 28; 105 and 108; 402 and 108; 401 and 108; 401 and 403; 401 and 404; 105 and 403; 105 and 404; 111 and 114; 117 and 120; or 123 and 126. In some aspects, the antibody competes with any of the antibodies in Class I (ie., clones 7A4, 8A2, 15D2, 10D11, or 7B10, or affinity-matured versions of any of those antibodies) for binding to Tf . In another aspect, the antibody competes with any of the antibodies in Class II (ie, clones 15G11, 16G5, 13C3 or 16G, or affinity-matured versions of any of those antibodies) for binding to TfR. In another aspect, the antibody competes with clone 16F6 or affinity-matured versions thereof for binding to TfR. In another aspect, the antibody competes with any of the antibodies in Class IV (ie, clones 7G7, 4C2, 1B12 or 13D4, or affinity matured versions thereof) for binding to TfR.
[00203] In a further aspect of the invention, the anti-TfR arm of a multispecific antibody according to any of the above embodiments is a monoclonal antibody, including a chimeric, humanized or human antibody. In some embodiments, a multispecific antibody is an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab')2 fragment. In another embodiment, the antibody is a full length antibody, e.g., an intact IgGl, IgG2, IgG3, or IgG4 antibody or other antibody class or isotype as defined herein.
[00204] In a further aspect, an antibody according to any of the above embodiments may incorporate any of the features, singly or in combination, as described in Sections 1 -7 below.
B. Exemplary Anti-BACEl Antibodies
[00205] In some embodiments, anti-TfR/BACEl multispecific antibodies are provided. In some embodiments, an anti-TfR/BACEl multispecific antibody provided herein is an allosteric inhibitor of BACE1 activity. Nonlimiting exemplary anti-TfR/BACEl multispecific antibodies include antibodies comprising the heavy chain and light chain variable regions of the antibodies listed in Table 1. The heavy and light chain variable regions of the antibodies listed in Table 1 are shown in Figures 23 and 24, respectively.
Table 1 : Anti-BACEl Antibodies
Figure imgf000058_0001
5586 5536 5887 6291 6309 6303
5583 5571 6275 6293 6310 6266
5532 5883 6279 6289 6308 6271
5592 5890 6276 5747 5990 6297
5878 5891 5888 5982 6307 6294
5874 5892 5894 5985 5931 5932
5875 5884 5543 5983 6298 6313
5876 6272 5643 5984 5930 6314
5880 6270 5644 5986 5988 6315
5881 6273 5896 6296 6299 5933
5260 6274 5902 5897 6300 6285
6288 5539 5903 5905 6305 6280
6266.1 6266.2 6266.3 6266.4 6266.5 6266.6
6266.1 6266.1 6266.1
6266.7 6266.8 6266.9
0 1 2
6266.1 6266.1 6266.1
3 4 5
[00206] In some embodiments, an anti-BACEl antibody described herein, including but not limited to antibodies comprising one or more HVRs, or all six HVRs, of an antibody listed in Table 1, is an allosteric inhibitor of BACEl activity. In some embodiments, an anti-BACEl antibody binds BACEl with an affinity (KD) of less than 10 nM, less than 9 nM, less than 8 nM, less than 7 nM, less than 6 nM, less than 5 nM, less than 4 nM, or less than 3 nM, as measured by surface plasmon resonance (SPR). In some embodiments, an anti-BACEl antibody binds BACEl with an affinity (KD) of between 0.1 nM and 10 nM, or between 0.1 nM and 8 nM, or between 0.1 nM and 7 nM, or between 0.1 nM and 5 nM, or between 0.5 nM and 5 nM, or between 0.1 nM and 3 nM, or between 0.5 nM and 3 nM, as measured by surface plasmon resonance (SPR). In some embodiments, an anti-BACEl antibody achieves a maximum inhibition of BACEl activity of greater than 60%, greater than 70%, greater than 75%, or greater than 80%, as measured, for example, using the dissociated cortical neuron culture assay described in Example 9E.
[00207] In some aspects, the invention provides a multispecific antibody comprising an anti- BACEl arm comprising at least one, two, three, four, five, or six HVRs of an antibody selected from the anti-BACEl antibodies listed in Table 1. Figures 21 and 22 show the heavy chain and light chain HVR sequences, respectively, of each of those antibodies. In some embodiments, the invention provides a multispecific antibody comprising an anti-BACEl arm comprising HVR-H1, HVR-H2, HVR-H3, HVR-L1, HVR-L2, and HVR-L3 of an antibody selected from the anti- BACE1 antibodies listed in Table 1.
[00208] In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-Hl sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201 ; an HVR-L1 sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-Hl sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385; an HVR-Ll sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-Hl sequence selected from SEQ ID NOs: 165, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 179, 377, and 383; an HVR-H3 sequence selected from SEQ ID NOs: 202, 378, 379, 384, and 385; an HVR-Ll sequence of SEQ ID NO: 215; an HVR-L2 sequence selected from SEQ ID NOs: 221 and 375; and an HVR-L3 sequence of SEQ ID NO: 230. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-Hl of SEQ ID NO: 165; an HVR-H2 sequence of SEQ ID NO: 179; an HVR-H3 sequence of SEQ ID NO: 202; an HVR-Ll sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221; and an HVR-L3 sequence of SEQ ID NO: 230. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-Hl, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, and HVR-L3 of an antibody selected from antibody 6266 variants 1-15.
[00209] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising at least one, at least two, or all three VH HVR sequences selected of an antibody selected from the anti-BACEl antibodies listed in Table 1. In some embodiments, the invention provides an anti-TfR/BACEl multispecific antibody comprising HVR-Hl, HVR-H2, and HVR-H3 of an antibody selected from the anti-BACEl antibodies listed in Table 1. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR- Hl sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; and an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-Hl sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; and an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR- Hl sequence selected from SEQ ID NOs: 165, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 179, 377, and 383; and an HVR-H3 sequence selected from SEQ ID NOs: 202, 378, 379, 384, and 385. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-H1 of SEQ ID NO: 165; an HVR-H2 sequence of SEQ ID NO: 179; and an HVR-H3 sequence of SEQ ID NO: 202. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-H1, HVR-H2, and HVR-H3 of an antibody selected from antibody 6266 variants 1-15.
[00210] In some aspects, the invention provides an anti-TfR/BACEl multispecific antibody comprising at least one, at least two, or all three VL HVR sequences selected of an antibody selected from the anti-BACEl antibodies listed in Table 1. In some embodiments, the invention provides an anti-TfR/BACEl multispecific antibody comprising HVR-L1, HVR-L2, and HVR-L3 of an antibody selected from the anti-BACEl antibodies listed in Table 1. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR- Ll sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-L1 sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221, 223, or 375; and an HVR-L3 sequence of SEQ ID NO: 230. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221; and an HVR-L3 sequence of SEQ ID NO: 230. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises an HVR-L1, HVR-L2, and HVR-L3 of an antibody selected from antibody 6266 variants 1-15.
[00211] In another aspect, an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the VH of an anti-BACEl antibody of Table 1. In some embodiments, an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374. In some embodiments, an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374. In some embodiments, an anti-TfR/BACEl multispecific antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 288. In certain embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti- TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to BACE1 and/or inhibit or reduce BACE1 activity. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NO: 249 to 297, 352 to 358, and 367 to 374. In certain embodiments, substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs). Optionally, the antibody comprises the VH sequence in any one of SEQ ID NO: 249 to 297, 352 to 358, and 367 to 374, including post-translational modifications of that sequence. In a particular embodiment, the VH comprises one, two or three HVRs of an anti-BACEl antibody listed in Table 1. In some embodiments, the VH comprises an HVR-Hl sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; and an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201. In some embodiments, the VH comprises an HVR-Hl sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; and an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385. In some embodiments, the VH comprises an HVR-Hl sequence selected from SEQ ID NOs: 165, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 179, 377, and 383; and an HVR-H3 sequence selected from SEQ ID NOs: 202, 378, 379, 384, and 385. In some embodiments, the VH comprises an HVR-Hl of SEQ ID NO: 165; an HVR-H2 sequence of SEQ ID NO: 179; and an HVR-H3 sequence of SEQ ID NO: 202. In some embodiments, the VH comprises an HVR-Hl, HVR-H2, and HVR-H3 of an antibody selected from antibody 6266 variants 1-15.
[00212] In another aspect, an anti-TfR/BACEl multispecific antibody comprises a light chain variable domain (VL) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the VL of an anti-BACEl antibody of Table 1. In another aspect, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 298 to 328, 345 to 351 , and 359 to 366. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 306. In certain embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g. , conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-TfR/BACEl multispecific antibody comprising that sequence retains the ability to bind to BACE1 and/or inhibit or reduce BACE1 activity. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in any one of SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366. In certain embodiments, the substitutions, insertions, or deletions occur in regions outside the HVRs (i.e., in the FRs). Optionally, the antibody comprises the VL sequence in any one of SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366, including post-translational modifications of that sequence. In a particular embodiment, the VL comprises one, two or three HVRs of an anti-BACEl antibody listed in Table 1. In some embodiments, the VL comprises an HVR-L1 sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248. In some embodiments, the VL comprises an HVR-L1 sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247. In some embodiments, the VL comprises an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221 , 223, or 375; and an HVR-L3 sequence of SEQ ID NO: 230. In some embodiments, the VL comprises an HVR-L1 sequence of SEQ ID NO: 215; an HVR-L2 sequence of SEQ ID NO: 221 ; and an HVR-L3 sequence of SEQ ID NO: 230. In some embodiments, the VL comprises an HVR-L1 , HVR-L2, and HVR-L3 of an antibody selected from antibody 6266 variants 1-15.
[00213] In another aspect, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH sequence selected from SEQ ID NOs: 249 to 256 and a VL sequence selected from SEQ ID NOs: 298 to 302. In some embodiments, an anti- TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH sequence selected from SEQ ID NOs: 257 to 297, 352 to 358, and 367 to 374 and a VL sequence selected from SEQ ID NOs: 303 to 328, 345 to 351, and 359 to 366. In some embodiments, an anti- TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH and a VL of an anti-BACEl antibody listed in Table 1. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374 and a VL sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366. In some embodiments, the antibody comprises the VH and VL sequences of SEQ ID NO: 288 and SEQ ID NO: 306, respectively, including post-translational modifications of those sequences. In some embodiments, an anti-TfR/BACEl multispecific antibody is provided, wherein the antibody comprises a VH and a VL of an antibody selected from antibody 6266 variants 1-15.
[00214] In a further aspect, the invention provides a multispecific antibody that binds to the same epitope as an anti-BACEl antibody provided herein, such as the anti-BACEl antibodies listed in Table 1. For example, in certain embodiments, an antibody is provided that binds to the same epitope as an anti-BACEl antibody comprising a VH sequence selected from SEQ ID NOs: 249 to 256 and a VL sequence selected from SEQ ID NOs: 298 to 302. In certain embodiments, an antibody is provided that binds to the same epitope as an anti-BACEl antibody comprising a VH sequence selected from SEQ ID NOs: 257 to 297, 352 to 358, and 367 to 374 and a VL sequence selected from SEQ ID NOs: 303 to 328, 345 to 351, and 359 to 366. In certain embodiments, an antibody is provided that binds to the same epitope as an anti-BACEl antibody comprising the VH and VL sequences of SEQ ID NO: 288 and SEQ ID NO: 306, respectively.
[00215] In another embodiment, a multispecific antibody is provided that competes for binding (e.g., binds to the same epitope) as any anti-BACEl antibody described herein.
[00216] In a further aspect of the invention, the anti-BACEl arm of an anti-TfR/BACEl multispecific antibody according to any of the above embodiments is a monoclonal antibody, including a chimeric or human antibody. In some embodiments, an antibody is an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab')2 fragment. In another embodiment, the antibody is a full length antibody, e.g., an intact IgGl antibody or other antibody class or isotype as defined herein.
[00217] In a further aspect, an anti-TfR/BACEl multispecific antibody according to any of the above embodiments may incorporate any of the features, singly or in combination, as described in Sections 1-7 below.
. Antibody Affinity
[00218] In certain embodiments, an antibody provided herein has a dissociation constant (Kd) of < ΙμΜ, < 100 nM, < 10 nM, < 1 nM, < 0.1 nM, < 0.01 nM, or < 0.001 nM (e.g. 10"8 M or less, e.g. from 10"8 M to 10"13 M, e.g., from 10"9 M to lO 3 M). [00219] In certain aspects of the present invention, a "low affinity" anti-Tf arm of an anti- TfR/BACEl multispecific antibody of the invention is selected, based, e.g., on the results in Example 5 and in Atwal et al., Sci. Transl. Med. 3, 84ra43 (2011) and Yu et al., Sci. Transl. Med. 25 May 2011 : Vol. 3, Issue 84, p. 84ra44, showing that such lower-affinity antibodies to Tf display improved CNS (for example, brain) uptake and/or persistence in the brain/CNS. In order to identify such low affinity antibodies, various assays for measuring antibody affinity are available including, without limitation: Scatchard assay and surface plasmon resonance technique (e.g. using BIACORE®). According to some embodiments of the invention, the antibody has an affinity for human or primate TfR from about 5nM, or from about 20 nM, or from about 100 nM, to about 50 μΜ, or to about 30 μΜ, or to about 10 μΜ, or to about 1 μΜ, or to about 500 nM. Thus, the affinity may be in the range from about 5 nM to about 50 μΜ, or in the range from about 20 nM to about 30 μΜ, or in the range from about 30 nM to about 30 μΜ, or in the range from about 50 nM to about 1 μΜ, or in the range from about 100 nM to about 500 nM, e.g. as measured by Scatchard analysis or BIACORE®. In another embodiment of the invention, the antibody has a dissociation half-life from TfR of less than 1 minute, less than 2 minutes, less than 3 minutes, less than four minutes, less than 5 minutes, or less than 10 minutes to about 20 minutes, or to about 30 minutes, as measured by competition binding analysis or BIACORE®.
[00220] Thus, the invention provides a method of making an antibody useful for transporting a neurological disorder drug across the blood-brain barrier comprising selecting an antibody from a panel of antibodies against TfR because it has an affinity for TfR which is in the range from about 5nM, or from about 20 nM, or from about 100 nM, to about 50 μΜ, or to about 30 μΜ, or to about 10 μΜ, or to about 1 μΜ, or to about 500 mM. Thus, the affinity may be in the range from about 5 nM to about 50 μΜ, or in the range from about 20 nM to about 30 μΜ, or in the range from about 30 nM to about 30 μΜ, or in the range from about 50 nM to about 1 μΜ, or in the range from about 100 nM to about 500 nM, e.g. as measured by Scatchard analysis or BIACORE®. As will be understood by one of ordinary skill in the art, conjugating a heterologous molecule/compound to an antibody will often decrease the affinity of the antibody for its target due, e.g., to steric hindrance or even to elimination of one binding arm if the antibody is made multispecific with one or more arms binding to a different antigen than the antibody's original target. In some embodiments, a low affinity antibody of the invention specific for TfR conjugated to anti-BACEl had a Kd for TfR as measured by BIACORE of about 30 nM. In another embodiment, a low affinity antibody of the invention specific for TfR conjugated to BACE1 had a Kd for TfR as measured by BIACORE of about 600 nM. In another embodiment, a low affinity antibody of the invention specific for TfR conjugated to BACE1 had a Kd for TfR as measured by BIACORE of about 20 μΜ. In another embodiment, a low affinity antibody of the invention specific for Tf conjugated to BACE1 had a Kd for TfR as measured by BIACORE of about 30 μΜ.
[00221] In some embodiments, Kd is measured by a radiolabeled antigen binding assay (RIA). In some embodiments, an RIA is performed with the Fab version of an antibody of interest and its antigen. For example, solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of (125I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J. Mol. Biol. 293:865-881(1999)). To establish conditions for the assay,
MICROTITER® multi-well plates (Thermo Scientific) are coated overnight with 5 μg/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C). In a non-adsorbent plate (Nunc #269620), 100 pM or 26 pM [125I]-antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of the anti- VEGF antibody, Fab-12, in Presta et al., Cancer Res. 57:4593-4599 (1997)). The Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., about 65 hours) to ensure that equilibrium is reached. Thereafter, the mixtures are transferred to the capture plate for incubation at room temperature (e.g., for one hour). The solution is then removed and the plate washed eight times with 0.1% polysorbate 20 (TWEEN-20®) in PBS. When the plates have dried, 150 μΐ/well of scintillant (MICROSCINT-20™; Packard) is added, and the plates are counted on a TOPCOUNT™ gamma counter (Packard) for ten minutes. Concentrations of each Fab that give less than or equal to 20% of maximal binding are chosen for use in competitive binding assays.
[00222] In some aspects, the RIA is a Scatchard analysis. For example, the anti-TfR antibody of interest can be iodinated using the lactoperoxidase method (Bennett and Horuk, Methods in Enzymology 288 pg.134-148 (1997)). A radiolabeled anti-TfR antibody is purified from free 125I-Na by gel filtration using a NAP-5 column and its specific activity measured. Competition reaction mixtures of 50 μί^ containing a fixed concentration of iodinated antibody and decreasing concentrations of serially diluted unlabeled antibody are placed into 96-well plates. Cells transiently expressing TfR are cultured in growth media, consisting of Dulbecco's modified eagle's medium (DMEM) (Genentech) supplemented with 10% FBS, 2 mM L-glutamine and
1 x penicillin-streptomycin at 37°C in 5% CO2. Cells are detached from the dishes using Sigma Cell Dissociation Solution and washed with binding buffer (DMEM with 1% bovine serum albumin, 50 mM HEPES, pH 7.2, and 0.2% sodium azide). The washed cells are added at an approximate density of 200,000 cells in 0.2 mL of binding buffer to the 96-well plates containing the 50-μί competition reaction mixtures. The final concentration of the unlabeled antibody in the competition reaction with cells is varied, starting at 1000 nM and then decreasing by 1 :2 fold dilution for 10 concentrations and including a zero-added, buffer-only sample. Competition reactions with cells for each concentration of unlabeled antibody are assayed in triplicate.
Competition reactions with cells are incubated for 2 hours at room temperature. After the 2-hour incubation, the competition reactions are transferred to a filter plate and washed four times with binding buffer to separate free from bound iodinated antibody. The filters are counted by gamma counter and the binding data are evaluated using the fitting algorithm of Munson and odbard (1980) to determine the binding affinity of the antibody.
[00223] An exemplary BIACORE® analysis using the compositions of the invention may be performed as follows. Kd was measured using surface plasmon resonance assays using a
BIACORE®-2000 (BIAcore, Inc., Piscataway, NJ) at 25 °C using anti-human Fc kit (BiAcore Inc., Piscataway, NJ). Briefly, carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) were activated with N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Anti-human Fc antibody was diluted with 10 niM sodium acetate, pH 4.0, to 50 μg/ml before injection at a flow rate of 5 μΐ/minute to achieve approximately 10000 response units (RU) of coupled protein. Following the injection of antibody, 1 M ethanolamine was injected to block unreacted groups. For kinetics measurements, monospecific or multispecific anti-TfR antibody variants were injected in HBS-P to reach about 220 RU, then two-fold serial dilutions of MuTfR-His (0.61 nM to 157 nM) were injected in HBS-P at 25°C at a flow rate of approximately 30 μΐ/min. Association rates (kon) and dissociation rates (koff) were calculated using a simple one-to-one Langmuir binding model (BIACORE® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant (Kd) was calculated as the ratio koff/kon. See, e.g., Chen et al., J. Mol. Biol. 293:865-881 (1999)
[00224] According to another embodiment, Kd is measured using surface plasmon resonance assays with a BIACORE®-2000 device (BIAcore, Inc., Piscataway, NJ) at 25°C using anti-human Fc kit (BiAcore Inc., Piscataway, NJ). Briefly, carboxymethylated dextran biosensor chips (CM5, BIACORE, Inc.) are activated with N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride (EDC) and N-hydroxysuccinimide (NHS) according to the supplier's instructions. Anti -human Fc antibody is diluted with 10 mM sodium acetate, pH 4.0, to 50 μg/ml before injection at a flow rate of 5 μΐ/minute to achieve approximately 10000 response units (RU) of coupled protein. Following the injection of antibody, 1 M ethanolamine is injected to block unreacted groups. For kinetics measurements, anti-TfR antibody variants are injected in HBS-P to reach about 220 RU, then two-fold serial dilutions of TfR-His (0.61 nM to 157 nM) are injected in HBS-P at 25°C at a flow rate of approximately 30 μΐ/min. Association rates (kon) and dissociation rates (koff) are calculated using a simple one-to-one Langmuir binding model (BIACORE ® Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams. The equilibrium dissociation constant (Kd) is calculated as the ratio koff/kon. See, e.g., Chen et al., J. Mol. Biol. 293:865-881 (1999).
[00225] Several methods of determining the IC50 for a given compound are art-known; a common approach is to perform a competition binding assay, such as that described herein. In general, a high IC50 indicates that more of the antibody is required to inhibit binding of the known ligand, and thus that the antibody's affinity for that ligand is relatively low. Conversely, a low IC50 indicates that less of the antibody is required to inhibit binding of the known ligand, and thus that the antibody's affinity for that ligand is relatively high.
[00226] An exemplary competitive ELISA assay to measure IC50 is one in which increasing concentrations of anti-Tf or anti-TfR/brain antigen (i.e., anti-TfR/BACEl) variant antibodies are used to compete against a biotinylated known anti-TfR antibody for binding to TfR. The anti-TfR competition ELISA was performed in Maxisorp plates (Neptune, N.J.) coated with 2.5 μg/ml of purified murine TfR extracellular domain in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using Superblock blocking buffer in PBS (Thermo Scientific, Hudson, NH). A titration of each individual anti-TfR or anti-TfR/brain antigen (i.e., anti- TfR/BACEl) (1 :3 serial dilution) was combined with biotinylated known anti-TfR (0.5 nM final concentration) and added to the plate for 1 hour at room temperature. Plates were washed with PBS/0.05% Tween 20, and HRP-streptavidin (Southern Biotech, Birmingham) was added to the plate and incubated for 1 hour at room temperature. Plates were washed with PBS/0.05% Tween 20, and biotinylated anti-TfR antibody bound to the plate was detected using TMB substrate (BioFX Laboratories, Owings Mills).
2. Antibody Fragments
[00227] In certain embodiments, an antibody provided herein is an antibody fragment.
Antibody fragments include, but are not limited to, Fab, Fab', Fab'-SH, F(ab')2, Fv, and scFv fragments, and other fragments described below. For a review of certain antibody fragments, see Hudson et al. Nat. Med. 9:129-134 (2003). For a review of scFv fragments, see, e.g., Pluckthiin, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer- Verlag, New York), pp. 269-315 (1994); see also WO 93/16185; and U.S. Patent Nos. 5,571,894 and 5,587,458. For discussion of Fab and F(ab')2 fragments comprising salvage receptor binding epitope residues and having increased in vivo half-life, see U.S. Patent No. 5,869,046.
[00228] Diabodies are antibody fragments with two antigen-binding sites that may be bivalent or bispecific. See, for example, EP 404,097; WO 1993/01161; Hudson et al., Nat. Med. 9:129-134 (2003); and Hollinger et al., Proc. Natl. Acad. Sci. USA 90: 6444-6448 (1993). Triabodies and tetrabodies are also described in Hudson et al., Nat. Med. 9:129-134 (2003).
[00229] Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody (Domantis, Inc., Waltham, MA; see, e.g., U.S. Patent No. 6,248,516 Bl).
[00230] Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells (e.g. E. coli or phage), as described herein.
3. Chimeric and Humanized Antibodies
[00231] In certain embodiments, an antibody provided herein is a chimeric antibody. Certain chimeric antibodies are described, e.g., in U.S. Patent No. 4,816,567; and Morrison et al., Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)). In one example, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region. Chimeric antibodies of interest herein include "primatized" antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey, such as baboon, rhesus or cynomolgus monkey) and human constant region sequences (US Pat No. 5,693,780). In a further example, a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
[00232] In certain embodiments, a chimeric antibody is a humanized antibody. Typically, a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
[00233] Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008), and are further described, e.g., in Riechmann et al., Nature 332:323-329 (1988); Queen et al., Proc. Nat'l Acad. Sci. USA 86: 10029-10033 (1989); US Patent Nos. 5, 821,337, 7,527,791, 6,982,321, and 7,087,409; Kashmiri et al., Methods 36:25-34 (2005) (describing specificity determining region (SDR) grafting); Padlan, Mol. Immunol. 28:489- 498 (1991) (describing "resurfacing"); Dall'Acqua et al., Methods 36:43-60 (2005) (describing "F shuffling"); and Osbourn et al., Methods 36:61 -68 (2005) and Klhnka et al., Br. J. Cancer, 83 :252-260 (2000) (describing the "guided selection" approach to FR shuffling).
[00234] Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best-fit" method (see, e.g., Sims et al. J.
Immunol. 151 :2296 (1993)); framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions (see, e.g., Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); and Presta et al. J. Immunol, 151 :2623 (1993)); human mature (somatically mutated) framework regions or human germline framework regions (see, e.g., Almagro and Fransson, Front. Biosci. 13: 1619-1633 (2008)); and framework regions derived from screening FR libraries (see, e.g., Baca et al., J. Biol. Chem. 272: 10678-10684 (1997) and Rosok et al., J. Biol. Chem. 271 :2261 1-22618 (1996)).
4. Human Antibodies
[00235] In certain embodiments, an antibody provided herein is a human antibody. Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk and van de Winkel, Curr. Opin. Pharmacol. 5 : 368-74 (2001) and Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).
[00236] Human antibodies may be prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge. Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated. For review of methods for obtaining human antibodies from transgenic animals, see Lonberg, Nat. Biotech. 23 : 1 1 17-1 125 (2005). See also, e.g., U.S. Patent Nos. 6,075,181 and 6, 150,584 describing XENOMOUSE™ technology; U.S. Patent No. 5,770,429 describing HUMAB® technology; U.S. Patent No. 7,041 ,870 describing K-M MOUSE® technology, and U.S. Patent Application Publication No. US 2007/0061900, describing VELOCIMOUSE® technology). Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.
[00237] Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described. (See, e.g., Kozbor J. Immunol, 133 : 3001 (1984); Brodeur et al.,
Monoclonal Antibody Production Techniques and Applications, pp. 51 -63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol, 147: 86 (1991).) Human antibodies generated via human B-cell hybridoma technology are also described in Li et al Proc. Natl. Acad. Sci. USA, 103:3557-3562 (2006). Additional methods include those described, for example, in U.S. Patent No. 7,189,826 (describing production of monoclonal human IgM antibodies from hybridoma cell lines) and Ni, Xiandai Mianyixue, 26(4):265-268 (2006) (describing human-human hybridomas). Human hybridoma technology (Trioma technology) is also described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3): 185-91 (2005).
[00238] Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
5. Library-Derived Antibodies
[00239] Antibodies of the invention may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, 2001) and further described, e.g., in the McCafferty et al., Nature 348:552-554; Clackson et al., Nature 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Marks and Bradbury, in Methods in Molecular Biology 248: 161-175 (Lo, ed., Human Press, Totowa, NJ, 2003); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132(2004).
[00240] In certain phage display methods, repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PC ) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter et al., Ann. Rev. Immunol, 12: 433-455 (1994). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992). Patent publications describing human antibody phage libraries include, for example: US Patent No. 5,750,373, and US Patent Publication Nos. 2005/0079574, 2005/0119455, 2005/0266000, 2007/0117126,
2007/0160598, 2007/0237764, 2007/0292936, and 2009/0002360.
[00241] Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
6. Multispecific Antibodies
[00242] In certain embodiments, an antibody provided herein is a multispecific antibody, e.g. a bispecific antibody. Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites. In certain embodiments, one of the binding specificities is for TfR and the other is for BACEl. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express Tf . Bispecific antibodies can be prepared as full length antibodies or antibody fragments.
[00243] Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein and Cuello, Nature 305: 537 (1983)), WO 93/08829, and Traunecker et al., EMBO J. 10: 3655 (1991)), and "knob-in-hole" engineering (see, e.g., U.S. Patent No.
5,731,168). Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004A1); cross-linking two or more antibodies or fragments (see, e.g., US Patent No. 4,676,980, and Brennan et al., Science, 229: 81 (1985)); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny et al., J. Immunol, 148(5): 1547-1553 (1992)); using "diabody" technology for making bispecific antibody fragments (see, e.g., Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); and using single-chain Fv (sFv) dimers (see,e.g. Gruber et al., J. Immunol, 152:5368 (1994)); and preparing trispecific antibodies as described, e.g., in Tutt et al. J. Immunol. 147: 60 (1991).
[00244] Engineered antibodies with three or more functional antigen binding sites, including "Octopus antibodies" or "dual- variable domain immunoglobulins" (DVDs) are also included herein (see, e.g. US 2006/0025576A1, and Wu et al. Nature Biotechnology (2007)).
[00245] The antibody or fragment herein also includes a "Dual Acting FAb" or "DAF" comprising an antigen binding site that binds to TfR as well as another, different antigen, such as BACEl (see, US 2008/0069820, for example).
[00246] According to some embodiments of the invention, the "coupling" is achieved by generating a multispecific antibody (e.g. a bispecific antibody). Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different antigens or epitopes. In some embodiments, the multispecific antibody comprises a first antigen binding site which binds the TfR and a second antigen binding site which binds a brain antigen, such as beta-secretase 1 (BACE1) or Abeta, and the other brain antigens disclosed herein.
[00247] An exemplary brain antigen bound by such multispecific/bispecific antibody is BACE1, and an exemplary antibody binding thereto is an antibody listed in Table 1 herein, such as antibody 6266.
Knobs into Holes
[00248] The use of knobs into holes as a method of producing multispecific antibodies is described, e.g., in U.S. Pat. No. 5,731,168, WO2009/089004, US2009/0182127, US2011/0287009, Marvin and Zhu, Acta Pharmacol. Sin. (2005) 26(6):649-658, and Kontermann (2005) Acta Pharmacol. Sin., 26: 1-9. A brief nonlimiting discussion is provided below.
[00249] A "protuberance" refers to at least one amino acid side chain which projects from the interface of a first polypeptide and is therefore positionable in a compensatory cavity in the adjacent interface (i.e. the interface of a second polypeptide) so as to stabilize the heteromultimer, and thereby favor heteromultimer formation over homomultimer formation, for example. The protuberance may exist in the original interface or may be introduced synthetically (e.g. by altering nucleic acid encoding the interface). In some embodiments, nucleic acid encoding the interface of the first polypeptide is altered to encode the protuberance. To achieve this, the nucleic acid encoding at least one "original" amino acid residue in the interface of the first polypeptide is replaced with nucleic acid encoding at least one "import" amino acid residue which has a larger side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue. The side chain volumes of the various amino residues are shown, for example, in Table 1 of US2011/0287009. A mutation to introduce a "protuberance" may be referred to as a "knob mutation."
[00250] In some embodiments, import residues for the formation of a protuberance are naturally occurring amino acid residues selected from arginine (R), phenylalanine (F), tyrosine (Y) and tryptophan (W). In some embodiments, an import residue is tryptophan or tyrosine. In some embodiment, the original residue for the formation of the protuberance has a small side chain volume, such as alanine, asparagine, aspartic acid, glycine, serine, threonine or valine.
[00251] A "cavity" refers to at least one amino acid side chain which is recessed from the interface of a second polypeptide and therefore accommodates a corresponding protuberance on the adjacent interface of a first polypeptide. The cavity may exist in the original interface or may be introduced synthetically (e.g. by altering nucleic acid encoding the interface). In some embodiments, nucleic acid encoding the interface of the second polypeptide is altered to encode the cavity. To achieve this, the nucleic acid encoding at least one "original" amino acid residue in the interface of the second polypeptide is replaced with DNA encoding at least one "import" amino acid residue which has a smaller side chain volume than the original amino acid residue. It will be appreciated that there can be more than one original and corresponding import residue. In some embodiments, import residues for the formation of a cavity are naturally occurring amino acid residues selected from alanine (A), serine (S), threonine (T) and valine (V). In some embodiments, an import residue is serine, alanine or threonine. In some embodiments, the original residue for the formation of the cavity has a large side chain volume, such as tyrosine, arginine, phenylalanine or tryptophan. A mutation to introduce a "cavity" may be referred to as a "hole mutation."
[00252] The protuberance is "positionable" in the cavity which means that the spatial location of the protuberance and cavity on the interface of a first polypeptide and second polypeptide respectively and the sizes of the protuberance and cavity are such that the protuberance can be located in the cavity without significantly perturbing the normal association of the first and second polypeptides at the interface. Since protuberances such as Tyr, Phe and Trp do not typically extend perpendicularly from the axis of the interface and have preferred conformations, the alignment of a protuberance with a corresponding cavity may, in some instances, rely on modeling the protuberance/cavity pair based upon a three-dimensional structure such as that obtained by X-ray crystallography or nuclear magnetic resonance (NMR). This can be achieved using widely accepted techniques in the art.
[00253] In some embodiments, a knob mutation in an IgGl constant region is T366W. In some embodiments, a hole mutation in an IgGl constant region comprises one or more mutations selected from T366S, L368A and Y407V. In some embodiments, a hole mutation in an IgGl constant region comprises T366S, L368A and Y407V. SEQ ID NOs: 391 and 393 show exemplary IgGl constant regions with knob mutations (in addition to LALAPG and
LALAPG.YTE, discussed herein). SEQ ID NOs: 390 and 392 show exemplary IgGl constant region with hole mutations (in addition to LALAPG and LALAPG.YTE, discussed herein).
[00254] In some embodiments, a knob mutation in an IgG4 constant region is T366W. In some embodiments, a hole mutation in an IgG4 constant region comprises one or more mutations selected from T366S, L368A, and Y407V. In some embodiments, a hole mutation in an IgG4 constant region comprises T366S, L368A, and Y407V.
7. Antibody Variants
[00255] In certain embodiments, amino acid sequence variants of the antibodies provided herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody. Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen- binding.
a) Substitution, Insertion, and Deletion Variants
[00256] In certain embodiments, antibody variants having one or more amino acid substitutions are provided. Sites of interest for substitutional mutagenesis include the HV s and FRs.
Conservative substitutions are shown in Table 2 under the heading of "preferred substitutions." More substantial changes are provided in Table 2 under the heading of "exemplary substitutions," and as further described below in reference to amino acid side chain classes. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC
TABLE 2
Figure imgf000075_0001
Original Exemplary Preferred Residue Substitutions Substitutions
Val (V) He; Leu; Met; Phe; Ala; Norleucine Leu
[00257] Amino acids may be grouped according to common side-chain properties:
(1) hydrophobic: Norleucine, Met, Ala, Val, Leu, He;
(2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin;
(3) acidic: Asp, Glu;
(4) basic: His, Lys, Arg;
(5) residues that influence chain orientation: Gly, Pro;
(6) aromatic: Trp, Tyr, Phe.
[00258] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[00259] One type of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody). Generally, the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody. An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
[00260] Alterations (e.g., substitutions) may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, Methods Mol. Biol. 207: 179-196 (2008)), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity. Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom et al. in Methods in Molecular Biology 178: 1-37 (O'Brien et al., ed., Human Press, Totowa, NJ, (2001).) In some embodiments of affinity maturation, diversity is introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or
oligonucleotide-directed mutagenesis). A secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity. Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CD -H3 and CDR-L3 in particular are often targeted.
[00261] In certain embodiments, substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen. For example, conservative alterations (e.g., conservative substitutions as provided herein) that do not substantially reduce binding affinity may be made in HVRs. Such alterations may, for example, be outside of antigen contacting residues in the HVRs. In certain embodiments of the variant VH and VL sequences provided above, each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
[00262] A useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells (1989) Science, 244: 1081-1085. In this method, a residue or group of target residues (e.g., charged residues such as arg, asp, his, lys, and glu) are identified and replaced by a neutral or negatively charged amino acid (e.g., alanine or polyalanine) to determine whether the interaction of the antibody with antigen is affected. Further substitutions may be introduced at the amino acid locations demonstrating functional sensitivity to the initial substitutions. Alternatively, or additionally, a crystal structure of an antigen-antibody complex to identify contact points between the antibody and antigen. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
[00263] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
b) Glycosylation variants
[00264] In certain embodiments, an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated. Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
[00265] Where the antibody comprises an Fc region, the carbohydrate attached thereto may be altered. Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc region. See, e.g., Wright et al. TIBTECH 15:26-32 (1997). The oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary
oligosaccharide structure. In some embodiments, modifications of the oligosaccharide in an antibody of the invention may be made in order to create antibody variants with certain improved properties.
[00266] In some embodiments, antibody variants are provided having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc region. For example, the amount of fucose in such antibody may be from 1% to 80%, from 1% to 65%, from 5% to 65% or from 20% to 40%. The amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example. Asn297 refers to the asparagine residue located at about position 297 in the Fc region (Eu numbering of Fc region residues); however, Asn297 may also be located about ± 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies. Such fucosylation variants may have improved ADCC function. See, e.g., US Patent Publication Nos. US 2003/0157108 (Presta, L.); US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd). Examples of publications related to "defucosylated" or "fucose-deficient" antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614; US 2002/0164328; US 2004/0093621 ; US 2004/0132140; US 2004/0110704; US 2004/0110282; US 2004/0109865; WO 2003/085119; WO 2003/084570; WO 2005/035586; WO 2005/035778; WO2005/053742; WO2002/031140; Okazaki et al. J. Mol. Biol. 336:1239-1249 (2004); Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004). Examples of cell lines capable of producing defucosylated antibodies include Led 3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al, especially at Example 11), and knockout cell lines, such as alpha- 1 ,6-fucosyltransferase gene, FUT8, knockout CHO cells (see, e.g., Yamane-Ohnuki et al. Biotech. Bioeng. 87: 614 (2004); Kanda, Y. et al., Biotechnol. Bioeng., 94(4):680-688 (2006); and WO2003/085107).
[00267] Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878 (Jean-Mairet et al.); US Patent No. 6,602,684 (Umana et al.); and US 2005/0123546 (Umana et al). Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087 (Patel et al.); WO 1998/58964 ( aju, S.); and WO 1999/22764 (Raju, S.).
c) Fc region variants
[00268] In certain embodiments, one or more amino acid modifications may be introduced into the Fc region of an antibody provided herein, thereby generating an Fc region variant. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g. a substitution) at one or more amino acid positions.
[00269] In certain embodiments, the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half life of the antibody in vivo is important yet certain effector functions (such as complement and ADCC) are unnecessary or deleterious. In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities. For example, Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability. The primary cells for mediating ADCC, NK cells, express Fc(RIII only, whereas monocytes express Fc(RI, Fc(RII and Fc(RIII. FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol. 9:457-492 (1991). Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest is described in U.S. Patent No. 5,500,362 (see, e.g. Hellstrom, I. et al. Proc. Nat'l Acad. Sci. USA 83:7059-7063 (1986)) and Hellstrom, I et al., Proc. Nat 'l Acad. Sci. USA 82:1499-1502 (1985); 5,821,337 (see Bruggemann, M. et al., J. Exp. Med. 166:1351-1361 (1987)). Alternatively, non-radioactive assays methods may be employed (see, for example, ACTI™ non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox 96® non-radioactive cytotoxicity assay (Promega, Madison, WI). Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. Proc. Nat 'l Acad. Sci. USA 95:652-656 (1998). Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402. To assess complement activation, a CDC assay may be performed (see, for example, Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996); Cragg, M.S. et al., Blood 101 :1045-1052 (2003); and Cragg, M.S. and M.J. Glennie, Blood 103:2738-2743 (2004)). FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al., Int 'l. Immunol.
18(12): 1759-1769 (2006)). [00270] Nonlimiting examples of antibodies with reduced effector function include those with substitution of one or more of Fc region residues 238, 265, 269, 270, 297, 327 and 329 (U.S. Patent No. 6,737,056). Such Fc mutants include Fc mutants with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc mutant with substitution of residues 265 and 297 to alanine (US Patent No. 7,332,581).
[00271] Certain antibody variants with improved or diminished binding to Fc s are described. (See, e.g., U.S. Patent No. 6,737,056; WO 2004/056312, and Shields et al J. Biol. Chem. 9(2): 6591-6604 (2001).)
[00272] In certain embodiments, an antibody variant comprises an Fc region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc region (EU numbering of residues).
[00273] In some embodiments, alterations are made in the Fc region that result in altered {i.e., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in US Patent No. 6,194,551, WO 99/51642, and Idusogie et al. J. Immunol. 164: 4178-4184 (2000).
[00274] Antibodies with increased half lives and improved binding to the neonatal Fc receptor (FcRn), which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J.
Immunol. 117:587 (1976) and Kim et al., J. Immunol. 24:249 (1994)), are described in
US2005/0014934A1 (Hinton et al.). Those antibodies comprise an Fc region with one or more substitutions therein which improve binding of the Fc region to FcRn. Such nonlimiting Fc variants include those with substitutions at one or more of Fc region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc region residue 434 (US Patent No. 7,371,826).
[00275] See also Duncan & Winter, Nature 322:738-40 (1988); U.S. Patent No. 5,648,260; U.S. Patent No. 5,624,821; and WO 94/29351 concerning other examples of Fc region variants.
d) Cysteine engineered antibody variants
[00276] In certain embodiments, it may be desirable to create cysteine engineered antibodies, e.g., "thioMAbs," in which one or more residues of an antibody are substituted with cysteine residues. In particular embodiments, the substituted residues occur at accessible sites of the antibody. By substituting those residues with cysteine, reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein. In certain embodiments, any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc region. Cysteine engineered antibodies may be generated as described, e.g., in U.S. Patent No. 7,521,541.
e) Antibody Derivatives
[00277] In certain embodiments, an antibody provided herein may be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available. The moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers. Non-limiting examples of water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol,
carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), polyvinyl alcohol, and mixtures thereof. Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. The polymer may be of any molecular weight, and may be branched or unbranched. The number of polymers attached to the antibody may vary, and if more than one polymer are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
[00278] In another embodiment, conjugates of an antibody and nonproteinaceous moiety that may be selectively heated by exposure to radiation are provided. In some embodiments, the nonproteinaceous moiety is a carbon nanotube (Kam et al., Proc. Natl. Acad. Sci. USA 102: 11600- 11605 (2005)). The radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the nonproteinaceous moiety to a temperature at which cells proximal to the antibody-nonproteinaceous moiety are killed.
C. Recombinant Methods and Compositions
[00279] Antibodies may be produced using recombinant methods and compositions, e.g., as described in U.S. Patent No. 4,816,567. In some embodiments, isolated nucleic acid encoding an anti-TfR/BACEl multispecific antibody described herein is provided. Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody). In a further embodiment, one or more vectors (e.g., expression vectors) comprising such nucleic acid are provided. In a further embodiment, a host cell comprising such nucleic acid is provided. In one such embodiment, a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody. In some embodiments, the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NSO, Sp20 cell). In some embodiments, a method of making an anti- TfR/BACEl multispecific antibody is provided, wherein the method comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
[00280] In some embodiments, a method of making a multispecific antibody is provided, wherein the method comprises culturing in a host cell comprising nucleic acid encoding the multispecific antibody under conditions suitable for expression of the antibody, and optionaly recovering the multispecific antibody from the host cell (or host cell culture medium). In some embodiments, a method of making a multispecific antibody is provided, wherein the method comprises culturing a first host cell comprising nucleic acid encoding a first VH/VL unit of the multispecific antibody (including constant region, if any, sometimes referred to as a "hemimer," "half-antibody," or "arm") under conditions suitable for expression of the first VH/VL unit, and optionaly recovering the first VH/VL unit from the host cell (or host cell culture medium), and culturing a second host cell comprising nucleic acid encoding a second VH/VL unit of the multispecific antibody (including constant region, if any) under conditions suitable for expression of the second VH/VL unit, and optionaly recovering the second VH/VL unit from the host cell (or host cell culture medium). In some embodiments, the method further comprises assembling the multispecific antibody from an isolated first VH/VL unit and an isolated second VH/VL unit. Such assembly may comprise, in some embodiments, a redox step to form intramolecular disulfides between the two VH/VL units (or hemimers). Nonlimiting exemplary methods of producing multispecific antibodies are described, e.g., in US 2011/0287009, US 2007/0196363,
US2007/0178552, U.S. Patent No. 5,731,168, WO 96/027011, WO 98/050431, and Zhu et al., 1997, Protein Science 6:781-788. A nonlimiting exemplary method is also described in the examples below.
[00281] For recombinant production of an anti-TfR/BACEl multispecific antibody, nucleic acid encoding an antibody, e.g., as described above, is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell. Such nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
[00282] Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein. For example, antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. For expression of antibody fragments and polypeptides in bacteria, see, e.g., U.S. Patent Nos. 5,648,237,
5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ, 2003), pp. 245-254, describing expression of antibody fragments in E. coli.) After expression, the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
[00283] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized," resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, Nat. Biotech.
22:1409-1414 (2004), and Li et al., Nat. Biotech. 24:210-215 (2006).
[00284] Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
[00285] Plant cell cultures can also be utilized as hosts. See, e.g., US Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES™ technology for producing antibodies in transgenic plants).
[00286] Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CVl line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CVl); African green monkey kidney cells (VE O-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK; buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TPJ cells, as described, e.g., in Mather et al Annals N Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR" CHO cells (Urlaub et al Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as Y0, NS0 and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, NJ), pp. 255-268 (2003).
D. Assays
[00287] Anti-TfR/BACEl multispecific antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
. Binding assays and other assays
[00288] Various techniques are available for determining binding of the antibody to TfR and/or BACEl . One such assay is an enzyme linked immunosorbent assay (ELISA) for confirming an ability to bind to human TfR and/or BACEl . According to this assay, plates coated with antigen (e.g. recombinant TfR or BACEl) are incubated with a sample comprising the antibody and binding of the antibody to the antigen of interest is determined.
[00289] In some aspects, an antibody of the invention is tested for its antigen binding activity, e.g., by known methods such as ELISA, Western blot, etc.
[00290] In another aspect, competition assays may be used to identify an antibody that competes with any of the antibodies of the invention for binding to TfR and/or BACEl. In certain embodiments, such a competing antibody binds to the same epitope (e.g., a linear or a
conformational epitope) that is bound by any of the antibodies of the invention, more specifically, any of the epitopes specifically bound by antibodies in class I, class II, class III or class IV as described herein (see, e.g., Example 1). Detailed exemplary methods for mapping an epitope to which an antibody binds are provided in Morris (1996) "Epitope Mapping Protocols," in Methods in Molecular Biology vol. 66 (Humana Press, Totowa, NJ).
[00291] In an exemplary competition assay, immobilized TfR or BACEl (i.e., antigen) is incubated in a solution comprising a first labeled antibody (e.g., one or more of the antibodies disclosed herein) and a second unlabeled antibody that is being tested for its ability to compete with the first antibody for binding to antigen. The second antibody may be present in a hybridoma supernatant. As a control, immobilized antigen is incubated in a solution comprising the first labeled antibody but not the second unlabeled antibody. After incubation under conditions permissive for binding of the first antibody to antigen, excess unbound antibody is removed, and the amount of label associated with immobilized antigen is measured. If the amount of label associated with immobilized antigen is substantially reduced in the test sample relative to the control sample, then that indicates that the second antibody is competing with the first antibody for binding to the antigen. See Harlow and Lane (1988) Antibodies: A Laboratory Manual ch.14 (Cold Spring Harbor Laboratory, Cold Spring Harbor, NY). 2. Activity assays
[00292] In some aspects, assays are provided for identifying antibodies having biological activity. Biological activity may include, e.g., transporting a compound associated with/conjugated to the antibody across the BBB into the brain and/or CNS. Antibodies having such biological activity in vivo and/or in vitro are also provided.
[00293] In certain embodiments, an antibody of the invention is tested for such biological activity.
E. Immunoconjugates
[00294] The invention also provides immunoconjugates comprising an antibody herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
[00295] In some embodiments, the antibody herein is coupled with a neurological disorder drug, a chemotherapeutic agent and/or an imaging agent in order to more efficiently transport the drug, chemotherapeutic agent and/or the imaging agent across the BBB.
[00296] Covalent conjugation can either be direct or via a linker. In certain embodiments, direct conjugation is by construction of a protein fusion (i.e., by genetic fusion of the two genes encoding the antibody and e.g., the neurological disorder drug and expression as a single protein). In certain embodiments, direct conjugation is by formation of a covalent bond between a reactive group on one of the two portions of the antibody and a corresponding group or acceptor on the, e.g., neurological drug. In certain embodiments, direct conjugation is by modification (i.e., genetic modification) of one of the two molecules to be conjugated to include a reactive group (as nonlimiting examples, a sulfhydryl group or a carboxyl group) that forms a covalent attachment to the other molecule to be conjugated under appropriate conditions. As one nonlimiting example, a molecule (i.e., an amino acid) with a desired reactive group (i.e., a cysteine residue) may be introduced into the antibody and a disulfide bond formed with the e.g., neurological drug.
Methods for covalent conjugation of nucleic acids to proteins are also known in the art (i.e., photocrosslinking, see, e.g., Zatsepin et al. Russ. Chem. Rev. 74: 77-95 (2005))
[00297] Non-covalent conjugation can be by any nonconvalent attachment means, including hydrophobic bonds, ionic bonds, electrostatic interactions, and the like, as will be readily understood by one of ordinary skill in the art.
[00298] Conjugation may also be performed using a variety of linkers. For example, an antibody and a neurological drug may be conjugated using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4- (N-maleimidomethyl) cyclohexane-l-carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HC1), active esters (such as
disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p- azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)- ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate), and bis-active fluorine compounds (such as l,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science 238:1098 (1987). Carbon- 14-labeled 1- isothi ocyanatobenzy 1-3 -methyldi ethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See W094/11026. Peptide linkers, comprised of from one to twenty amino acids joined by peptide bonds, may also be used. In certain such embodiments, the amino acids are selected from the twenty naturally-occurring amino acids. In certain other such embodiments, one or more of the amino acids are selected from glycine, alanine, proline, asparagine, glutamine and lysine. The linker may be a "cleavable linker" facilitating release of the neurological drug upon delivery to the brain. For example, an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari et al., Cancer Res. 52: 127-131 (1992); U.S. Patent No. 5,208,020) may be used.
[00299] The invention herein expressly contemplates, but is not limited to, conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB, SMCC, SMPB, SMPH, sulfo-EMCS, sulfo-GMBS, sulfo- KMUS, sulfo-MBS, sulfo-SIAB, sulfo-SMCC, and sulfo-SMPB, and SVSB (succinimidyl-(4- vinylsulfone)benzoate) which are commercially available (e.g., from Pierce Biotechnology, Inc., ockford, IL., U.S.A).
[00300] In some embodiments, an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see U.S. Patent Nos. 5,208,020, 5,416,064 and European Patent EP 0 425 235 Bl); an auristatin such as monomethylauristatin drug moieties DE and DF (MMAE and MMAF) (see U.S. Patent Nos. 5,635,483 and 5,780,588, and 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see U.S. Patent Nos. 5,712,374, 5,714,586, 5,739,116, 5,767,285, 5,770,701, 5,770,710,
5,773,001, and 5,877,296; Hinman et al., Cancer Res. 53:3336-3342 (1993); and Lode et al., Cancer Res. 58:2925-2928 (1998)); an anthracycline such as daunomycin or doxorubicin (see Kratz et al., Current Med. Chem. 13:477-523 (2006); Jeffrey et al., Bioorganic & Med. Chem. Letters 16:358-362 (2006); Torgov et al., Bioconj. Chem. 16:717-721 (2005); Nagy et al., Proc. Natl. Acad. Sci. USA 97:829-834 (2000); Dubowchik et al., Bioorg. & Med. Chem. Letters 12:1529-1532 (2002); King et al., J. Med. Chem. 45:4336-4343 (2002); and U.S. Patent No. 6,630,579); methotrexate; vindesine; a taxane such as docetaxel, paclitaxel, larotaxel, tesetaxel, and ortataxel; a trichothecene; and CC1065.
[00301] In another embodiment, an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
[00302] In another embodiment, an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate. A variety of radioactive isotopes are available for the production of radioconjugates. Examples include At211, 1131, 1125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu. When the radioconjugate is used for detection, it may comprise a radioactive atom for scintigraphic studies, for example tc99m or 1123, or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, mri), such as iodine-123 again, iodine-131, indium-I l l, fluorine-19, carbon-13, nitrogen- 15, oxygen- 17, gadolinium, manganese or iron.
F. Methods and Compositions for Diagnostics and Detection
[00303] In certain embodiments, any of the antibodies provided herein is useful for detecting the presence of antigen in a biological sample. The term "detecting" as used herein encompasses quantitative or qualitative detection. In certain embodiments, a biological sample comprises a cell or tissue, such as blood (i.e., immature red blood cells), CSF, and BBB-containing tissue.
[00304] In some embodiments, an anti-TfR/BACEl multispecific antibody for use in a method of diagnosis or detection is provided. In a further aspect, a method of detecting the presence of TfR and/or BACE1 in a biological sample is provided. In certain embodiments, the method comprises contacting the biological sample with an antibody as described herein under conditions permissive for binding of the antibody to antigen, and detecting whether a complex is formed between the antibody and antigen. Such method may be an in vitro or in vivo method. In some embodiments, an antibody described herein is used to select subjects eligible for therapy with an anti-TfR/BACEl multispecific antibody, e.g. where TfR and/or BACE1 is a biomarker for selection of patients.
[00305] Exemplary disorders that may be diagnosed using an antibody of the invention includedisorders involving immature red blood cells, due to the fact that TfR is expressed in reticulocytes and is therefore detectable by any of the antibodies of the invention. Such disorders include anemia and other disorders arising from reduced levels of reticulocytes, or congenital polycythemia or neoplastic polycythemia vera, where raised red blood cell counts due to hyperproliferation of, e.g., reticulocytes, results in thickening of blood and concomitant physiological symptoms. .
[00306] In certain embodiments, labeled anti-TfR/BACEl multispecific antibodies are provided. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. Exemplary labels include, but are not limited to, the radioisotopes 32P, 14C, 1251, 3H, and 131I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Patent No. 4,737,456), luciferin, 2,3- dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, β-galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
[00307] In some embodiments, the intact antibody lacks effector function. In another embodiment, the inact antibody has reduced effector function. In another embodiment, the intact antibody is engineered to have reduced effector function. In some aspects, the antibody is a Fab. In another aspect, the antibody has one or more Fc mutations reducing or eliminating effector function. In another aspect, the antibody has modified glycosylation due, e.g., to producing the antibody in a system lacking normal human glycosylation enzymes. In another aspect, the Ig backbone is modified to one which naturally possesses limited or no effector function.
[00308] Various techniques are available for determining binding of the antibody to TfR and/or BACE1. One such assay is an enzyme linked immunosorbent assay (ELISA) for confirming an ability to bind to human TfR and/or BACE1. According to this assay, plates coated with antigen (e.g. recombinant TfR or BACE1) are incubated with a sample comprising the antibody and binding of the antibody to the antigen of interest is determined.
[00309] Assays for evaluating uptake of systemically administered antibody and other biological activity of the antibody can be performed as disclosed in the examples or as known for the anti-CNS antigen antibody of interest.
[00310] In some aspects, assays are provided for identifying anti-TfR/BACEl multispecific antibodies having biological activity. Biological activity may include, e.g., inhibition of BACE1 aspartyl protease activity. Antibodies having such biological activity in vivo and/or in vitro are also provided, e.g. as evaluated by homogeneous time-resolved fluorescence HTRF assay or a microfluidic capillary electrophoretic (MCE) assay using synthetic substrate peptides, or in vivo in cell lines which express BACE1 substrates such as APP.
F. Pharmaceutical Formulations
[00311] Pharmaceutical formulations of an anti-TfR/BACEl multispecific antibody as described herein are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers, excipients or stabilizers {Remington 's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized
formulations or aqueous solutions. Pharmaceutically acceptable carriers, excipients, or stabilizers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol;
resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes {e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). Exemplary pharmaceutically acceptable carriers herein further include insterstitial drug dispersion agents such as soluble neutral-active hyaluronidase glycoproteins (sHASEGP), for example, human soluble PH-20 hyaluronidase glycoproteins, such as rHuPH20 (HYLENEX®, Baxter International, Inc.). Certain exemplary sHASEGPs and methods of use, including rHuPH20, are described in US Patent Publication Nos. 2005/0260186 and 2006/0104968. In some aspects, a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
[00312] Exemplary lyophilized antibody formulations are described in US Patent No.
6,267,958. Aqueous antibody formulations include those described in US Patent No. 6,171,586 and WO2006/044908, the latter formulations including a histidine-acetate buffer.
[00313] The formulation herein may also contain more than one active ingredient as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. For example, it may be desirable to further provide one or more active ingredients for treating a neuropathy disorder, a neurodegenerative disease, cancer, an ocular disease disorder, a seizure disorder, a lysosomal storage disease, an amyloidosis, a viral or microbial disease, ischemia, a behavioral disorder or CNS inflammation. Exemplary such medicaments are discussed hereinbelow. Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
[00314] Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in, for example,
Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). One or more active ingredients may be encapsulated in liposomes that are coupled to anti-Tf /BACEl multispecific antibodies described herein {see e.g., U.S. Patent Application Publication No. 20020025313).
[00315] Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
Nonlimiting examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and γ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUP ON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D- (-)-3-hydroxybutyric acid.
[00316] The formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
G. Therapeutic Methods and Compositions
[00317] Any of the anti-TfR/BACEl multispecific antibodies provided herein may be used in therapeutic methods. In some aspects, an anti-TfR/BACEl multispecific antibody for use as a medicament is provided. For example, the invention provides a method of transporting a therapeutic compound across the blood-brain barrier with reduced or eliminated impact on red blood cell populations comprising exposing the anti-TfR/BACE 1 multispecific antibody to the BBB such that the antibody is transported across the BBB. In another example, the invention provides a method of transporting a neurological disorder drug across the blood-brain barrier comprising exposing an anti-TfR/BACEl multispecific antibody of the invention to the BBB such that the antibody is transported across the BBB with reduced or eliminated impact on red blood cell populations. In some embodiments, the BBB is in a mammal (e.g. a human), e.g. one which has a neurological disorder, including, without limitation: Alzheimer's disease (AD), stroke, dementia, muscular dystrophy (MD), multiple sclerosis (MS), amyotrophic lateral sclerosis (ALS), cystic fibrosis, Angelman's syndrome, Liddle syndrome, Parkinson's disease, Pick's disease, Paget's disease, cancer, traumatic brain injury, etc.
[00318] In some embodiments, the neurological disorder is selected from: a neuropathy, an amyloidosis, cancer (e.g. involving the CNS or brain), an ocular disease or disorder, a viral or microbial infection, inflammation (e.g. of the CNS or brain), ischemia, neurodegenerative disease, seizure, behavioral disorder, lysosomal storage disease, etc. The antibodies of the invention are particularly suited to treatment of such neurological disorders due to their ability to transport one or more associated active ingredients/coupled therapeutic compounds across the BBB and into the CNS/brain where such disorders find their molecular, cellular, or viral/microbial basis.
[00319] Neuropathy disorders are diseases or abnormalities of the nervous system characterized by inappropriate or uncontrolled nerve signaling or lack thereof, and include, but are not limited to, chronic pain (including nociceptive pain), pain caused by an injury to body tissues, including cancer-related pain, neuropathic pain (pain caused by abnormalities in the nerves, spinal cord, or brain), and psychogenic pain (entirely or mostly related to a psychological disorder), headache, migraine, neuropathy, and symptoms and syndromes often accompanying such neuropathy disorders such as vertigo or nausea.
[00320] For a neuropathy disorder, a neurological drug may be selected that is an analgesic including, but not limited to, a narcotic/opioid analgesic (i.e., morphine, fentanyl, hydrocodone, meperidine, methadone, oxymorphone, pentazocine, propoxyphene, tramadol, codeine and oxycodone), a nonsteroidal anti-inflammatory drug (NSAID) (i.e., ibuprofen, naproxen, diclofenac, diflunisal, etodolac, fenoprofen, flurbiprofen, indomethacin, ketorolac, mefenamic acid, meloxicam, nabumetone, oxaprozin, piroxicam, sulindac, and tolmetin), a corticosteroid (i.e., cortisone, prednisone, prednisolone, dexamethasone, methylprednisolone and triamcinolone), an anti-migraine agent (i.e., sumatriptin, almotriptan, frovatriptan, sumatriptan, rizatriptan, eletriptan, zolmitriptan, dihydroergotamine, eletriptan and ergotamine), acetaminophen, a salicylate (i.e., aspirin, choline salicylate, magnesium salicylate, diflunisal, and salsalate), a anti-convulsant (i.e., carbamazepine, clonazepam, gabapentin, lamotrigine, pregabalin, tiagabine, and topiramate), an anaesthetic (i.e., isoflurane, trichloroethylene, halothane, sevoflurane, benzocaine, chloroprocaine, cocaine, cyclomethycaine, dimethocaine, propoxycaine, procaine, novocaine, proparacaine, tetracaine, articaine, bupivacaine, carticaine, cinchocaine, etidocaine, levobupivacaine, lidocaine, mepivacaine, piperocaine, prilocaine, ropivacaine, trimecaine, saxitoxin and tetrodotoxin), and a cox-2-inhibitor (i.e., celecoxib, rofecoxib, and valdecoxib). For a neuropathy disorder with vertigo involvement, a neurological drug may be selected that is an anti-vertigo agent including, but not limited to, meclizine, diphenhydramine, promethazine and diazepam. For a neuropathy disorder with nausea involvement, a neurological drug may be selected that is an anti-nausea agent including, but not limited to, promethazine, chlorpromazine, prochlorperazine, trimethobenzamide, and metoclopramide.
[00321] Amyloidoses are a group of diseases and disorders associated with extracellular proteinaceous deposits in the CNS, including, but not limited to, secondary amyloidosis, age- related amyloidosis, Alzheimer's Disease (AD), mild cognitive impairment (MCI), Lewy body dementia, Down's syndrome, hereditary cerebral hemorrhage with amyloidosis (Dutch type); the Guam Parkinson-Dementia complex, cerebral amyloid angiopathy, Huntington's disease, progressive supranuclear palsy, multiple sclerosis; Creutzfeld Jacob disease, Parkinson's disease, transmissible spongiform encephalopathy, HIV-related dementia, amyotropic lateral sclerosis (ALS), inclusion-body myositis (IBM), and ocular diseases relating to beta-amyloid deposition (i.e., macular degeneration, drusen-related optic neuropathy, and cataract).
[00322] For amyloidosis, a neurological drug may be selected that includes, but is not limited to, an antibody or other binding molecule (including, but not limited to a small molecule, a peptide, an aptamer, or other protein binder) that specifically binds to a target selected from: beta secretase, tau, presenilin, amyloid precursor protein or portions thereof, amyloid beta peptide or oligomers or fibrils thereof, death receptor 6 (D 6), receptor for advanced glycation endproducts (RAGE), parkin, and huntingtin; a cholinesterase inhibitor (i.e., galantamine, donepezil, rivastigmine and tacrine); an NMDA receptor antagonist (i.e., memantine), a monoamine depletor (i.e.,
tetrabenazine); an ergoloid mesylate; an anticholinergic antiparkinsonism agent (i.e., procyclidine, diphenhydramine, trihexylphenidyl, benztropine, biperiden and trihexyphenidyl); a dopaminergic antiparkinsonism agent (i.e., entacapone, selegiline, pramipexole, bromocriptine, rotigotine, selegiline, ropinirole, rasagiline, apomorphine, carbidopa, levodopa, pergolide, tolcapone and amantadine); a tetrabenazine; an anti-inflammatory (including, but not limited to, a nonsteroidal anti-inflammatory drug (i.e., indomethicin and other compounds listed above); a hormone (i.e., estrogen, progesterone and leuprolide); a vitamin (i.e., folate and nicotinamide); a dimebolin; a homotaurine (i.e., 3-aminopropanesulfonic acid; 3APS); a serotonin receptor activity modulator (i.e., xaliproden); an, an interferon, and a glucocorticoid.
[00323] Cancers of the CNS are characterized by aberrant proliferation of one or more CNS cell (i.e., a neural cell) and include, but are not limited to, glioma, glioblastoma multiforme, meningioma, astrocytoma, acoustic neuroma, chondroma, oligodendroglioma, medulloblastomas, ganglioglioma, Schwannoma, neurofibroma, neuroblastoma, and extradural, intramedullary or intradural tumors.
[00324] For cancer, a neurological drug may be selected that is a chemotherapeutic agent. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphor- amide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); delta-9- tetrahydrocannabinol (dronabinol, MARINOL®); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN®), CPT-11 (irinotecan, CAMPTOSAR®), acetylcamptothecin, scopolectin, and 9-aminocamptothecin); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e. g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem Intl. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6- mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6- azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine;
androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfomithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, OR); razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine (ELDISINE®, FILDESIN®); dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); thiotepa; taxoids, e.g., TAXOL® paclitaxel (Bristol-Myers Squibb
Oncology, Princeton, N.J.), ABRAXANETM Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, Illinois), and
TAXOTERE® doxetaxel (Rhone-Poulenc Rorer, Antony, France); chloranbucil; gemcitabine (GEMZAR®); 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carbop latin; vinblastine (VELBAN®); platinum; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine (ONCOVIN®); oxaliplatin; leucovovin; vinorelbine (NAVELBINE®); novantrone; edatrexate; daunomycin; aminopterin; ibandronate; topoisomerase inhibitor RFS 2000;
difluorometlhylornithine (DMFO); retinoids such as retinoic acid; capecitabine (XELODA®); pharmaceutically acceptable salts, acids or derivatives of any of the above; as well as combinations of two or more of the above such as CHOP, an abbreviation for a combined therapy of cyclophosphamide, doxorubicin, vincristine, and prednisolone, and FOLFOX, an abbreviation for a treatment regimen with oxaliplatin (ELOXATINTM) combined with 5-FU and leucovovin.
[00325] Also included in this definition of chemotherapeutic agents are anti-hormonal agents that act to regulate, reduce, block, or inhibit the effects of hormones that can promote the growth of cancer, and are often in the form of systemic, or whole-body treatment. They may be hormones themselves. Examples include anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEX® tamoxifen), EVISTA® raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and
FARESTON® toremifene; anti-progesterones; estrogen receptor down-regulators (ERDs); agents that function to suppress or shut down the ovaries, for example, leutinizing hormone-releasing hormone (LHRH) agonists such as LUPRON® and ELIGARD® leuprolide acetate, goserelin acetate, buserelin acetate and tripterelin; other anti-androgens such as flutamide, nilutamide and bicalutamide; and aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® megestrol acetate, AROMASIN® exemestane, formestanie, fadrozole, RIVISOR® vorozole, FEMARA® letrozole, and ARIMIDEX® anastrozole. In addition, such definition of chemotherapeutic agents includes bisphosphonates such as clodronate (for example, BONEFOS® or OSTAC®), DIDROCAL® etidronate, NE-58095, ZOMETA® zoledronic acid/zoledronate, FOSAMAX® alendronate, AREDIA® pamidronate, SKELID® tiludronate, or ACTONEL® risedronate; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); antisense oligonucleotides, particularly those that inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, such as, for example, PKC-alpha, af, H-Ras, and epidermal growth factor receptor (EGF-R); vaccines such as THERATOPE® vaccine and gene therapy vaccines, for example, ALLOVECTIN® vaccine, LEUVECTIN® vaccine, and VAXID® vaccine; LURTOTECAN® topoisomerase 1 inhibitor; ABARELIX® rmRH; lapatinib ditosylate (an ErbB-2 and EGFR dual tyrosine kinase small-molecule inhibitor also known as GW572016); and pharmaceutically acceptable salts, acids or derivatives of any of the above.
[00326] Another group of compounds that may be selected as neurological drugs for cancer treatment or prevention are anti-cancer immunoglobulins (including, but not limited to, trastuzumab, pertuzumab, bevacizumab, alemtuxumab, cetuximab, gemtuzumab ozogamicin, ibritumomab tiuxetan, panitumumab and rituximab). In some instances, antibodies in conjunction with a toxic label or conjugate may be used to target and kill desired cells (i.e., cancer cells), including, but not limited to, tositumomab with a 131I radiolabel, or trastuzumab emtansine.
[00327] Ocular diseases or disorders are diseases or disorders of the eye, which for the purposes herein is considered a CNS organ segregated by the BBB. Ocular diseases or disorders include, but are not limited to, disorders of sclera, cornea, iris and ciliary body (i.e., scleritis, keratitis, corneal ulcer, corneal abrasion, snow blindness, arc eye, Thygeson's superficial punctate keratopathy, corneal neovascularisation, Fuchs' dystrophy, keratoconus, keratoconjunctivitis sicca, iritis and uveitis), disorders of the lens (i.e., cataract), disorders of choroid and retina (i.e., retinal detachment, retinoschisis, hypertensive retinopathy, diabetic retinopathy, retinopathy, retinopathy of prematurity, age-related macular degeneration, macular degeneration (wet or dry), epiretinal membrane, retinitis pigmentosa and macular edema), glaucoma, floaters, disorders of optic nerve and visual pathways (i.e., Leber's hereditary optic neuropathy and optic disc drusen), disorders of ocular muscles/binocular movement accommodation/refraction (i.e., strabismus, ophthalmoparesis, progressive external opthalmoplegia, esotropia, exotropia, hypermetropia, myopia, astigmatism, anisometropia, presbyopia and ophthalmoplegia), visual disturbances and blindness (i.e., amblyopia, Lever's congenital amaurosis, scotoma, color blindness, achromatopsia, nyctalopia, blindness, river blindness and micro-opthalmia/coloboma), red eye, Argyll Robertson pupil, keratomycosis, xerophthalmia and andaniridia.
[00328] For an ocular disease or disorder, a neurological drug may be selected that is an anti- angiogenic ophthalmic agent (i.e., bevacizumab, ranibizumab and pegaptanib), an ophthalmic glaucoma agent (i.e., carbachol, epinephrine, demecarium bromide, apraclonidine, brimonidine, brinzolamide, levobunolol, timolol, betaxolol, dorzolamide, bimatoprost, carteolol, metipranolol, dipivefrin, travoprost and latanoprost), a carbonic anhydrase inhibitor (i.e., methazolamide and acetazolamide), an ophthalmic antihistamine (i.e., naphazoline, phenylephrine and tetrahydrozoline), an ocular lubricant, an ophthalmic steroid (i.e., fluorometholone, prednisolone, loteprednol, dexamethasone, difluprednate, rimexolone, fluocinolone, medrysone and
triamcinolone), an ophthalmic anesthetic (i.e., lidocaine, proparacaine and tetracaine), an ophthalmic anti-infective (i.e., levofloxacin, gatifloxacin, ciprofloxacin, moxifloxacin, chloramphenicol, bacitracin/polymyxin b, sulfacetamide, tobramycin, azithromycin, besifloxacin, norfloxacin, sulfisoxazole, gentamicin, idoxuridine, erythromycin, natamycin, gramicidin, neomycin, ofloxacin, trifluridine, ganciclovir, vidarabine), an ophthalmic anti-inflammatory agent (i.e., nepafenac, ketorolac, flurbiprofen, suprofen, cyclosporine, triamcinolone, diclofenac and bromfenac), and an ophthalmic antihistamine or decongestant (i.e., ketotifen, olopatadine, epinastine, naphazoline, cromolyn, tetrahydrozoline, pemirolast, bepotastine, naphazoline, phenylephrine, nedocromil, lodoxamide, phenylephrine, emedastine and azelastine).
[00329] Viral or microbial infections of the CNS include, but are not limited to, infections by viruses (i.e., influenza, HIV, poliovirus, rubella, ), bacteria (i.e., Neisseria sp., Streptococcus sp., Pseudomonas sp., Proteus sp., E. coli, S. aureus, Pneumococcus sp., Meningococcus sp.,
Haemophilus sp., and Mycobacterium tuberculosis) and other microorganisms such as fungi (i.e., yeast, Cryptococcus neoformans), parasites (i.e., toxoplasma gondii) or amoebas resulting in CNS pathophysiologies including, but not limited to, meningitis, encephalitis, myelitis, vasculitis and abscess, which can be acute or chronic.
[00330] For a viral or microbial disease, a neurological drug may be selected that includes, but is not limited to, an antiviral compound (including, but not limited to, an adamantane antiviral (i.e., rimantadine and amantadine), an antiviral interferon (i.e., peginterferon alfa-2b), a chemokine receptor antagonist (i.e., maraviroc), an integrase strand transfer inhibitor (i.e., raltegravir), a neuraminidase inhibitor (i.e., oseltamivir and zanamivir), a non-nucleoside reverse transcriptase inhibitor (i.e., efavirenz, etravirine, delavirdine and nevirapine), a nucleoside reverse transcriptase inhibitors (tenofovir, abacavir, lamivudine, zidovudine, stavudine, entecavir, emtricitabine, adefovir, zalcitabine, telbivudine and didanosine), a protease inhibitor (i.e., darunavir, atazanavir, fosamprenavir, tipranavir, ritonavir, nelfinavir, amprenavir, indinavir and saquinavir), a purine nucleoside (i.e., valacyclovir, famciclovir, acyclovir, ribavirin, ganciclovir, valganciclovir and cidofovir), and a miscellaneous antiviral (i.e., enfuvirtide, foscarnet, palivizumab and fomivirsen)), an antibiotic (including, but not limited to, an aminopenicillin (i.e., amoxicillin, ampicillin, oxacillin, nafcillin, cloxacillin, dicloxacillin, flucoxacillin, temocillin, azlocillin, carbenicillin, ticarcillin, mezlocillin, piperacillin and bacampicillin), a cephalosporin (i.e., cefazolin, cephalexin, cephalothin, cefamandole, ceftriaxone, cefotaxime, cefpodoxime, ceftazidime, cefadroxil, cephradine, loracarbef, cefotetan, cefuroxime, cefprozil, cefaclor, and cefoxitin), a
carbapenem/penem (i.e., imipenem, meropenem, ertapenem, faropenem and doripenem), a monobactam (i.e., aztreonam, tigemonam, norcardicin A and tabtoxinine-beta- lactam, a beta- lactamase inhibitor (i.e., clavulanic acid, tazobactam and sulbactam) in conjunction with another beta-lactam antibiotic, an aminoglycoside (i.e., amikacin, gentamicin, kanamycin, neomycin, netilmicin, streptomycin, tobramycin, and paromomycin), an ansamycin (i.e., geldanamycin and herbimycin), a carbacephem (i.e., loracarbef), a glycopeptides (i.e., teicoplanin and vancomycin), a macrolide (i.e., azithromycin, clarithromycin, dirithromycin, erythromycin, roxithromycin, troleandomycin, telithromycin and spectinomycin), a monobactam (i.e., aztreonam), a quinolone (i.e., ciprofloxacin, enoxacin, gatifloxacin, levofloxacin, lomefloxacin, moxifloxacin, norfloxacin, ofloxacin, trovafloxacin, grepafloxacin, sparfloxacin and temafloxacin), a sulfonamide (i.e., mafenide, sulfonamidochrysoidine, sulfacetamide, sulfadiazine, sulfamethizole, sulfanilamide, sulfasalazine, sulfisoxazole, trimethoprim, trimethoprim and sulfamethoxazole), a tetracycline (i.e., tetracycline, demeclocycline, doxycycline, minocycline and oxytetracycline), an antineoplastic or cytotoxic antibiotic (i.e., doxorubicin, mitoxantrone, bleomycin, daunorubicin, dactinomycin, epirubicin, idarubicin, plicamycin, mitomycin, pentostatin and valrubicin) and a miscellaneous antibacterial compound (i.e., bacitracin, colistin and polymyxin B)), an antifungal (i.e., metronidazole, nitazoxanide, tinidazole, chloroquine, iodoquinol and paromomycin), and an antiparasitic (including, but not limited to, quinine, chloroquine, amodiaquine, pyrimethamine, sulphadoxine, proguanil, mefloquine, atovaquone, primaquine, artemesinin, halofantrine, doxycycline, clindamycin, mebendazole, pyrantel pamoate, thiabendazole, diethylcarbamazine, ivermectin, rifampin, amphotericin B, melarsoprol, efornithine and albendazole).
[00331] Inflammation of the CNS includes, but is not limited to, inflammation that is caused by an injury to the CNS, which can be a physical injury (i.e., due to accident, surgery, brain trauma, spinal cord injury, concussion) and an injury due to or related to one or more other diseases or disorders of the CNS (i.e., abscess, cancer, viral or microbial infection).
[00332] For CNS inflammation, a neurological drug may be selected that addresses the inflammation itself (i.e., a nonsteroidal anti-inflammatory agent such as ibuprofen or naproxen), or one which treats the underlying cause of the inflammation (i.e., an anti-viral or anti-cancer agent).
[00333] Ischemia of the CNS, as used herein, refers to a group of disorders relating to aberrant blood flow or vascular behavior in the brain or the causes therefor, and includes, but is not limited to: focal brain ischemia, global brain ischemia, stroke (i.e., subarachnoid hemorrhage and intracerebral hemorrhage), and aneurysm.
[00334] For ischemia, a neurological drug may be selected that includes, but is not limited to, a thrombolytic (i.e., urokinase, alteplase, reteplase and tenecteplase), a platelet aggregation inhibitor (i.e., aspirin, cilostazol, clopidogrel, prasugrel and dipyridamole), a statin (i.e., lovastatin, pravastatin, fluvastatin, rosuvastatin, atorvastatin, simvastatin, cerivastatin and pitavastatin), and a compound to improve blood flow or vascular flexibility, including, e.g., blood pressure medications.
[00335] Neurodegenerative diseases are a group of diseases and disorders associated with neural cell loss of function or death in the CNS, and include, but are not limited to:
adrenoleukodystrophy, Alexander's disease, Alper's disease, amyotrophic lateral sclerosis, ataxia telangiectasia, Batten disease, cockayne syndrome, corticobasal degeneration, degeneration caused by or associated with an amyloidosis, Friedreich's ataxia, frontotemporal lobar degeneration, Kennedy's disease, multiple system atrophy, multiple sclerosis, primary lateral sclerosis, progressive supranuclear palsy, spinal muscular atrophy, transverse myelitis, efsum's disease, and spinocerebellar ataxia.
[00336] For a neurodegenerative disease, a neurological drug may be selected that is a growth hormone or neurotrophic factor; examples include but are not limited to brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF), neurotrophin-4/5, fibroblast growth factor (FGF)-2 and other FGFs, neurotrophin (NT)-3, erythropoietin (EPO), hepatocyte growth factor (HGF), epidermal growth factor (EGF), transforming growth factor (TGF)-alpha, TGF-beta, vascular endothelial growth factor (VEGF), interleukin-1 receptor antagonist (IL-lra), ciliary neurotrophic factor (CNTF), glial-derived neurotrophic factor (GDNF), neurturin, platelet- derived growth factor (PDGF), heregulin, neuregulin, artemin, persephin, interleukins, glial cell line derived neurotrophic factor (GFPv), granulocyte-colony stimulating factor (CSF), granulocyte-macrophage-CSF, netrins, cardiotrophin-1, hedgehogs, leukemia inhibitory factor (LIF), midkine, pleiotrophin, bone morphogenetic proteins (BMPs), netrins, saposins, semaphorins, and stem cell factor (SCF).
[00337] Seizure diseases and disorders of the CNS involve inappropriate and/or abnormal electrical conduction in the CNS, and include, but are not limited to epilepsy (i.e., absence seizures, atonic seizures, benign Rolandic epilepsy, childhood absence, clonic seizures, complex partial seizures, frontal lobe epilepsy, febrile seizures, infantile spasms, juvenile myoclonic epilepsy, juvenile absence epilepsy, Lennox-Gastaut syndrome, Landau-Kleffher Syndrome, Dravet's syndrome, Otahara syndrome, West syndrome, myoclonic seizures, mitochondrial disorders, progressive myoclonic epilepsies, psychogenic seizures, reflex epilepsy, Rasmussen's Syndrome, simple partial seizures, secondarily generalized seizures, temporal lobe epilepsy, toniclonic seizures, tonic seizures, psychomotor seizures, limbic epilepsy, partial-onset seizures, generalized- onset seizures, status epilepticus, abdominal epilepsy, akinetic seizures, autonomic seizures, massive bilateral myoclonus, catamenial epilepsy, drop seizures, emotional seizures, focal seizures, gelastic seizures, Jacksonian March, Lafora Disease, motor seizures, multifocal seizures, nocturnal seizures, photosensitive seizure, pseudo seizures, sensory seizures, subtle seizures, sylvan seizures, withdrawal seizures, and visual reflex seizures). [00338] For a seizure disorder, a neurological drug may be selected that is an anticonvulsant or antiepileptic including, but not limited to, barbiturate anticonvulsants (i.e., primidone, metharbital, mephobarbital, allobarbital, amobarbital, aprobarbital, alphenal, barbital, brallobarbital and phenobarbital), benzodiazepine anticonvulsants (i.e., diazepam, clonazepam, and lorazepam), carbamate anticonvulsants (i.e. felbamate), carbonic anhydrase inhibitor anticonvulsants (i.e., acetazolamide, topiramate and zonisamide), dibenzazepine anticonvulsants (i.e., rufinamide, carbamazepine, and oxcarbazepine), fatty acid derivative anticonvulsants (i.e., divalproex and valproic acid), gamma-aminobutyric acid analogs (i.e., pregabalin, gabapentin and vigabatrin), gamma-aminobutyric acid reuptake inhibitors (i.e., tiagabine), gamma-aminobutyric acid transaminase inhibitors (i.e., vigabatrin), hydantoin anticonvulsants (i.e. phenytoin, ethotoin, fosphenytoin and mephenytoin), miscellaneous anticonvulsants (i.e., lacosamide and magnesium sulfate), progestins (i.e., progesterone), oxazolidinedione anticonvulsants (i.e., paramethadione and trimethadione), pyrrolidine anticonvulsants (i.e., levetiracetam), succinimide anticonvulsants (i.e., ethosuximide and methsuximide), triazine anticonvulsants (i.e., lamotrigine), and urea
anticonvulsants (i.e., phenacemide and pheneturide).
[00339] Behavioral disorders are disorders of the CNS characterized by aberrant behavior on the part of the afflicted subject and include, but are not limited to: sleep disorders (i.e., insomnia, parasomnias, night terrors, circadian rhythm sleep disorders, and narcolepsy), mood disorders (i.e., depression, suicidal depression, anxiety, chronic affective disorders, phobias, panic attacks, obsessive-compulsive disorder, attention deficit hyperactivity disorder (ADHD), attention deficit disorder (ADD), chronic fatigue syndrome, agoraphobia, post-traumatic stress disorder, bipolar disorder), eating disorders (i.e., anorexia or bulimia), psychoses, developmental behavioral disorders (i.e., autism, Rett's syndrome, Aspberger's syndrome), personality disorders and psychotic disorders (i.e., schizophrenia, delusional disorder, and the like).
[00340] For a behavioral disorder, a neurological drug may be selected from a behavior- modifying compound including, but not limited to, an atypical antipsychotic (i.e., risperidone, olanzapine, apripiprazole, quetiapine, paliperidone, asenapine, clozapine, iloperidone and ziprasidone), a phenothiazine antipsychotic (i.e., prochlorperazine, chlorpromazine, fluphenazine, perphenazine, trifluoperazine, thioridazine and mesoridazine), a thioxanthene (i.e., thiothixene), a miscellaneous antipsychotic (i.e., pimozide, lithium, molindone, haloperidol and loxapine), a selective serotonin reuptake inhibitor (i.e., citalopram, escitalopram, paroxetine, fluoxetine and sertraline), a serotonin-norepinephrine reuptake inhibitor (i.e., duloxetine, venlafaxine, desvenlafaxine, a tricyclic antidepressant (i.e., doxepin, clomipramine, amoxapine, nortriptyline, amitriptyline, trimipramine, imipramine, protriptyline and desipramine), a tetracyclic
antidepressant (i.e., mirtazapine and maprotiline), a phenylpiperazine antidepressant (i.e., trazodone and nefazodone), a monoamine oxidase inhibitor (i.e., isocarboxazid, phenelzine, selegiline and tranylcypromine), a benzodiazepine (i.e., alprazolam, estazolam, flurazeptam, clonazepam, lorazepam and diazepam), a norepinephrine-dopamine reuptake inhibitor (i.e., bupropion), a CNS stimulant (i.e., phentermine, diethylpropion, methamphetamine,
dextroamphetamine, amphetamine, methylphenidate, dexmethylphenidate, lisdexamfetamine, modafinil, pemoline, phendimetrazine, benzphetamine, phendimetrazine, armodafinil, diethylpropion, caffeine, atomoxetine, doxapram, and mazindol), an anxiolytic/sedative/hypnotic (including, but not limited to, a barbiturate (i.e., secobarbital, phenobarbital and mephobarbital), a benzodiazepine (as described above), and a miscellaneous anxiolytic/sedative/hypnotic (i.e.
diphenhydramine, sodium oxybate, zaleplon, hydroxyzine, chloral hydrate, aolpidem, buspirone, doxepin, eszopiclone, ramelteon, meprobamate and ethclorvynol)), a secretin (see, e.g., Ratliff- Schaub et al. Autism 9: 256-265 (2005)), an opioid peptide (see, e.g., Cowen et al., J. Neurochem. 89:273-285 (2004)), and a neuropeptide (see, e.g., Hethwa et al. Am. J. Physiol. 289: E301-305 (2005)).
[00341] Lysosomal storage disorders are metabolic disorders which are in some cases associated with the CNS or have CNS-specific symptoms; such disorders include, but are not limited to: Tay-Sachs disease, Gaucher's disease, Fabry disease, mucopolysaccharidosis (types I, II, III, IV, V, VI and VII), glycogen storage disease, GM1 -gangliosidosis, metachromatic leukodystrophy, Farber's disease, Canavan's leukodystrophy, and neuronal ceroid lipofuscinoses types 1 and 2, Niemann-Pick disease, Pompe disease, and Krabbe's disease.
[00342] For a lysosomal storage disease, a neurological drug may be selected that is itself or otherwise mimics the activity of the enzyme that is impaired in the disease. Exemplary recombinant enzymes for the treatment of lysosomal storage disorders include, but are not limited to those set forth in e.g., U.S. Patent Application publication no. 2005/0142141 (i.e., alpha-L- iduronidase, iduronate-2-sulphatase, N-sulfatase, alpha-N-acetylglucosaminidase, N-acetyl- galactosamine-6-sulfatase, beta-galactosidase, arylsulphatase B, beta-glucuronidase, acid alpha- glucosidase, glucocerebrosidase, alpha-galactosidase A, hexosaminidase A, acid
sphingomyelinase, beta-galactocerebrosidase, beta-galactosidase, arylsulfatase A, acid ceramidase, aspartoacylase, palmitoyl-protein thioesterase 1 and tripeptidyl amino peptidase 1).
[00343] In another embodiment, diseases related to or caused by inappropriate overproduction of red blood cells, or wherein the overproduction of red blood cells is an effect of the disease, can be prevented or treated by the reticulocyte-depleting effect recognized herein of anti-TfR antibodies retaining at least partial effector function. For example, in congenital or neoplastic polycythemia vera, elevated red blood cell counts due to hyperproliferation of, e.g., reticulocytes, results in thickening of blood and concomitant physiological symptoms (d'Onofrio et al., Clin. Lab. Haematol. (1996) Suppl. 1 : 29-34). Administration of an anti-TfR/BACEl multispecific antibody of the invention wherein at least partial effector function of the antibody was preserved would permit selective removal of immature reticulocyte populations without impacting normal transferrin transport into the CNS. Dosing of such an antibody could be modulated such that acute clinical symptoms could be minimized (ie, by dosing at a very low dose or at widely-spaced intervals), as well-understood in the art.
[00344] In some aspects, an antibody of the invention is used to detect a neurological disorder before the onset of symptoms and/or to assess the severity or duration of the disease or disorder. In some aspects, the antibody permits detection and/or imaging of the neurological disorder, including imaging by radiography, tomography, or magnetic resonance imaging (MRI).
[00345] In some aspects, an anti-TfR/BACEl multispecific antibody for use as a medicament is provided. In some embodiments, the anti-TfR/BACEl multispecific antibody has low affinity for TfR. In further aspects, an anti-TfR/BACEl multispecific antibody for use in treating a neurological disease or disorder (e.g., Alzheimer's disease) without depleting red blood cells (ie, reticulocytes) is provided. In certain embodiments, a modified anti-TfR/BACEl multispecific antibody with low affinity for TfR for use in a method of treatment as described herein is provided. In certain embodiments, the invention provides an anti-TfR/BACEl multispecific antibody that has been modified to improve its safety for use in a method of treating an individual having a neurological disease or disorder comprising administering to the individual an effective amount of the anti-TfR/BACEl antibody. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent. In further embodiments, the invention provides an anti-TfR/BACEl multispecific antibody modified to improve its safety for use in reducing or inhibiting amlyoid plaque formation in a patient at risk or suffering from a neurological disease or disorder (e.g., Alzheimer's disease). An "individual" according to any of the above embodiments is optionally a human. In certain aspects, the anti- TfR/BACEl multispecific antibody of the invention for use in the methods of the invention improves uptake of the neurological disorder drug with which it is coupled.
[00346] In a further aspect, the invention provides for the use of an anti-TfR/BACEl multispecific antibody of the invention in the manufacture or preparation of a medicament. In some embodiments, the anti-TfR/BACEl multispecific antibody has low affinity for TfR. In some embodiments, the medicament is for treatment of neurological disease or disorder. In a further embodiment, the medicament is for use in a method of treating neurological disease or disorder comprising administering to an individual having neurological disease or disorder an effective amount of the medicament. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent. [00347] In a further aspect, the invention provides a method for treating Alzheimer's disease. In some embodiments, the method comprises administering to an individual having Alzheimer's disease an effective amount of an anti-TfR/BACEl multispecific antibody of the invention. In one such embodiment, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent. An "individual" according to any of the above embodiments may be a human.
[00348] The anti-TfR/BACEl multispecific antibodies of the invention can be used either alone or in combination with other agents in a therapy. For instance, the anti-TfR/BACEl multispecific antibody of the invention may be co-administered with at least one additional therapeutic agent. In certain embodiments, an additional therapeutic agent is a therapeutic agent effective to treat the same or a different neurological disorder as the anti-TfR/BACEl multispecific antibody is being employed to treat. Exemplary additional therapeutic agents include, but are not limited to: the various neurological drugs described above, cholinesterase inhibitors (such as donepezil, galantamine, rovastigmine, and tacrine), NMDA receptor antagonists (such as memantine), amyloid beta peptide aggregation inhibitors, antioxidants, γ-secretase modulators, nerve growth factor (NGF) mimics or NGF gene therapy, PPARy agonists, HMS-CoA reductase inhibitors (statins), ampakines, calcium channel blockers, GABA receptor antagonists, glycogen synthase kinase inhibitors, intravenous immunoglobulin, muscarinic receptor agonists, nicrotinic receptor modulators, active or passive amyloid beta peptide immunization, phosphodiesterase inhibitors, serotonin receptor antagonists and anti-amyloid beta peptide antibodies. In certain embodiments, the at least one additional therapeutic agent is selected for its ability to mitigate one or more side effects of the neurological drug.
[00349] As exemplified herein, certain anti-TfR/BACEl multispecific antibodies may have side effects that negatively impact reticulocyte populations in a subject treated with the anti- TfR/BACEl multispecific antibody. Thus, in certain embodiments, at least one further therapeutic agent selected for its ability to mitigate such negative side effect on reticulocyte populations is coadministered with an anti-TfR/BACEl multispecific antibody of the invention. Examples of such therapeutic agents include, but are not limited to, agents to increase red blood cell (ie, reticulocyte) populations, agents to support growth and development of red blood cells (ie, reticulocytes), and agents to protect red blood cell populations from the effects of the anti- TfR/BACEl multispecific antibody; such agents include, but are not limited to, erythropoietin (EPO), iron supplements, vitamin C, folic acid, and vitamin B12, as well as physical replacement of red blood cells (ie, reticulocytes) by, for example, transfusion with similar cells, which may be from another individual of similar blood type or may have been previously extracted from the subject to whom the anti-TfR/BACEl multispecific antibody is administered. It will be understood by one of ordinary skill in the art that in some instances, agents intended to protect existing red blood cells (ie, reticulocytes) are preferably administered to the subject preceding or concurrent with the anti-TfR/BACEl multispecific antibody therapy, while agents intended to support or initiate the regrowth/development of red blood cells or blood cell populations (ie, reticulocytes or reticulocyte populations) are preferably administered concurrent with or after the anti-TfR/BACEl multispecific antibody therapy such that such blood cells can be replenished after the anti- TfR/BACEl multispecific antibody treatment.
[00350] In certain other such embodiments, the at least one further therapeutic agent is selected for its ability to inhibit or prevent the activation of the complement pathway upon administration of the anti-TfR/BACEl multispecific antibody. Examples of such therapeutic agents include, but are not limited to, agents that interfere with the ability of the anti-TfR/BACEl multispecific antibody to bind to or activate the complement pathway and agents that inhibit one or more molecular interactions within the complement pathway, and are described generally in Mollnes and
Kirschfink (2006) Molec. Immunol. 43:107-121, the contents of which are expressly incorporated herein by reference.
[00351] Such combination therapies noted above and herein encompass combined
administration (where two or more therapeutic agents are included in the same or separate formulations), and separate administration, in which case, administration of the antibody of the invention can occur prior to, simultaneously, and/or following, administration of the additional therapeutic agent and/or adjuvant. In some embodiments, administration of the anti-TfR/BACEl multispecific antibody and administration of an additional therapeutic agent occur within about one month, or within about one, two or three weeks, or within about one, two, three, four, five or six days, of each other. Antibodies of the invention can also be used in combination with other interventional therapies such as, but not limited to, radiation therapy, behavioral therapy, or other therapies known in the art and appropriate for the neurological disorder to be treated or prevented.
[00352] An anti-TfR/BACEl multispecific antibody of the invention (and any additional therapeutic agent) can be administered by any suitable means, including parenteral,
intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosing schedules including but not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion are contemplated herein.
[00353] Antibodies of the invention would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners. The antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question or to prevent, mitigate or ameliorate one or more side effects of antibody administration. The effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99% of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
[00354] For the prevention or treatment of disease, the appropriate dosage of an antibody of the invention (when used alone or in combination with one or more other additional therapeutic agents) will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The antibody is suitably administered to the patient at one time or over a series of treatments. Depending on the type and severity of the disease, about 1 μg/kg to 15 mg/kg (e.g. 0.1 mg/kg- lOmg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. One typical daily dosage might range from about 1 μg/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs. One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 40 mg/kg. Thus, one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg, 5.0 mg/kg, 7.5 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg or 40 mg/kg (or any combination thereof) may be administered to the patient. Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the antibody). An initial higher loading dose, followed by one or more lower doses may be administered. However, other dosage regimens may be useful. It will be appreciated that one method to reduce impact on reticulocyte populations by administration of anti-Tf /BACEl multispecific antibodies is to modify the amount or timing of the doses such that overall lower quantities of circulating antibody are present in the bloodstream to interact with reticulocytes. In one nonlimiting example, a lower dose of the anti-TfR/BACEl multispecific antibodies may be administered with greater frequency than a higher dose would be. The dosage used may be balanced between the amount of antibody necessary to be delivered to the CNS (itself related to the affinity of the CNS antigen-specific portion of the antibody), the affinity of that antibody for TfR, and whether or not red blood cell (ie, reticulocyte) -protecting, growth and development-stimulating, or complement pathway-inhibiting compound(s) are being co- or serially administered with the antibody. The progress of this therapy is easily monitored by conventional techniques and assays as described herein and as known in the art.
[00355] It is understood that any of the above formulations or therapeutic methods may be carried out using an immunoconjugate of the invention in place of or in addition to an anti- TfR/BACEl multispecific antibody.
H. Articles of Manufacture
[00356] In another aspect of the invention, an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above is provided. The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds a composition which is by itself or combined with another composition effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). At least one active agent in the composition is an antibody of the invention. The label or package insert indicates that the composition is used for treating the condition of choice. Moreover, the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises an antibody of the invention; and (b) a second container with a composition contained therein, wherein the composition comprises a further cytotoxic or otherwise therapeutic agent. The article of manufacture in this embodiment of the invention may further comprise a package insert indicating that the compositions can be used to treat a particular condition. Alternatively, or additionally, the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically- acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
[00357] It is understood that any of the above articles of manufacture may include a bispecific antibody immunoconjugate of the invention in place of or in addition to a bispecific antibody of the invention. EXAMPLES
EXAMPLE 1: GENERATION, CHARACTERIZATION AND HUMANIZATION OF HUMAN/CYNO CROSS-REACTIVE ANTI-TFR ANTIBODIES
[00358] Initially, a naive antibody phage panning process was performed in an attempt to identify antibodies cross-reactive with both human Tf and Tf from cynomolgous ("cyno") monkeys that further did not compete with Tf for binding to TfR {Lee et al. JMB (2004) 1073- 1093). No such cross-reactive, non-Tf-competing clone was identified from this phage panning process. However, two antibodies were identified that were useful in characterizing subsequently generated hybridoma clones.
[00359] A species cross-reactive antibody was identified that competes with Tf for binding to human or cyno TfR (Tf-competing antibody). The epitope of another clone, specific for human TfR, was mapped to the apical domain of huTfR using mouse/human chimeric TfR receptors (Figure 1). This apical domain-binding clone lost binding to huTfR when the mouse TfR sequence in the apical domain was substituted into huTfR.
[00360] Next, an immunization-based approach to generate cross-reactive anti-human/cyno TfR antibodies was performed. Human TfR extracellular domain ("ecd") containing an N-terminal His tag and human hemachromatosis protein ("HFE") were expressed and purified as described (Bennet et al, Nature (2000) 403, 46-53). An analogous cyno TfR ecd construct was also made. Cyno TfR was expressed and purified in a similar manner. Human and cyno cross-reactive TfR antibodies were generated by immunizing 5 Balb/C mice in the footpad with 6 doses (twice per week) containing 2 μg each of cynoTfR and huTfR ecd. All mice sera were FACS positive and all mice were fused. Of 1632 hybridomas screened, 111 were ELISA positive for binding to both human and cyno TfR.
[00361] The resulting ELISA-positive hybridomas were screened by FACS in the presence of 1 μΜ human holo-Tf for binding to 293 cells transiently expressing human or cyno TfR. Briefly, FACS analysis was performed using 293 cells transfected with full length human or cyno TfR using lipofectamin 2000 plus (Invitrogen) 48-72 h before FACS analysis. Non-transfected (control) and transfected 293 cells were washed twice with FACS buffer (PBS containing 1% BSA), 50 μΐ of hybridoma supernatant (normalized to 10 μg/ml) was added to 293 cells in the presence of 1 μΜ human holo-Tf and incubated on ice for 30 min. Cells were washed twice with FACS buffer, 50 μΐ of PE-Goat-anti-murine Fey (Jackson ImmunoResearch) was added to cells and they were incubated on ice for 30 min. Cells were washed with FACS buffer and resuspended in ΙΟΟμΙ FACS buffer for analysis.
[00362] 14 clones were positive for binding to both human and cyno TfR (Figures 2A and 2B). These clones were further subcloned and evaluated for binding to both human and cyno TfR by ELISA, and epitope mapped on huTfR using the apical binding phage clone identified above. Briefly, the apical domain phage competition ELISA was performed in maxisorp plates coated with 2 μg/ml of purified human or cyno Tf in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using Superblock with casein (Thermo Scientific, Hudson, NH). A 30 μΐ aliquot of hybridoma supernatant (normalized to 10 μg/ml) was added to each well for 45 min. This was followed by the addition of 30 μΐ apical domain-binding phage at OD 0.05 for 15 min. Plates were washed with PBS/0.05% Tween 20 and 1 : 1000 diluted HRP-Mouse-anti M13 (GE healthcare) was added the plate and incubated for 1 h at room temperature. Plates were washed with PBS/0.05% Tween 20 and bound phage were detected using TMB substrate (BioFX Laboratories, Owings Mills). Nine of the fourteen clones were found to block binding of the apical binding antibody displayed on phage (see Figure 2C).
[00363] Antibody affinities were measured using surface plasmon resonance ("SPR")
(Biacore™, GE Healthcare). Anti-His antibody (Qiagen) was coupled onto four different flow cells of a BIACORE™ CM5 sensor chip (Biacore, Inc., Piscataway, NJ) at between 6000 and 8000 RU. Immobilization was achieved by random coupling through amino groups using a protocol provided by the manufacturer. 10X HBS-P (Biacore, Inc., Piscataway, NJ) was diluted in water and served as the dilution and running buffer. Purified human or cyno TfR was captured, followed by a 3-fold dilution series of IgG or Fab that was injected at a flow rate of 30 ml/min using the single cycle kinetics method. Affinity constants were determined using a simple 1 : 1 Langmuir binding model or using a steady state model when kon or k0ff was beyond the detection limit. The equilibrium dissociation constant (KD) was calculated as the ratio of association rate constant (kon) and dissociation rate constant (k0ff). The results are shown in Figure 2C.
[00364] Each hybridoma was cloned. Total RNA was isolated from hybridoma using an RNeasy mini kit (Qiagen). cDNA was generated using a SMART 5' RACE cDNA Amplification kit (Clontech) based on the manufacturer's instructions. The variable region of each antibody was amplified using UPM (5 ' oligo) provided in the kit and a 3 ' oligo that anneals to the constant region. The entire PCR product was then cloned into pCR4Blunt-TOPO vector (Invitrogen) for sequencing. After sequence analysis, the hybridomas could be further subdivided into 4 groups (Figures 3A-3D). Clones that competed with the apical binding antibody fell into 3 related sequence classes (Figure 3 A-C). The 4 non-apical clones (Figure 3D) consisted of 2 related clones and 2 other unique sequences. The light and heavy chain CDRs of each clone are provided in Table 3. TABLE 3: Li ht and Heav Chain CDRs of Cross-Reactive Anti-C no/Human TfR Antibodies
Figure imgf000108_0001
Figure imgf000109_0001
[00365] Representative clones from each class, (15G11, 7A4, 16F6 and 7G7), are exemplified herein for humanization and further characterization. Humanization was achieved using HVR grafts along with the inclusion of select vernier positions as outlined below and Figures 4A-4E. 15G11 was humanized by grafting the HVRs into the IGKV1-NL1*01 and IGHV1-3*01 human variable domains. Combinations of different mouse vernier positions were included in the humanized variants as outlined in Figure 4E. Humanized 15G11 variant 15G1 l.v5 contains selected vernier positions in VL (positions 43 and 48) and VH (positions 48, 67, 69, 71 and 73) as outlined in Figure 4A. In addition, The N-terminus of VH was changed from Q to E. For humanization of 7A4, an HVR graft was made using the 7A4 heavy chain and 8A2 light chain HVRs (7A4 and 8A2 are related clones, Figure 3A). HVRs were grafted into the IGKV4-1*01 and IGHVl-2*02 human variable domains. Combinations of different mouse vernier positions were included in the humanized variants as outlined in Figure 4E. Humanized 7A4 variant, 7A4.vl5 contains selected vernier positions in VL (position 68) and VH (positions 24 and 71) and the CDR- L3 change G94A, as outlined in Figure 4B. 7G7 was humanized by grafting the HVRs into the kappa 4 and subgroup I human consensus variable domains along with selected vernier positions in VH (position 93) as outlined in Figure 4C. This humanized variant is called 7G7.vl . 16F6 was humanized by grafting the HVRs into the IGKV1-9*01 and IGHV4-59*01 human variable domains. Combinations of different mouse vernier positions were included in the humanized variants as outlined in Figure 4E. Humanized 16F6 variant 16F6.v4 contains 2 changes in VL (I48L and F71 Y) as well as selected vernier positions in VL (positions 43 and 44) and VH (positions 71 and 78) as outlined in Figure 4D.
TABLE 4: Li ht and Heav Chain CDRs of Humanized Antibodies/Fabs
Figure imgf000111_0001
[00366] The affinity of humanized variants for human and cyno TfR was determined by SPR as IgG (Figure 4E). Selected clones were also analyzed by SPR as Fab to assess monovalent affinity (Table 7). In both cases, the SPR experiments were performed as described above.
TABLE 5: Biacore Bindin Data for Selected Fab-Formatted Variants
Figure imgf000112_0001
[00367] The binding epitope of the antibodies were re-confirmed as follows. A Tf-TfR blocking ELISA was performed in maxisorp plates coated with 2 μg/ml of purified human TfR in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using
Superblock blocking buffer in PBS (Thermo Scientific, Hudson, NH). 50 μΐ of 12.5 μΜ human holo-Tf (R&D Systems, Minneapolis, MN) was added to the plates for 40 min. A 50 μΐ titration of hu7A4.vl5, hul5Gl l .v5, Tf competiting antibody, and hu7G7.vl (beginning at lO ug/ml, 1 :3 serial dilution) was added to the plate and incubated for 20 min. Plates were washed with
PBS/0.05% Tween 20 and 1 :1000 diluted HRP-Goat-anti human Fey (Jackson ImmunoResearch) was added to the plate and incubated for 1 h at room temperature. Plates were washed with PBS/0.05% Tween 20 and detected using TMB substrate (BioFX Laboratories, Owings Mills). [00368] An HFE-TfR binding ELISA was performed in maxisorp plates coated with 1 μg/ml of HFE in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using Superblock blocking buffer in PBS (Thermo Scientific, Hudson, NH). A titration of human TfR (start at 100 ug/ml, 1 :3 serial dilution) was added to the plate and incubated for 1 h. 1 μg/ml of hul5Gl 1.v5, hu7A4.vl5 or hu7G7.vl was then added to the plate for 1 h. Plates were washed with PBS/0.05% Tween 20 and 1 :1000 diluted HRP-Goat-anti human Fey (Jackson ImmunoResearch) was added the plate and incubated for 1 h at room temperature. Plates were washed with
PBS/0.05% Tween 20 and detected using TMB substrate (BioFX Laboratories, Owings Mills). An HFE-TfR blocking ELISA was performed in maxisorp plates coated with 1 μg/ml HFE in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using Superblock blocking buffer in PBS (Thermo Scientific, Hudson, NH). In a NUNC™ plate, a titration of hu7A4.vl5, hul5Gl l .v5, Tf competiting antibody, human holo-Tf andcontrol IgG (400μg for all antibody, 8000μg/ml for holo transferrin, 1 :3 serial dilution) was combined with 2 μg/ml of biotinylated human TfR and incubated for 1 h. The mixture was then added to the HFE coated plate for 1 h at room temperature. Plates were washed with PBS/0.05% Tween 20 and 1 : 1000 diluted HRP-streptavidin (SouthernBiotech, Birmingham) was added the plate and incubated for 1 hour at room temperature. Plates were washed with PBS/0.05% Tween 20 and biotinylated human TfR bound to the plate was detected using TMB substrate (BioFX Laboratories, Owings Mills).
[00369] Binding of these humanized variants to TfR was unaffected by the presence of 6.3 μΜ holo-Tf, whereas the binding of the Tf competing antibody that binds to the Tf binding site on TfR was inhibited (Figure 5). Further, humanized 7A4.vl5, 15G1 l.v5 and 7G7.vl could still bind HFE captured huTfR, indicating that they did not affect binding of huTfR to immobilized HFE (Figure 6A). In a related experiment, 7A4.vl5 and 15G1 l.v5 did not block biotinylated TfR from binding to immobilized HFE. In contrast, this interaction was blocked by the Tf competing antibody and holo Tf (Figure 6B). HFE and Tf are known to share a similar epitope on TfR {Bennet et al, Nature (2000) 403, 46-53).
[00370] Immobilized 15G1 lv.5 and anti-TfRC12 were evaluated for binding to biotinylated human TfR ECD or monovalent Ml 3 phage displaying the human TfR apical domain. Anti-TfRC12 was derived from a synthetic antibody phage library that was panned against human TfR ECD and binds to a site on the human TfR which competes with transferrin binding. Antibodies were coated at 1 μg/ml in PBS on Maxisorp plates. Bound biotinylated human TfR ECD or TfR-apical domain phage were detected with HRP-streptavidin (GE health care, RPN 4401V) or HRP-anti-M13 (GE health care, 27-9421-01), respectively. Figure 20 shows that 15G1 lv.5 binds to human TfR apical domain. The 15G1 lv.5 binding site was mapped to the apical domain, a site distant from the TfR ligand binding sites.
I l l EXAMPLE 2: AFFINITY ENGINEERING HUMAN/CYNO CROSS-REACTIVE ANTI- TFR ANTIBODIES
[00371] In addition to the humanized variants described above, additional affinity engineered variants were made. Exemplified herein is affinity engineering of 15G1 l .v5 and 7A4.vl5.
Affinity variants were generated by making individual alanine substitutions in CDR-L3 or CDR- H3 using standard techniques. These variants were screened as IgG by ELISA and SPR to identify positions important for binding to human and cyno TfR; the monovalent affinity of selected variants as Fab was also determined. Ala scan variant IgGs or Fab were expressed in 293 cells and binding to human or cyno TfR quantified by ELISA in maxisorp plates coated with 1.8 μg/ml of goat anti-human Fey (Jackson ImmunoResearch) in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using Superblock blocking buffer in PBS (Thermo Scientific, Hudson, NH). Supematants containing expressed IgG were diluted serially 1 :5 and added to the plate for 1 h. Purified hul5Gl l.v5 or hu7A4.vl5 were used as standards (diluted 1 :5 beginning at 1 ug/ml). Plates were washed with PBS/0.05% Tween 20 and 1 :1000 diluted HRP-Goat-anti kappa (Southern Biotech) was added the plate and incubated for 1 h at room temperature. Plates were washed with PBS/0.05% Tween 20 and detected using TMB substrate (BioFX Laboratories, Owings Mills). Binding was also assessed by SPR, as described above. The results are shown in Figures 7A (15Gl l .v5 variants) and 7B (7A4.vl5 variants).
[00372] Further variants of 15G11.v5 with individual alanine substitutions at positions in CDR- Ll, CDR-L2, CDR-H1 and CDR-H2 were also generated, expressed and first screened for binding to human and cyno TfR by ELISA (Table 6). The Hu/Cy binding ELISA was performed in maxisorp plates coated with 2 μg/ml of purified human or cyno TfR in PBS at 4°C overnight. Plates were washed with PBS/0.05% Tween 20 and blocked using Superblock blocking buffer in PBS (Thermo Scientific, Hudson, NH). Cell culture supematants containing the expressed Ala scan variant IgGs were serially diluted 1 :5 and added to the wells for 1 h. Plates were washed with PBS/0.05% Tween 20 and 1 : 1000 diluted HRP-Goat-anti human Fey (Jackson ImmunoResearch) was added the plate and incubated for 1 hour at room temperature. Plates were washed with PBS/0.05% Tween 20 and detected using TMB substrate (BioFX Laboratories, Owings Mills).
TABLE 6: ELISA Analysis of hul5Gll.v5 IgG Ala Variants
Figure imgf000114_0001
Figure imgf000115_0001
[00373] Selected variants were then purified and their monovalent affinity for human TfR assessed by SPR (Table 7). TABLE 7: Monovalent SPR Analysis of Select 15Gll.v5 Fab Alanine Variants
Figure imgf000116_0001
EXAMPLE 3: BISPECIFIC ANTI-HUMAN TfR ANTIBODY CONSTRUCTION AND IN VITRO ANALYSIS
[00374] Certain of the foregoing antibody variants were reformatted as bispecific antibodies with a second arm specifically binding to BACE1. The anti-human TfR antibodies Hul5Gl l.v5, Hul5Gl l .LC92A , Hul5Gl l .HC52A and Hul5Gl l .HC53A were used to engineer the TfR binding arm of the bispecific using 'knob in hole' bispecific antibody construction technology (Carter, P. (2001) J. Immunol. Methods 248, 7-15; Ridgway, J. B., Presta, L. G., and Carter, P. (1996) Protein Eng. 9, 617-621; Merchant, A. M., Zhu, Z., Yuan, J. Q., Goddard, A., Adams, C. W., Presta, L. G., and Carter, P. (1998) Nat. Biotechnol. 16, 677-681 ; Atwell, S., Ridgway, J. B., Wells, J. A., and Carter, P. (1997) J. Mol. Biol. 270, 26-35). In addition to the knob and hole mutations in the Fc for anti-TfR (hole) and anti-BACEl (knob), all half-antibodies contained mutations in the Fc region that abrogated effector function (N297G) and Hul5Gl l.v5 and Hul5Gl 1.LC92A contained an additional Fc mutation that abrogated effector function (D265A). The knob and hole half-antibodies were purified separately from E.coli and combined at a 1 : 1.1 ratio of anti-TfR to prevent formation of anti-TfR homodimers. Assembly of the bispecific antibody was completed by reductive annealing for at least three days at room temperature in a buffer containing reduced glutathione at a lOOx ratio to antibody and 200 niM arginine pH 8.0. Following assembly, bispecific antibodies were purified by hydrophobic interaction
chromatography. The assembly was confirmed by liquid chromatography mass spectroscopy and SDS-PAGE. The purified antibodies were confirmed to be homogeneous and monodisperse by size exclusion and multi angle laser light spectroscopy.
[00375] The resulting bispecific antibodies were called 15Gl l .v5 (anti-TfR1), hul5Gl 1.W92A (hul5Gl l .LC92A or anti-TfR2), hul5Gl l .N52A (anti-TfR52A) and hul5Gl l .T53A (anti-TfR53A). The monovalent affinity and kinetics for human and cyno TfR was determined for 115G1 l.v5 and 115G11.W92A by SPR, as above (see Table 9). Anti-TfR1 and anti-TfR2 possess similar monovalent binding affinities as anti-TfRA and anti-TfRD do for binding to mouse TfR (see Atwal et al., Sci. Transl. Med. 3, 84ra43 (2011); Yu et al., Sci. Transl. Med. 25 May 2011 : Vol. 3, Issue 84, p. 84ra44).
TABLE 8: Monovalent SPR Analysis of 15Gl l.v5 (TfR1) and 15G11.W92A (LC92A, TfR2)
Figure imgf000117_0001
[00376] Additionally, the binding affinity of the anti-TfR1, anti-TfR2, Hul5Gl 1.N52A and Hul 5G11.T53A bispecific antibodies were measured against human and cyno TfR by SPR as previously described. As shown in Table 9 below, Anti-TfR52A and anti-TfR53A have binding affinities to human and cyno TfR between TfRlhl5Gl l v5 and TfR2LC92A.
TABLE 9
Figure imgf000117_0002
EXAMPLE 4: IMPACT OF EFFECTOR-CONTAINING AND EFFECTORLESS
MONOSPECIFIC AND BISPECIFIC ANTIBODIES ON A HUMAN ERYTHROLEUKEMIA CELL LINE AND PRIMARY BONE MARROW MONONUCLEAR CELLS
[00377] Prior studies in mice had determined that antibodies binding murine TfR with effector function and/or complement binding capabilities selectively depleted TfR-expressing reticulocytes To ascertain whether the depletion observed in the mouse studies was unique to a murine system, further experiments were performed utilizing anti-TfR that bind to human TfR. [00378] ADCC assays were carried out using peripheral blood mononuclear cells (PBMCs) from healthy human donors as effector cells. A human erythroleukemia cell line (HEL, ATCC) and primary human bone marrow mononuclear cells (AllCells, Inc.) were used as target cells. To minimize inter-donor variability which could potentially arise from allotypic differences at the residue 158 position in FcyRIIIA, blood donors were limited to those carrying the heterozygous RcyRIIIA genotype (F/V158) in the first set of experiments (Figure 8A-B). For the second set of experiments (Figure 9A-B), only HEL cells were used as the target cells, with PBMCs from healthy human donors carrying either the F/V158 genotype or the FcyPJIIA V/V158 genotype. The V/V158 genotype was also included in this assay due to the known association with increased NK cell-mediated ADCC activity as well as ability to bind IgG4 antibodies (Bowles and Weiner, 2005; Bruhns et al. 2008). Cells were counted and viability was determined by Vi-CELL® (Beckman Coulter; Fullerton, CA) following the manufacturer's instructions.
[00379] PBMCs were isolated by density gradient centrifugation using Uni-Sep™ blood separation tubes (Accurate Chemical & Scientific Corp.; Westbury, NY). Target cells in 50 of assay medium (RPMI-1640 with 1% BSA and 100 units/mL penicillin and streptomycin) were seeded in a 96-well, round-bottom plate at 4 x 104/well. Serial dilutions of test and control antibodies (50 μίΛνεΙΙ) were added to the plates containing the target cells, followed by incubation at 37 °C with 5% CO2 for 30 minutes to allow opsonization. The final concentrations of antibodies ranged from 0.0051 to 10,000 ng/mL following 5-fold serial dilutions for a total of 10 data points. After the incubation, 1.0 x 106 PBMC effector cells in 100 of assay medium were added to each well to give a ratio of 25: 1 effector: target cells, and the plates were incubated for an additional 4 hours. The plates were centrifuged at the end of incubation and the supematants were tested for lactate dehydrogenase (LDH) activity using a Cytotoxicity Detection Kit™ (Roche Applied Scinece; Indianapolis, IN). The LDH reaction mixture was added to the supematants and the plates were incubated at room temperature for 15 minutes with constant shaking. The reaction was terminated with 1 M H3PO4, and absorbance was measured at 490 nm (the background, measured at 650 nm was subtracted for each well) using a SpectraMax Plus microplate reader. Absorbance of wells containing only the target cells served as the control for the background (low control), whereas wells containing target cells lysed with Triton-X100 provided the maximum signal available (high control). Antibody-independent cellular cytotoxicity (AICC) was measured in wells containing target and effector cells without the addition of antibody. The extent of specific ADCC was calculated as follows:
A490 (Sample) - A490 (AICC)
% ADCC = 100 x
A490 (High Control) - A490 (Low Control) ADCC values of sample dilutions were plotted against the antibody concentration, and the dose- response curves were fitted to a four-parameter model using SoftMax Pro.
[00380] In a first set of experiments, the ADCC activity of various anti-human Tf constructs were assessed using either a human erythroleukemia cell line (HEL cells) or primary human bone marrow mononuclear cells as the target cells. Bivalent IgGl effector function-competent anti- human Tf l antibody 15G11, and a bispecific form of this antibody with an anti-BACEl arm in a human IgGl format containing D265A and N297G mutations to abrogate effector function (see Example 3), were tested at various concentrations in the ADCC assay, using anti-gD WT IgGl as a negative control and murine anti-human HLA (class I) as a positive control. The results are shown in Figures 8A and 8B. With either the HEL cells as targets (Fig. 8A) or the bone marrow mononuclear cells as targets (Fig. 8B), the monospecific, effector positive anti-human TfR antibody 15G11 elicited significant ADCC activity. This activity was similar to that of the positive control anti-human HLA antibodies on the HEL cells, and at a robust yet lower level relative to the positive control on the bone marrow mononuclear cells. The somewhat lower level observed in the bone marrow mononuclear cells experiment is likely due to the fact that only a portion of the heterogeneous mixture of myeloid and erythroid lineage PBMC cells used in the experiment express high levels of Tf , whereas the HEL cells have consistently high Tf expression throughout the clonal cell population. In sharp contrast, the bispecific effectorless anti- humanTfR/BACEl antibody did not display any ADCC activity in either HEL or bone marrow mononuclear cells, similar to the negative control.
[00381] In a second set of experiments, the impact of switching the antibody isotype in this assay system was assessed. The ADCC assay procedure was identical to that described above, with the exception that all target cells were HEL cells, and the effector cells were PBMCs from healthy human donors either carrying the heterozygous FcyRIIIa-V/F158 genotype or the homozygous FcyRIIIa-V/V 158 genotype. All anti-human TfR tested were bispecific with anti-gD, on three different Ig backbones: wild-type human IgGl, human IgGl with the N297G mutation, and human IgG4. An anti-Abeta antibody with a human IgG4 backbone was also tested, and mouse anti-human HLA (class I) served as a positive control. The results are shown in Figures 9A and 9B. As anticipated based on the known association between effector cell activation and the V/V158 genotype (Bowles and Weiner 2005), ADCC activity was more robustly elicited by V/V158 donor PBMCs (~ 45% of target cells impacted) relative to F/V158 donors (~ 25% of target cells impacted) (compare Fig. 9A to Fig. 9B). Anti-TfR/gD with the wild-type IgGl induced robust ADCC in HEL cells, while the anti-TfR/gD with the effectorless IgGl did not show any ADCC activity in HEL cells, replicating the results from the first set of experiments. Notably, at concentrations of 100 ng/niL or higher, anti-TfR/gD of the IgG4 isotype showed a mild ADCC activity. This activity was not observed in the anti-Abeta IgG4 results, indicating that TfR binding was required for the ADCC activity. This finding correlates with previous reports that IgG4 has minimal, but measurable, effector function (Adolffson et al., J. Neurosci. 32(28):9677-9689 (2012); van der Zee et al. Clin Exp. Immunol. 64: 415-422 (1986)); Tao et al., J. Exp. Med.
173:1025-1028 (1991)).
EXAMPLE 5: ASSESSMENT OF BISPECIFIC ANTI-HUMAN TfR/BACEl BISPECIFIC ANTIBODIES IN VIVO
A. Pharmacokinetic, Pharmacodynamic and Safety Study
[00382] To evaluate the drug concentrations, pharmacodynamics effects, and safety of the bispecific anti-human TfR antibodies in vivo, cynomolgus monkeys (Macaca fascicularis) were dosed with bispecific antibodies using anti-TfR antibody clone 15G11 paired with the same anti- BACE1 arm used in prior examples (anti-TfRVBACEl), or clone 15G11.LC92A paired with the same anti-BACEl arm used in prior examples (anti-TfR2/BACEl). These bispecific antibodies were in a human IgGl format with N297G or D265A and N297G mutations abrogating effector function, as described previously. As a control, an anti-gD molecule on human IgGl was used. This study was performed in non-human primates because crossreactivity of these anti-TfR antibodies is limited to non-human primates and humans. In addition, studies have shown that the mechanisms of drug transport between the cerebrospinal fluid (CSF) and plasma compartments may be similar between humans and primates (Pop lack et al, 1977). The antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cisterna magna catheters. At various timepoints up to 60 days post-dose, plasma, serum, and (CSF) were sampled. Sample analysis included hematology (whole blood), clinical chemistry (serum), antibody concentrations (serum and CSF), and pharmacodynamic response to the antibody (plasma and CSF). See Figure 10 for a detailed sampling scheme.
[00383] The concentrations of the dosed antibodies in cynomolgus monkey serum and CSF were measured with an ELISA using a sheep anti-human IgG monkey absorbed antibody coat, followed by adding serum samples starting at a dilution of 1 : 100, and finished by adding a goat anti-human IgG antibody conjugated to horseradish peroxidase monkey adsorbed for detection. The assay had a standard curve range of 0.78-50 ng/mL and a limit of detection of 0.08 μg/mL. Results below this limit of detection were reported as less than reportable (LTR).
[00384] Figures 11A-B shows the results of the pharmacokinetic analysis for anti-TfRl/BACEl and anti-TfR2/BACEl. The pharmacokinetic profile for anti-gD was as expected for a typical human IgGl antibody in cynomolgus monkey with a mean clearance of 3.98 mL/day/kg. Both anti-TfR/BACEl antibodies cleared faster than anti-gD, likely due to peripheral target-mediated clearance. Anti-Tf l/BACEl had the fastest clearance, consistent with it having the highest binding affinity to Tf , whereas anti-Tf 2/BACEl showed an improved pharmacokinetic profile (ie, prolonged exposure in serum) as compared to anti-Tf l/BACEl, likely due to its reduced affinity for TfR. The clearance for anti-TfRl/BACEl and anti-TfR2/BACEl were 18.9 mL/day/kg and 8.14 mL/day/kg, respectively. All antibodies were detected in the CSF at approximately one one-thousandth of the serum concentration. However, there was high variability, and overall no detectable difference in the CSF antibody concentrations across the molecules.
TABLE 10: Mean (± SD) PK parameter estimates for all test antibodies following a single IV bolus dose administration at 30 mg/kg in cynomolgus monkeys (n=5)
AUCall AUCinf Cmax CL Vss
Antibody (day*μg/mL) (day*μg/mL) fog/mL) (mL/day/kg) (mL/kg) anti-gD 7640 ± 3.98 ± 51.3 ±
1790 7930 ± 1910 912 ± 141 1.05 10.2 anti-TfRVBACEl 1610 ± 1610 ± 18.9 ± 41.0 ±
240 237 809 ± 132 2.54 8.18 anti-TfR2/BACEl 3750 ± 3750 ± 850 ± 8.14 ± 41.2 ±
528 530 69.2 1.21 6.06
SD = standard deviation; IV = intravenous; AUCaii = area under the concentration-time curve from time 0 to the time of last measurable concentration; AUCmf = area under the
concentration-time curve extrapolated to infinity; Cmax = observed maximum serum
concentration; CL = clearance; Vss = volume of distribution at steady state; Min = minimum; Max = maximum.
[00385] To look at the pharmacodynamic effect in response to anti-TfR/BACEl dosing, we measured Abetai-40 and sAPPa and sAPPp levels in cynomolgus monkey plasma and CSF. Abetai- 40 was measured with an ELISA using an anti-Abetai-4o specific polyclonal antibody coat, followed by adding samples, and finishing by adding a mouse anti-human Abetai-40 monoclonal antibody conjugated to horseradish peroxidase for detection. The assay has a limit of detection of 60 pg/mL for plasma and 140 pg/mL for CSF. Results below this concentration were reported as less than reportable (LTR). CSF concentrations of sAPPa and sAPPp were determined using the sAPPa/sAPPp Multi-spot assay (Mesoscale Discovery (Gaithersburg, MD)). CSF was thawed on ice, then diluted 1 :10 into 1% BSA in TBS-T (10 mM Tris buffer, pH 8.0, 150 mM NaCl, 0.1% Tween-20). The assay was performed as per the manufacturer's protocol. The assay had lower limit of quantification values of 0.05 ng/ml for sAPPa and 0.03 ng/mL for sAPPp.
[00386] Figures 12A-E summarize the pharmacodynamics behavior of the antibodies. In the periphery, plasma
Figure imgf000121_0001
levels remained unchanged following anti-gD adiminstration, but transiently decreased following anti-TfR/BACEl administration. Both variants reduced plasma Abetai-40 levels, with a maximal inhibition of 50% achieved 1 day post-dosing. Plasma Abetai-40 levels gradually recovered, with animals given anti-TfRVBACEl returning to baseline Abetai-40 levels around 14 days post-dose. Abetai-40 levels returned to baseline levels between 21 and 30 days post-dose in animals treated with anti-Tf 2/BACEl . Both anti-TfR/BACEl antibodies reduced CSF Abetai-40 levels, with no change observed in anti-gD dosed animals. Anti- TfPvVBACEl administration resulted in a more significant decrease in CSF Abetai-40 levels (average maximal inhibition 50% of baseline) than that of anti-Tf 2/BACEl (average maximal inhibition 20% of baseline). sAPPp production was inhibited in anti-TfR/BACEl treated animals, but not in animals who received anti-gD. Similar to results for Αβ40, anti-TfRVBACEl had a stronger inhibitory effect on sAPPp production than anti-TfR2/BACEl . sAPPa production was stimulated during BACE1 inhibition by both anti-TfRVBACEl and anti-TfR2/BACEl, and the response correlated inversely with the level of inhibition observed for sAPPp and
Figure imgf000122_0001
SAPPa and sAPPp are the primary processing products of amyloid precursor protein (APP), and their levels are highly correlated. The ratio of sAPPp/sAPPa normalizes the results to potential changes in basal APP expression or potential preanalytical differences in CSF collection and handling over the course of the study. The ratio of CSF sAPPp/sAPPa with anti-TfRVBACEl demonstrated a more robust PD effect than anti-TfR2/BACEl. Thus, these results support target (i.e. BACE1) engagement by the anti-TfR/BACEl antibodies.
[00387] Overall, these results suggest that a bispecific anti-TfR/BACEl antibody with an affinity for human TfR between that of anti-TfRVBACEl and anti-TfR2/BACEl would likely have a desirable pharmacokinetic/pharmacodynamic balance.
[00388] No safety signals were observed in this study. There were no evident effects on any hematology or clinical chemistry parameters of monkeys given 30 mg/kg of any bispecific antibody administered up to 60 days post-dose. Importantly, reticulocyte levels were unaffected by treatment with either anti-TfRVBACEl or anti-TfR2/BACEl (Figure 13), as expected since these antibodies were effector-function-impaired and the overall level of circulating early reticulocytes with high TfR levels is very low in normal primates (see Example 4).
EXAMPLE 6: ASSESSMENT OF BISPECIFIC ANTI-HUMAN TfR BACEl BISPECIFIC ANTIBODIES IN VIVO
[00389] To examine the relationship between antibody pharmacodynamics in CSF and pharmacokinetics in brain, cynomolgus monkeys (Macaca fascicularis) were dosed with bispecific antibodies anti-TfRVBACEl or anti-TfR2/BACEl, as in the previous example. These bispecific antibodies were in a human IgGl format with D265A and N297G mutations abrogating effector function. As a control, an anti-gD molecule on human IgGl was used. For comparison, we also dosed with a bivalent anti-BACEl antibody, which is the same clone used for the bispecific antbibodies. The antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cistema magna catheters. Baseline CSF samples were collected 24 and 48 hours prior to dosing, and another CSF sample was collected 24 hours post-dose (as shown schematically in Figure 14). Following CSF collection 24 hours post-dose, animals were perfused with saline and brains were harvested for analysis of antibody concentrations. Different brain regions were homogenized in 1% NP-40 (Cal-Biochem) in PBS containing Complete Mini EDTA-free protease inhibitor cocktail tablets (Roche Diagnostics). Homogenized brain samples were rotated at 4°C for 1 hour before spinning at 14,000 rpm for 20 minutes. The supernatant was isolated for brain antibody measurement, using the ELISA method described in the previous example. Blood was also collected to confirm peripheral exposure and pharmacodynamics responses, which were similar to our observations in Example 5.
[00390] The pharmacodynamic effects of anti-TfRVBACEl and anti-TfR2/BACEl as assessed in CSF were also similar to that observed in the previous example. Figure 15 demonstrates that the ratio of CSF sAPPp/sAPPa decreased robustly following dosing with anti-TfRVBACEl. Anti- TfRVBACEl did not show an evident decrease at 24 hours post-dose in this study. Anti-BACEl also showed no effect. Analysis of brain concentrations of antibody revealed that both the control IgG and the anti-BACEl antibody had limited uptake into the brain, at levels that were just above detection in our assay (average -670 pM). Anti-TfR2/BACEl had ~3-fold improved brain uptake over control IgG (average ~2 nM), and anti-TfRVBACEl had the best brain uptake, ~15 -fold greater than control IgG (average -10 nM). The brain antibody concentrations for the different antibodies correlated with the pharmacodynamics response seen in CSF in our studies, with anti- TfRVBACEl having the best brain uptake and most robust pharmacodynamics effect, and anti- TfRVBACEl having less brain uptake and a more modest effect.
[00391] These results extend our previous findings to demonstrate that TfR-binding bispecific antibodies improve uptake in brain of non-human primates. In primates, as in mice, there is likely an optimum affinity to TfR that best balances brain uptake and TfR-mediated clearance. In our example, the higher affinity anti-TfRVBACEl demonstrates good brain uptake, and is affected by peripheral target-mediated clearance. The reduced affinity TfR2/BACEl has improved clearance properties, but appears to have such low binding for TfR as to not be able to be efficiently transported by TfR (much in the same way that the lowest-affinity anti-TfR antibody TfRE in US2012/0171120 passes some affinity threshold beyond which the affinity is too low to permit sufficient interaction between the antibody and TfR such that the antibody would remain associated with TfR as TfR begins the translocation process). From the results of this experiment, an anti- human/cyno TfR/BACEl bispecific antibody having affinity for TfR between that of TfR1 and TfR2 would be predicted to have improved uptake and clearance properties over either anti- TfRVBACEl or anti-Tf 2/BACEl in this system.
EXAMPLE 7: CREATION OF ADDITIONAL EFFECTORLESS MUTATIONS IN THE CONTEXT OF A BISPECIFIC TRANSFERRIN RECEPTOR ANTIBODY
[00392] Other mutations in the Fc region, which abrogate effector function in addition to
N297G and D265A were tested for their ability to reduce or prevent depletion of Tf -expressing reticulocytes. Specifically, the Fc mutations L234A, L235A and P329G ("LALAPG") which are described in US Application Publication No 2012/0251531, which is incorporated herein by reference, were incorporated into the anti-Tf D/BACEl antibody (which is described in
International Application Publication No. WO 2013/177062, and which is incorporated by reference herin in its entirety).
[00393] Pharmacokinetic analysis and reticulocyte count following a single antibody administration in mice were performed as follows. Wild type female C57B/6 mice ages 6-8 weeks were used for all studies. The animals' care was in accordance with institutional guidelines. Mice were dosed intravenously with a single 50mg/kg dose of either an anti-gD antibody (murine IgG2a) with the LALAPG mutations, an anti-Tf D/BACEl antibody (rat/murine chimera) with the LALAPG mutations. Total injection volume did not exceed 250μί and antibodies were diluted in D-PBS when necessary (Invitrogen). After 24 hours, whole blood was collected prior to perfusion in EDTA microtainer tubes (BD Diagnostics), allowed to sit for 30 minutes at room temperature, and spun down at 5000x g for 10 minutes. The top layer of plasma was transferred to new tubes for antibody measurements.
[00394] Total antibody concentrations in mouse plasma was measured using an anti-mouse IgG2a (allotype a)/ anti-mouse IgG2a (allotype a) ELISA. NUNC 384- well Maxisorp
immunoplates (Neptune, NJ) were coated with mouse anti-mouse IgG2a allotype A, an allotype A specific antibody (BD/Pharmigen San Jose, CA), overnight at 4°C. Plates were blocked with PBS, 0.5% BSA for 1 hour at 25°C Each antibody (anti-gD and the anti- TfR/BACEl bispecific variants) was used as a standard to quantify respective antibody concentrations. Plates were washed with PBS, 0.05% Tween-20 using a microplate washer (Bio-Tek Instruments, Inc., Winooski, VT), and standards and samples diluted in PBS containing 0.5% BSA, 0.35 M NaC!, 0.25% CHAPS, 5 mM EDTA, 0.2% BgG, 0.05% Tween-20 and 15 ppm Procliti® (Sigma-Aldrich) were added for two hours at 25°C. Bound antibody was detected with biotin-conjugated mouse anti-mouse IgG2a allotype A, an allotype A specific antibody (BD/Pharmigen San Jose, CA). Bound biotin- conjugated antibody was detected with horseradish peroxidase-conjugated streptavidin (GE Helathcare Life Sciences, Pittsburgh, PA). Samples were developed using 3,3',5,5'- tetramethyl benzidine (TMB) (KPL, Inc., Gaithersburg, MD) and absorbance measured at 450 nm on a Multiskan Ascent reader (Thermo Scientific, Hudson, NH). Concentrations were determined from the standard curve using a four-parameter non-linear regression program. The assay had lower limit of quantification (LLOQ) values of 78.13 ng/ml in plasma. Statistical analysis of differences between experimental groups was performed using a two-tailed unpaired t-test.
[00395] Upon administration of the anti-Tf D/BACEl antibodies containing the Fc LALAPG mutations, the mice displayed no clinical symptoms as had been previously observed using antibodies with full effector function. See Couch et al., Sci. Trans. Med. 5:183ra57 (2013). Figure 17 shows the results of the pharmacokinetic analysis.
[00396] Additionally, immature and total reticulocyte counts were determined using the Sysmex XT2000iV (Sysmex, Kobe, Japan) according to manufacturer's instructions. At 24 hours post dose, there was no observed difference in the immature reticulocyte fraction or the total reticulocyte count with any antibody tested as seen in Figure 18. These results suggest that the LALAPG mutation not only abrogates antibody effector function but also reduces complement binding and complement-mediated reticulocyte clearance seen even with an effectorless antibody framework (Couch et al. 2013). This is consistent with another report that incorporation of the LALA mutation on a human IgGl can limit complement binding (Hessell et al. Nature 449: 101- 104 (2007)).
EXAMPLE 8: GENERATION OF ANTI-BACE1 ANTIBODIES
[00397] Fully -human antibodies specifically binding to BACE1 were generated using a yeast- based human antibody display library, selected against human BACE1 extracellular domain (BACE1-ECD), amino acids 1-457 of SEQ ID NO: 179.
[00398] Eight naive human synthetic yeast libraries each of ~109 diversity were propagated as described previously {see, e.g.,: Xu et al, 2013, Protein Eng. Des. Sel., 26: 663-70;
WO2009036379; WO2010105256; WO2012009568 ). For the first two rounds of selection, a magnetic bead sorting technique utilizing the Miltenyi MACs system was performed, as described (see, e.g., Siegel et al., 2004, J. Immunol. Methods, 286: 141-53). Briefly, yeast cells (~1010 cells/library) were incubated with 200 nM biotinylated BACE1-ECD for 15 min at room temperature in FACS wash buffer (phosphate-buffered saline (PBS)/0.1% bovine serum albumin (BSA)). After washing once with 50 ml ice-cold wash buffer, the cell pellet was resuspended in 40 mL wash buffer, and Streptavidin MicroBeads (500 μΐ) were added to the yeast and incubated for 15 min at 4°C. Next, the yeast were pelleted, resuspended in 5 mL wash buffer, and loaded onto a Miltenyi LS column. After the 5 mL was loaded, the column was washed 3 times with 3 ml FACS wash buffer. The column was then removed from the magnetic field, and the yeast were eluted with 5 mL of growth media and then grown overnight. The following rounds of sorting were performed using flow cytometry. Approximately 1 x 10s yeast were pelleted, washed three times with wash buffer, and incubated with decreasing concentrations of biotinylated BACEl-ECD (100 to 1 nM) under equilibrium conditions at room temperature. Yeast were then washed twice and stained with LC-FITC (diluted 1 : 100) and either SA-633 (diluted 1 :500) or EA-PE (diluted 1 :50) secondary reagents for 15 min at 4°C. After washing twice with ice-cold wash buffer, the cell pellets were resuspended in 0.4 mL wash buffer and transferred to strainer-capped sort tubes. Sorting was performed using a FACS ARIA sorter (BD Biosciences) and sort gates were determined to select for binders. After the final round of sorting, yeast were plated and individual colonies were picked for characterization.
[00399] Optimization of select antibodies was carried out by a performing both light chain and heavy chain diversification, each described below.
[00400] Light chain diversification: Heavy chain plasmids were extracted and transformed into a light chain library with a diversity of approximately 1 x 106. Selections were performed as described above with one round of MACS sorting and two rounds of FACS sorting using biotinylated BACEl-ECD titrations so select for higher affinity.
[00401] Heavy chain diversification: The CDRH3 of was recombined into a premade library with CDRH1 and CDRH2 variants of a diversity of 1 x 10s and selections were performed as described above. Affinity pressures were applied by incubating the antigen antibody yeast complex with parental Fab or unbiotinylated antigen for different amounts of time to select for the highest affinity antibodies. Additional cycles of diversification utilized error prone PCR-based mutagenesis of the heavy chain and the light chain. Selections were performed similar to previous cycles using FACS sorting for all three rounds and with increased times for Fab pressure.
[00402] Seventy-eight antibodies were chosen from the selection process for sequencing and further characterization. The heavy chain and light chain HVRs for the seventy-eight antibodies are shown in Figures 21 and 22, respectively. The heavy chain and light chain variable region sequences are shown in Figures 23 and 24, respectively.
[00403] The antibodies were determined to be in two separate epitope bins. The epitope bin for each antibody (either bin "2" or bin "3") is shown in Figures 21 to 24.
EXAMPLE 9: CHARACTERIZATION OF ANTI-BACE1 ANTIBODIES
[00404] The anti-BACEl antibodies selected in Example 8 were further characterized using the assays described below.
A. Binding Kinetics Using Octet® System
[00405] The binding affinities for the 78 anti-BACEl antibodies selected in Example 1 for human and murine BACE1 ECD were determined using an Octet® System (ForteBio) as follows. Anti-BACEl antibodies were loaded onto anti -human capture (AHC) sensors (tips) followed by 60 seconds baseline in assay buffer. Tips were then exposed to 200 nM of human BACE1 ECD (produced in CHO cells or purchased from R&D Systems) or murine BACE1 ECD (produced in CHO cells; SEQ ID NO: 389). Tips were transferred to assay buffer for 5 minutes, 30 minutes, or 120 minutes depending on the off-rate, for off-rate measurement. Assay buffer was either PBS + 0.1% BSA, pH 7.5; or PBS + 0.1% BSA, pH 5.0. Kinetics were analyzed using a 1 : 1 binding model.
[00406] The results of that experiment are shown in Figure 25. Measurements with the "<" designations prior to the KD reach the lower limit of measurable off-rate for that assay run.
B. Binding Kinetics Using Surface Plasmon Resonance (BIAcore™)
[00407] Binding affinities of certain anti-BACEl IgGs were measured by surface plasmon resonance (SRP) using a BIAcore™-T100 instrument. Anti-BACEl human IgGs were captured by mouse anti-human Fc antibody (GE Healthcare, cat# BR-1008-39) coated on CM5 biosensor chips to achieve approximately 150 response units (RU). For kinetics measurements, two-fold serial dilutions (125nM to OnM) of human BACE1 (R&D Systems) were injected in HBS-P buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 0.05% v/v Surfactant P20, GE Healthcare) at 25°C with a flow rate of 30 μΐ/min. Association rates (km) and dissociation rates (kos) were calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2). The equilibrium dissociation constant (KD) was calculated as the ratio ka/kn.
[00408] The results of that experiment are shown in Figure 25.
C. Epitope Binning
[00409] Epitope binning of the 78 antibodies was performed using the Octet® System. Briefly, a first antibody is loaded onto multiple AHC tips followed by 60 seconds baseline in assay buffer, pH 7.5. Tips are then exposed to 200 nM human BACE1 for 180 seconds to allow for antigen binding. Tips are transferred to wells containing 50 μg/ml second antibody in assay buffer for 90 seconds. If the second antibody shows clear binding, it is considered to be a non-competitor (i.e., in a different epitope bin from the first antibody). If the second antibody does not show clear binding, it is considered to be a competitor (i.e., in the same epitope bin as the first antibody). The binding determination is made by comparing the second antibody binding to BACE1 in the presence of the first antibody to the first antibody blocking itself. To choose the first antibodies, an assay similar to the assay described above is carried out, and antibodies showing mutually exclusive binding are selected.
[00410] The epitope bin for each antibody is shown in Figures 21 to 24. The 78 antibodies fell into two epitope bins. D. In Vitro Inhibition Assays
[00411] Additionally, the ability of antibodies to modulate BACEl proteolytic activity on certain BACE substrates was assessed in vitro using the HTRF assay.
[00412] In the first assay, certain anti-BACEl antibodies were diluted in reaction buffer (50 mM NaAcetate pH 4.4, 0.1% CHAPS) to approximately 0.6 μΜ. BACEl ECD was diluted in reaction buffer to 0.3 μΜ. Three
Figure imgf000128_0001
of BACEl and 3 of anti-BACEl antibody were combined in a well of a 384 well plate and incubated for 30 minutes. Three
Figure imgf000128_0002
of FRET short substrate Mca- SEVNLDAEFRK(Dnp)RR-NH2 (Mca: (7-Methoxycoumarin-4-yl)acetyl, Dnp: 2, 4-Dinitrophenyl; R&D Systems) (SEQ ID NO: 184) was added and mixed by pulse spin. Fluorescence of the cleaved substrate was monitored every 10 minutes for 1 hour (excitation 320 nm, emission 405 nm). Each anti-BACEl antibody was tested in quadruplicate. Modulation of BACEl activity was calculated as ((free enzyme activity) - (IgG:enxyme activity))/(free enzyme activity). Positive values represent inhibition and negative values represent activation.
[00413] The results of that experiment are shown in Figure 26. In this short substrate assay, both enzyme inhibition (positive percentages), and enzyme activation (negative values) were observed.
[00414] In the second assay, certain anti-BACEl antibodies were tested in a HTRF assay as follows. Two microliters of 375 nM Bi27 (Biotin-KTEEISEVNLDAEFRHDSGYEVHHQKL (SEQ ID NO: 183), American Peptide Company)), an amyloid precursor protein BACEl cleavage site peptide bearing a substitution to increase sensitivity to BACEl cleavage, was combined with 3 of 125 nM BACEl pre-incubated with an anti-BACE antibody in BACE reaction buffer (50 mM sodium acetate pH 4.4 and 0.1% CHAPS) in a 384-well plate (Proxiplate™, Perkin-Elmer). The proteolytic reaction mixture was incubated at ambient temperature for 75 minutes and was quenched by the addition of 5
Figure imgf000128_0003
HTRF detection mixture containing 2 nM Streptavidin-D2 and 150 nM of 6E10 anti-amyloid beta antibody (Covance, Emoryville, CA) labeled with Europium cryptate in detection buffer (200 mM Tris pH 8.0, 20 mM EDTA, 0.1% BSA, and 0.8M KF). The final reaction mixture was incubated at ambient temperature for 60 minutes and the TR-FRET signal was measured using an EnVision Multilabel Plate Reader™ (Perkin-Elmer) at an excitation wavelength of 320 nm and emission wavelengths of 615 and 665 nm. Reactions lacking BACEl enzyme (0 BACE) and reactions containing lacking anti-BACEl antibodies (PBS (100% BACEl Activity) were used as controls. Additionally, reactions using a short FRET peptide (Rh- EVNLDAEFK-quencher (SEQ ID NO: 185), Invitrogen) were also performed identically to the HTRF reactions described above.
[00415] A synthetic peptide inhibitor of BACEl, OM99-2 (CalBiochem®, Catalog # 496000) was used as a control. The resulting fluorogenic products from the control reactions were measured as above, but at an excitation wavelength of 545 nm and an emission wavelength of 585 nm. Obtained data were analyzed using GraphPad Prism 5™ (LaJolla, CA).
[00416] The results of that experiment are shown in Figure 27. A "decreasing" data mode indicates inhibition, while an "increasing" data mode indicated activation.
[00417] Without intending to be bound by any particular theory, modulation of enzyme activity by allosteric inhibitors may, in some instances, result in either activation or inhibition of activity depending on the substrate. For example, a change in conformation caused by an allosteric inhibitor may cause better binding of one substrate and may interfere with binding of another substrate, resulting in differing, or even opposite, activity modulation.
E. In vivo Activity Assay in Primary Cultures
[00418] To determine whether the observed in vitro inhibitory action of the anti-BACEl antibodies on APP processing was also present in a cellular context, in vivo studies were performed. The ability of the antibodies to inhibit Αβχ-40 production in primary cultures of mouse cortical neurons expressing endogenous levels of wild-type human amyloid precursor protein was assessed as follows. Briefly, dissociated cortical neuron cultures were prepared from El 6.5 CD1 mice. Neurons were seeded at a density of 2.5 x 104 cells/well in a 96-well plate and grown for five days in Neurobasal media (Life Technologies) in vitro. 50 μΐ of fresh media containing anti- BACE antibodies or control IgGl prepared in an 8-point dilution series was incubated with the neurons for 24 hours at 37°C. Cell supernatants were harvested and assayed for the presence of mouse Αβχ-40 using a sandwich ELISA Briefly, rabbit polyclonal antibody specific for the C terminus (Millipore, Bedford, MA) was coated onto plates, and biotinylated anti-mouse Αβ monoclonal antibody M3.2 (Covance, Dedham, MA) was used for detection. The assay had lower limit of quantification values of 1.96 pg/ml in plasma and 39.1 pg/g in brain.
Figure imgf000129_0001
values were normalized for cell viability, as determined using the CellTiter-Glo Luminescent Cell Viability Assay (Promega). Data was plotted using a four-parameter non-linear regression curve- fitting program (Prism, Graphpad).
[00419] The results of that experiment are shown in Figure 28. Percent inhibition refers to the maximal inhibition (as % of control) seen with each antibody; percent inhibition was determined as follows: (baseline Αβχ-40 - minimal Αβχ-4θ) / baseline Αβχ-40 * 100 (baseline Αβχ-40 is in the absence of any treatment).
EXAMPLE 10: BISPECIFIC ANTI-HUMAN TfR / ANTI-HUMAN BACE1 ANTIBODY CONSTRUCTION
[00420] Certain of the foregoing antibody variants were reformatted as bispecific antibodies with a second arm specifically binding to BACE1 (anti-BACEl antibody 6266). The anti-human Tf antibodies 15Gl l.v5 (anti-Tf 1), 15G11.LC92A (anti-Tf 2), 15G11.HC52A (anti-Tf 52A) and 15G11.HC53A (anti-TfR ) were used to engineer the TfR binding arm of the bispecific using 'knob in hole' bispecific antibody construction technology (Carter, P. (2001) J. Immunol. Methods 248, 7-15; Ridgway, J. B., Presta, L. G., and Carter, P. (1996) Protein Eng. 9, 617-621 ; Merchant, A. M., Zhu, Z., Yuan, J. Q., Goddard, A., Adams, C. W., Presta, L. G., and Carter, P. (1998) Nat. Biotechnol. 16, 677-681 ; Atwell, S., Ridgway, J. B., Wells, J. A., and Carter, P. (1997) J. Mol. Biol. 270, 26-35). In addition to the knob and hole mutations in the Fc for anti-TfR (hole) and anti- BACE1 (knob), half-antibodies contained mutations in the Fc region that abrogated effector function, including (N297G) or L234A/L235A/P329G. In addition, the YTE
(M252Y/S254T/T256E) and AI (N434/Y436I) mutations were incorporated into both anti- TfR52A/BACEl and anti-TfR2/BACEl bispecific antibodies. Fc Receptor-neonate (FcRn) binding domain mutations (FcRnHIGH mutations) including M252Y, S254T and T256E (YTE) have been described to increase FcRn binding and thus increase the half-life of antibodies. See U.S.
Published Patent Application No. 2003/0190311 and Dall'Acqua et al, J. Biol. Chem. 281 :23514- 23524 (2006). Additionally, FcRn binding domain mutations N434A and Y436I (AI) have been described to also increase FcRn binding. See Yeung et al., J. Immunol. 182: 7663-7671 (2009).
[00421] Mutations were constructed using Kunkel mutatgenesis, antibodies were expressed transiently in CHO cells, knob and hole half-antibodies were purified using protein A
chromatography followed by size exclusion chromatography (SEC). Assembly of the bispecific antibody was completed by reductive annealing for at least three days at room temperature in a buffer containing reduced glutathione at a lOOx ratio to antibody and 200 niM arginine pH 8.0. Following assembly, bispecific antibodies were purified by hydrophobic interaction
chromatography. The assembly was confirmed by liquid chromatography mass spectroscopy and SDS-PAGE. The purified antibodies were confirmed to be homogeneous and monodisperse by size exclusion and multi angle laser light spectroscopy.
[00422] Binding of YTE variant antibodies to FcRn was measured uing BIAcore. Human and cynomolgus monkey FcRn proteins were expressed in CHO and purified using IgG affinity chromatography. Data were acquired on a BIAcore T200 instrument. A series S sensor chip CM5 (GE Healthcare, Cat. BR100530) was activated with EDC and NHS reagents according to the supplier's instructions, and anti-Fab antibody (Human Fab capture kit, GE Health care Bio-science. AB SE-75184, upsala, Sweden) was coupled to achieve approximately 10,000 response units (RU), followed by blocking un-reacted groups with 1 Methanolamine. For affinity measurements, antibodies were first injected at a 10 μΐ/min flow rate to capture approximately 1000 RU on 3 different flow cells (FC), except for FC1 (reference), and then 2-fold serial dilutions of human FcRn (or Cyno FcRn) in pH6 buffer (0.1M sodium phosphate), from low (1 nM) to high (25 μΜ) were injected (flow rate: 30 μΐ/min) one after the other in the same cycle with no regeneration between injections. Sensograms were recorded and subject to reference and buffer subtraction before evaluating by using BIAcore T200 Evaluation Software (version 2.0). Affinities were determined by analyzing the level of binding at steady state based on a 1 :1 binding model. Table 11 shows affinities of certain FcRnHIGH bispecific antibodies comprising an anti-BACEl antibody 6266 arm for human and cynomolgus monkey FcRn, determined by surface plasmon resonance at pH 6.
Table 11: Affinity of FcRnHIGH bispecific antibodies for human and cyno FcRn
Figure imgf000131_0001
[00423] Affinity of the bispecific antibodies for human and cynomolgus monkey TfR was determined using surface plasmon resonance (SPR) (Biacore™, GE Healthcare). Streptavidin (Sigma) was coupled onto four different flow cells of a serie S BIACORE™ CM5 sensor chip (Biacore, Inc., Piscataway, NJ) at between 2000 and 3000 RU. Immobilization was achieved by random coupling through amino groups using a protocol provided by the manufacturer. 10X HBS- P (Biacore, Inc., Piscataway, NJ) was diluted in water and served as the dilution and running buffer. Purified and biotin labeled human or cyno TfR was captured, followed by a 3-fold dilution series of bispecific antibody that was injected at a flow rate of 30 ml/min using the single cycle kinetics method. Affinity constants were determined using a simple 1 : 1 Langmuir binding model or using a steady state model when kon or k0ff was beyond the detection limit. The equilibrium dissociation constant (KD) was calculated as the ratio of association rate constant (kon) and dissociation rate constant (k0ff). Table 12 shows the dissociation constants.
Table 12: Affinity of bispecific antibody for human and cyno TfR
Figure imgf000131_0002
EXAMPLE 11: IN VIVO ACTIVITY OF BISPECIFIC ANTIBODIES
[00424] To assess the inhibitory action of the anti-BACEl antibodies and bispecific antibodies on APP processing in a cellular context, the ability of the antibodies to inhibit Αβχ-40 production in primary cultures of mouse cortical neurons expressing endogenous levels of wild-type human amyloid precursor protein was assessed as follows. Briefly, dissociated cortical neuron cultures were prepared from El 6.5 CDl mice. Neurons were seeded at a density of 2.5 x 104 cells/well in a 96-well plate and grown for five days in Neurobasal media (Life Technologies) in vitro. 50 μΐ of fresh media containing anti-BACE or bispecific antibody or control IgGl prepared in an 8-point dilution series was incubated with the neurons for 24 hours at 37°C. Cell supernatants were harvested and assayed for the presence of mouse Αβχ-40 using a sandwich ELISA. Briefly, rabbit polyclonal antibody specific for the C terminus of Αβχ-40 (Millipore, Bedford, MA) was coated onto plates, and biotinylated anti -mouse Αβ monoclonal antibody M3.2 (Covance, Dedham, MA) was used for detection.
Figure imgf000132_0001
values were normalized for cell viability, as determined using the CellTiter-Glo Luminescent Cell Viability Assay (Promega). Data was plotted using a four- parameter non-linear regression curve-fitting program (Prism, Graphpad).
[00425] The results of that experiment are shown in Figure 29. Antibody 6266 had an ICso of 1.7 nM and a maximum inhibition of 74%, compared to an ICso of 2.9 nM and a maximum inhibition of 62% exhibited by antibody YW412.8.31. Bispecific antibody Tf 2/6266 had an ICso of 1.7 nM and a maximum inhibition of 79%, compared to an ICso of 11 nM and a maximum inhibition of 54% for bispecific antibody TfR2/YW412.8.31.
EXAMPLE 12: PHARMACOKINETICS AND PHARMACODYNAMICS OF BISPECIFIC ANTIBODIES IN MICE
[00426] Pharmacokinetic and pharmacodynamic analyses following a single antibody administration in mice were performed as follows. Wild type female C57B/6 mice ages 6-8 weeks were used for all studies. The animals' care was in accordance with institutional guidelines. Mice were dosed intravenously with a single 25 mg/kg dose of an anti-gD antibody (human IgGl), an anti-TfRD/YW412.8.31 antibody (rat/human chimera), or an anti-Tf D/6266 antibody (rat/human chimera), each formatted as a hulgGI N297G isotype. Total injection volume did not exceed 250μΙ^ and antibodies were diluted in D-PBS when necessary (Invitrogen). After 24 hours, whole blood was collected prior to perfusion in EDTA microtainer tubes (BD Diagnostics), allowed to sit for 30 minutes at room temperature, and spun down at 5000x g for 10 minutes. The top layer of plasma was transferred to new tubes for antibody measurements.
[00427] Total antibody concentrations in mouse plasma was measured using an anti-human Fc / anti-human Fc ELISA. NUNC 384-well Maxisorp immunoplates (Neptune, NJ) were coated with donkey anti-human Fc antibody followed by adding plasma samples starting at a dilution of 1 :20, and finished by adding a goat anti-human Fc antibody conjugated to horseradish peroxidase for detection. The assay had a standard curve range of 0.156-20 ng/mL and a limit of detection of 0.003 μg/mL. Results below this limit of detection were reported as less than reportable (LTR). Statistical analysis of differences between experimental groups was performed using a two-tailed unpaired t-test. Reduction of brain Αβχ-40 in the mice administered a single injection of bispecific antibody was determined substantially as described in Example 11.
[00428] Upon administration of the anti-TfRD/BACEl antibodies containing the Fc N297G mutations, the mice displayed no clinical symptoms as had been previously observed using antibodies with full effector function. See Couch et al., Sci. Trans. Med. 5:183ra57 (2013).
[00429] Figure 30 shows the results of the pharmacokinetic analysis. The anti- TfRD/YW412.8.31 bispecific antibody and the anti-TfRD/6266 bispecific antibody showed similar pharmacokinetics.
[00430] Figure 31 shows the results of the pharmacokinetic (A) and pharmacodynamics (B) analysis in mouse brain following the single injection of bispecific antibody. As shown in Figure 31A, the anti-TfRD/YW412.8.31 bispecific antibody showed slightly higher brain antibody concentrations than and the anti-TfRD/6266 bispecific antibody. As shown in Figure 3 IB, brain Αβ40 was significantly lower in mice administered the anti-TfRD/6266 bispecific antibody (55% reduction from control IgG) as compared to the anti-TfRD/YW412.8.31 bispecific antibody (41% reduction from control IgG) at day 2 (p<0.05). These results suggest that the anti-TfRD/6266 bispecific antibody provides a better maximal BACE1 inhibition and reduction in Αβ in the brain.
EXAMPLE 13: PHARMACOKINETICS AND PHARMACODYNAMICS OF BISPECIFIC ANTIBODIES IN CYNOMOLGUS MONKEYS
[00431] To evaluate the drug concentrations, pharmacodynamics effects, and safety of the bispecific anti -human TfR/BACEl antibodies in vivo, cynomolgus monkeys (Macaca fascicularis) were dosed with anti-TfRVYW412.8.31 or anti-TfRV6266 bispecific antibody, substantially as described in Example 5. These bispecific antibodies were in a human IgGl format with N297G mutation abrogating effector function, as described previously. As a control, an anti-gD molecule on human IgGl was used. The antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cisterna magna catheters. At various timepoints, plasma, serum, and (CSF) were sampled. Sample analysis included hematology (whole blood), clinical chemistry (serum), antibody concentrations (serum and CSF), and pharmacodynamic response to the antibody (plasma and CSF), substantially as described in Example 5.
[00432] Figures 32A shows the results of the pharmacokinetic analysis for anti- TfRVYW412.8.31 and anti-TfRV6266. Both anti-TfR/BACEl antibodies cleared at a similar rate, and both cleared faster than anti-gD, likely due to peripheral target-mediated clearance. Table 13 shows the PK parameters for each of the antibodies in this experiment.
Table 13: Mean (± SD) PK parameter estimates for all test antibodies following a single IV bolus dose administration at 30 mg/kg in cynomolgus monkeys (n= =5)
Figure imgf000134_0001
SD = standard deviation; IV = intravenous; AUCaii = area under the concentration -time curve from time 0 to the time of last measurable concentration; AUCinf = area under the concentration -time curve extrapolated to infinity; Cmax = observed maximum serum concentration; CL = clearance; Vss = volume of distribution at steady state; Min = minimum; Max = maximum.
[00433] To look at the pharmacodynamic effect in response to bispecific antibody dosing, Abetai-4o levels in cynomolgus monkey CSF were measured with an ELISA using an anti-Abetai-4o specific polyclonal antibody coat, followed by adding samples, and finishing by adding a mouse anti-human
Figure imgf000134_0002
monoclonal antibody conjugated to horseradish peroxidase for detection, substantially as described in Example 5.
[00434] Figure 32B shows the pharmacodynamics behavior of the bispecific antibodies in CSF. CSF Αβ40 was significantly lower in animals administered anti-TfRV6266 bispecific antibody (67% reduction from baseline) than in animals administered anti-Tf 1/YW412.8.31 bispecific antibody (56% reduction from baseline). The duration of the effect was similar for both antibodies. These results suggest that the anti-TfRV6266 bispecific antibody provides a better maximal BACE1 inhibition and reduction in Αβ, similar to the results observed in mice.
EXAMPLE 14: PHARMACOKINETICS AND PHARMACODYNAMICS OF FCRNHIGH BISPECIFIC ANTIBODIES IN CYNOMOLGUS MONKEYS
[00435] To evaluate the drug concentrations, pharmacodynamics effects, and safety of the FcRnHIGH bispecific anti -human TfR/BACEl antibodies in vivo, cynomolgus monkeys (Macaca fascicularis) were dosed with bispecific antibodies anti-Tf 2/6266 (IgGl.LALAPG), anti- TfR2/6266 FcRnHIGH (IgGl .LALAPG.YTE), anti-Tf 52A/6266 (IgGl .LALAPG), and anti-Tf 52A /6266 FcRnHIGH (IgGl. LALAPG.YTE). As a control, an anti-gD molecule on human IgGl was used. The antibodies were administered by a single intravenous (IV) bolus injection into the saphenous vein at a dose of 30 mg/kg to conscious cynomolgus monkeys with indwelling cisterna magna catheters. At various timepoints, plasma, serum, and (CSF) were sampled. Sample analysis included hematology (whole blood), clinical chemistry (serum), antibody concentrations (serum and CSF), and pharmacodynamic response to the antibody (plasma and CSF). See Figure 33 for a detailed sampling scheme.
[00436] The concentrations of the dosed antibodies in cynomolgus monkey serum and CSF were measured with an ELISA using a sheep anti-human IgG monkey absorbed antibody coat, followed by adding serum samples starting at a dilution of 1 : 100, and finished by adding a goat anti-human IgG antibody conjugated to horseradish peroxidase monkey adsorbed for detection. The assay had a standard curve range of 0.78-50 ng/mL and a limit of detection of 0.08 μg/mL. Results below this limit of detection were reported as less than reportable (LTR). Additionally, immature and total reticulocyte counts were determined using the AD VIA 120 Hematology System (Siemans Healthcare, Siemans AG, Erlangen, Germany) according to manufacturer's instructions.
[00437] Figures 34A-B shows the results of the pharmacokinetic analysis for the bispecific antibodies in serum. The peripheral exposure with the FcRnHIGH bispecific antibodies was improved for both the anti-TfR2/6266 and anti-TfR52A/6266 antibodies. Table 14 shows the PK parameters for each of the antibodies in this experiment.
Table 14: Pharmacokinetics of FcRnHIGH bispecific antibodies
AUCall AUCinf
(day · μg/mL (day · μg/mL Cmax CL Vss
Antibody ) ) ^g/mL) (mL/day/kg) (mL/kg)
Anti-gD 9560 + 1790 10200 + 1980 1040 + 131 3.02 + 0.577 48.4 + 5.87
Anti-TfR2/6266 6000 + 131 6340 + 367 960 + 175 4.74±0.74 58.8 + 3.73
Anti-TfR2/6266 FcRnHIGH 8740 + 816 11100 + 1060 834 + 121 2.73+0.251 72.5 + 6.18
Anti- TfR52A/6266 3520 + 599 3520 + 640 859 + 210 8.62+1.37 47.4 + 6.79
Anti-TfR52A/6266
FcRnHIGH 4340 + 212 4410 + 241 751 + 96.2 6.81+0.384 69.3 + 1.64
SD = standard deviation; IV = intravenous; AUCaii = area under the concentration-time curve from time 0 to the time of last measurable concentration; AUCinf = area under the concentration-time curve extrapolated to infinity; Cmax = observed maximum serum concentration; CL = clearance; Vss = volume of distribution at steady state; Min = minimum; Max = maximum.
[00438] As shown in Table 14, the exposure and clearance rate of the FcRn bispecific antibodies was improved for both anti-TfR2/6266 and anti-TfR52A/6266.
[00439] To look at the pharmacodynamic effect in response to anti-TfR/BACEl dosing, Abetai- 40 levels in cynomolgus monkey CSF were measured. Abetai-40 was measured with an ELISA using an anti-Abetai-4o specific polyclonal antibody coat, followed by adding samples, and finishing by adding a mouse anti-human Abetai-40 monoclonal antibody conjugated to horseradish peroxidase for detection. The assay has a limit of detection of 60 pg/mL for plasma and 140 pg/mL for CSF. Results below this concentration were reported as less than reportable (LTR). [00440] Figures 35A-B show the pharmacodynamic behavior of the antibodies. The pharmacodynamics response was improved with the FcRnHIGH mutation for both the anti- TfR2/6266 and anti-TfR52A/6266 antibodies.
[00441] Figures 36A-B show reticulocyte levels in in cynomolgus monkeys administered bispecific antibodies, as described above.
[00442] No safety signals were observed in this study. There were no evident effects on any hematology or clinical chemistry parameters of monkeys given 30 mg/kg of any bispecific antibody administered up to 60 days post-dose. Importantly, reticulocyte levels were unaffected by treatment with either anti-TfR2/6266 or anti-TfR52A/6266, as expected since these antibodies were effector-function-impaired and the overall level of circulating early reticulocytes with high TfR levels is very low in normal primates.
EXAMPLE 15: AFFINITY MATURATION OF 6266 ANTIBODY
[00443] Antibody 6266 was affinity matured as follows.
NNK walk library design and phage panning
[00444] For library randomization, each position of the CDRs was randomized by
oligonucleotide-directed mutagenesis with an "NNK" codon, where N is any of the four natural nucleotides, and K is 50% T (thymine) and 50% G (guanine). The NNK codon can encode any of the 20 natural amino acids. Libraries for the light chain and heavy chain were made separately, and each of the 3 CDRs of each chain was randomized at the same time. This results in clones that have 0 to 3 random amino acid changes in each chain, with up to one mutation in each CDR. Libraries were made in a phage Fab fragment display vector by standard methods. Binding clones were selected by incubating the phage display libraries with 5, 0.5, and 0.1 nM biotinylated BACE1 in successive rounds of selection, and then competed with 100 nM non-biotinylated BACE1 at room temperature or 37°C to reduce binding of the lower affinity clones to BACE1. Bound clones were captured on ELISA plates coated with neutravidin, washed and eluted in 1 OOmM HC1 for 20 minutes at room temperature. The eluted phage was neutralized with 1/10 volume of 1 M Tris pH 8.0 and used to infect E. coli for amplification for the next round of selection.
Deep sequencing and data analysis
[00445] For deep sequencing, phagemid DNA was isolated from selected rounds. The VH and the VL segment from each sample were amplified by an 18 cycle PCR amplification using Phusion DNA polymerase (New England Biolabs). The amplicon was purified on a 2% agarose gel.
Amplicons were prepared with standard lllumina library prep methods, using TruSeq DNA Sample Prep (lllumina). Adapter-ligated libraries were subjected to a single cycle of PCR and sequenced on the lllumina MiSeq, paired-end 200bp or 300bp as appropriate to cover the entire length of the amplicon. Sequencing data where analyzed using the statistical programming language and the ShortRead package. Quality control was performed on identified CDR sequences, were each CDR sequence was checked for the correct length and was allowed to carry only up to one N K mutation and no non-NNK mutations. Calculating the frequency of all mutations of every randomized position generated position weight matrices. Enrichment ratios for all single mutations were calculated by dividing the frequency of a given mutation at a given position in the sorted sample by the frequency of the very same mutation in the unsorted sample, as described previously by Fowler and colleagues. The enrichment ratios of double mutations were obtained by calculating the enrichment ratio of all clones that carry NNK mutations at two given positions, ignoring the third NNK mutation. In order to filter out sampling effects, mutation pairs that had less than 10 sequence counts either in the sorted or unsorted sample, were removed from the analysis. Epistasis was calculated by combining the enrichment ratios from single and double mutation in a multiplicative model: EnrichAB = EnrichA x EnrichB. The epistasis used is thus defined as: Epistasis = EnrichAB - EnrichA x EnrichB. The highest enriched mutation from the single mutation analysis and from the double mutation analysis were selected for synthesis.
[00446] Figures 37 and 38 show the heavy chain and light chain variable region sequences of affinity matured antibody 6266 variants 1 to 15.
Affinity determination using surface plasmon resonance
[00447] The binding affinity of anti-BACEl Fab antibodies by single-cycle kinetics was determined using surface plasmon resonance (SRP) measurement with a BIAcore™ T200 instrument. Briefly, series S sensor chip CM5 was activated with EDC and NHS reagents according to the supplier's instructions, and anti-His antibody was coupled to achieve approximately 1000 response units (RU), then following by blocking un-reacted groups with 1M ethanolamine. For kinetics measurements, His-tagged BACE1 protein was first injected at ΙΟμΙ/min flow rate to capture approximately 100 RU at 3 different flow cells (FC), except for FC1 (reference), and then 5-fold serial dilutions of Fab in HBS-P buffer (0.01M HEPES pH 7.4, 0.15M NaCl, 0.005% surfactant P20) from low (0.08nM) to high (50nM) were injected (flow rate:
30μ1/ηϊίη) one after the other in the same cycle with no regeneration between injections. The sensorgram was recorded and subject to reference and buffer subtraction before evaluating by BIAcore™ T200 Evaluation Software (version 2.0). Association rates ( ) and dissociation rates (koff) were calculated using a simple one-to-one Langmuir binding model. The equilibrium dissociation constant (Kd) was calculated as the ratio koff/kon.
Thermal melt temperature (Tm) determination by differential scanning fluorimetry (DSF)
[00448] DSF monitors thermal unfolding of proteins in the presence of a fluorescent dye and is typically performed by using a real-time PCR instrument (e.g., Bio-Rad CFX). SYPRO orange dye (Invitrogen, cat. no. S6650) is diluted 1 :20 in PBS. One μΐ of diluted dye is added to 24μ1 Fab protein (~100ug/ml) in a well. As the temperature increases from 20°C to 100°C in the real-time PCPv instrument (Bio-Rad CFX), the fluorescence intensity is plotted and the inflection point of the transition curve (Tm) is calculated using, for example, the Boltzmann equation. See Nature Protocols, 2007, 2:2212-2221.
[00449] Figure 39 shows the association rate, dissociation rate, dissociation constant, and melting temperature for the affinity matured antibody 6266 variants 1 to 15. All of the variants showed improved affinity (KD) compared to antibody 6266.
EXAMPLE 16 - MODIFICATION OF BISPECIFIC ANTIBODY SEQUENCES
[00450] A mutation in heavy chain variable region FR4, methionine at position 108 changed to leucine (M108L), may be incorporated to promote stability of an anti-TfR/BACEl bispecific antibody. Binding affinity of an anti-TfR Fab comprising the M108L mutation was similar to the unmodified Fab, as shown in Table 15.
Table 15: Binding affinity of anti-TfR Fab
ka (1/Ms) kd (1/s) KD (M)
antiTfR.52A.Fab 3.71E+05 0.0204 5.50E-08
antiTfR.52A.M108L.Fab 3.20E+05 0.02312 7.22E-08
[00451] It is expected that a bispecific antibody comprising an anti-TfR arm comprising an anti- TfR2.hIgGl .LALAPG.YTE heavy chain having an M108L mutation (SEQ ID NO: 394) will be more stable than the bispecific antibody comprising the same anti-TfR arm without the M108L heavy chain mutation, while also retaining binding affinity for TfR.
[00452] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, the descriptions and examples should not be construed as limiting the scope of the invention. The disclosures of all patent and scientific literature cited herein are expressly incorporated in their entirety by reference. Table of Certain Sequences
SEQ Descripton Sequence
ID
O
1 human TfR MMDQARSAFS NLFGGEPLSY TRFSLARQVD
GDNSHVEMKL AVDEEENADN NTKANVTKPK
RCSGSICYGT IAVIVFFLIG FMIGYLGYCK
GVEPKTECER LAGTESPVRE EPGEDFPAAR
RLYWDDLKRK LSEKLDSTDF TSTIKLLNEN
SYVPREAGSQ KDENLALYVE NQFREFKLSK
VWRDQHFVKI QVKDSAQNSV I IVDKNGRLV
YLVENPGGYV AYSKAATVTG KLVHANFGTK
KDFEDLYTPV NGSIVIVRAG KITFAEKVAN
AESLNAIGVL IYMDQTKFPI VNAELSFFGH
AHLGTGDPYT PGFPSFNHTQ FPPSRSSGLP
NIPVQTISRA AAEKLFGNME GDCPSDWKTD
STCRMVTSES KNVKLTVSNV LKEIKILNIF
GVIKGFVEPD HYVWGAQRD AWGPGAAKSG
VGTALLLKLA QMFSDMVLKD GFQPSRSIIF
ASWSAGDFGS VGATEWLEGY LSSLHLKAFT
YINLDKAVLG TSNFKVSASP LLYTLIEKTM
QNVKHPVTGQ FLYQDSNWAS KVEKLTLDNA
AFPFLAYSGI PAVSFCFCED TDYPYLGTTM
DTYKELIERI PELNKVARAA AEVAGQFVIK
LTHDVELNLD YERYNSQLLS FVRDLNQYRA
DIKEMGLSLQ WLYSARGDFF RATSRLTTDF
GNAEKTDRFV MKKLNDRVMR VEYHFLSPYV
SPKESPFRHV FWGSGSHTLP ALLENLKLRK
QNNGAFNETL FRNQLALATW TIQGAANALS
GDVWDIDNEF
2 primate TfR; Genbank MMDQARSAFS NLFGGEPLSY TRFSLARQVD reference AFD18260.1 GDNSHVEMKL GVDEEENTDN NTKPNGTKPK
RCGGNICYGT IAVIIFFLIG FMIGYLGYCK
GVEPKTECER LAGTESPARE EPEEDFPAAP
RLYWDDLKRK LSEKLDTTDF TSTIKLLNEN
LYVPREAGSQ KDENLALYIE NQFREFKLSK
VWRDQHFVKI QVKDSAQNSV I IVDKNGGLV
YLVENPGGYV AYSKAATVTG KLVHANFGTK
KDFEDLDSPV NGSIVIVRAG KITFAEKVAN
AESLNAIGVL IYMDQTKFPI VKADLSFFGH
AHLGTGDPYT PGFPSFNHTQ FPPSQSSGLP
NIPVQTISRA AAEKLFGNME GDCPSDWKTD
STCKMVTSEN KSVKLTVSNV LKETKILNIF
GVIKGFVEPD HYVWGAQRD AWGPGAAKSS
VGTALLLKLA QMFSDMVLKD GFQPSRSIIF
ASWSAGDFGS VGATEWLEGY LSSLHLKAFT
YINLDKAVLG TSNFKVSASP LLYTLIEKTM
QDVKHPVTGR SLYQDSNWAS KVEKLTLDNA
AFPFLAYSGI PAVSFCFCED TDYPYLGTTM
DTYKELVERI PELNKVARAA AEVAGQFVIK
LTHDTELNLD YERYNSQLLL FLRDLNQYRA
DVKEMGLSLQ WLYSARGDFF RATSRLTTDF
RNAEKRDKFV MKKLNDRVMR VEYYFLSPYV
SPKESPFRHV FWGSGSHTLS ALLESLKLRR
QNNSAFNETL FRNQLALATW TIQGAANALS
GDVWDIDNEF
3 mouse Tfr; Genbank MMDQARSAFS NLFGGEPLSY TRFSLARQVD reference AAH54522.1 GDNSHVEMKL AADEEENADN NMKASVRKPK
RFNGRLCFAA IALVIFFLIG FMSGYLGYCK
RVEQKEECVK LAETEETDKS ETMETEDVPT
SSRLYWADLK TLLSEKLNS I EFADTIKQLS
QNTYTPREAG SQKDESLAYY IENQFHEFKF
SKVWRDEHYV KIQVKSSIGQ NMVTIVQSNG NLDPVESPEG YVAFSKPTEV SGKLVHANFG
TKKDFEELSY SVNGSLVIVR AGEITFAEKV
ANAQSFNAIG VLIYMDKNKF PVVEADLALF
GHAHLGTGDP YTPGFPSFNH TQFPPSQSSG
LPNIPVQTIS RAAAEKLFGK MEGSCPARWN
IDSSCKLELS QNQNVKLIVK NVLKERRILN
IFGVIKGYEE PDRYVWGAQ RDALGAGVAA
KSSVGTGLLL KLAQVFSDMI SKDGFRPSRS
I IFASWTAGD FGAVGATEWL EGYLSSLHLK
AFTYINLDKV VLGTSNFKVS ASPLLYTLMG
KIMQDVKHPV DGKSLYRDSN WISKVEKLSF
DNAAYPFLAY SGIPAVSFCF CEDADYPYLG
TRLDTYEALT QKVPQLNQMV RTAAEVAGQL
I IKLTHDVEL NLDYEMYNSK LLSFMKDLNQ
FKTDIRDMGL SLQWLYSARG DYFRATSRLT
TDFHNAEKTN RFVMREINDR IMKVEYHFLS
PYVSPRESPF RHIFWGSGSH TLSALVENLK
LRQKNITAFN ETLFRNQLAL ATWTIQGVAN
ALSGDIWNID NEF
147 Human BACE1, isoform B MAQALPWLLL WMGAGVLPAH GTQHGIRLPL
RSGLGGAPLG LRLPRETDEE PEEPGRRGSF
VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI
LVDTGSSNFA VGAAPHPFLH RYYQRQLSST
YRDLRKGVYV PYTQGKWEGE LGTDLVSIPH
GPNVTVRANI AAITESDKFF INGSNWEGIL
GLAYAEIARP DDSLEPFFDS LVKQTHVPNL
FSLQLCGAGF PLNQSEVLAS VGGSMIIGGI
DHSLYTGSLW YTPIRREWYY EVIIVRVEIN
GQDLKMDCKE YNYDKSIVDS GTTNLRLPKK
VFEAAVKSIK AASSTEKFPD GFWLGEQLVC
WQAGTTPWNI FPVISLYLMG EVTNQSFRIT
ILPQQYLRPV EDVATSQDDC YKFAISQSST
GTVMGAVIME GFYWFDRAR KRIGFAVSAC
HVHDEFRTAA VEGPFVTLDM EDCGYNIPQT
DESTLMTIAY VMAAICALFM LPLCLMVCQW
CCLRCLRQQH DDFADDISLL K
148 Human BACE1, isoform A MAQALPWLLL WMGAGVLPAH GTQHGIRLPL
RSGLGGAPLG LRLPRETDEE PEEPGRRGSF
VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI
LVDTGSSNFA VGAAPHPFLH RYYQRQLSST
YRDLRKGVYV PYTQGKWEGE LGTDLVSIPH
GPNVTVRANI AAITESDKFF INGSNWEGIL
GLAYAEIARL CGAGFPLNQS EVLASVGGSM
IIGGIDHSLY TGSLWYTPIR REWYYEVIIV
RVEINGQDLK MDCKEYNYDK SIVDSGTTNL
RLPKKVFEAA VKSIKAASST EKFPDGFWLG
EQLVCWQAGT TPWNIFPVIS LYLMGEVTNQ
SFRITILPQQ YLRPVEDVAT SQDDCYKFAI
SQSSTGTVMG AVIMEGFYVV FDRARKRIGF
AVSACHVHDE FRTAAVEGPF VTLDMEDCGY
NIPQTDESTL MTIAYVMAAI CALFMLPLCL
MVCQWCCLRC LRQQHDDFAD DISLLK
149 Human BACE1, isoform C MAQALPWLLL WMGAGVLPAH GTQHGIRLPL
RSGLGGAPLG LRLPRETDEE PEEPGRRGSF
VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI
LVDTGSSNFA VGAAPHPFLH RYYQRQLSST
YRDLRKGVYV PYTQGKWEGE LGTDLPDDSL
EPFFDSLVKQ THVPNLFSLQ LCGAGFPLNQ
SEVLASVGGS MI IGGIDHSL YTGSLWYTPI
RREWYYEVI I VRVEINGQDL KMDCKEYNYD
KSIVDSGTTN LRLPKKVFEA AVKSIKAASS
TEKFPDGFWL GEQLVCWQAG TTPWNIFPVI
SLYLMGEVTN QSFRITILPQ QYLRPVEDVA
TSQDDCYKFA ISQSSTGTVM GAVIMEGFYV VFDRARKRIG FAVSACHVHD EFRTAAVEGP
FVTLDMEDCG YNI PQTDEST LMTIAYVMAA ICALFMLPLC LMVCQWCCLR CLRQQHDDFA DDISLLK
150 Human BACE1, isoform D MAQALPWLLL WMGAGVLPAH GTQHGIRLPL
RSGLGGAPLG LRLPRETDEE PEEPGRRGSF VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI LVDTGSSNFA VGAAPHPFLH RYYQRQLSST YRDLRKGVYV PYTQGKWEGE LGTDLLCGAG FPLNQSEVLA SVGGSMIIGG IDHSLYTGSL WYTPIRREWY YEVIIVRVEI NGQDLKMDCK EYNYDKS IVD SGTTNLRLPK KVFEAAVKSI KAASSTEKFP DGFWLGEQLV CWQAGTTPWN IFPVISLYLM GEVTNQSFRI TILPQQYLRP VEDVATSQDD CYKFAISQSS TGTVMGAVIM EGFYVVFDRA RKRIGFAVSA CHVHDEFRTA AVEGPFVTLD MEDCGYNIPQ TDESTLMTIA YVMAAICALF MLPLCLMVCQ WCCLRCLRQQ HDDFADDISL LK
386 Murine BACE1, isoform 1 MAPALHWLLL WVGSGMLPAQ GTHLGIRLPL
RSGLAGPPLG LRLPRETDEE SEEPGRRGSF VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI LVDTGSSNFA VGAAPHPFLH RYYQRQLSST YRDLRKGVYV PYTQGKWEGE LGTDLVSIPH GPNVTVRANI AAITESDKFF INGSNWEGIL GLAYAEIARP DDSLEPFFDS LVKQTHIPNI FSLQLCGAGF PLNQTEALAS VGGSMIIGGI DHSLYTGSLW YTPIRREWYY EVIIVRVEIN GQDLKMDCKE YNYDKSIVDS GTTNLRLPKK VFEAAVKSIK AASSTEKFPD GFWLGEQLVC WQAGTTPWNI FPVISLYLMG EVTNQSFRIT ILPQQYLRPV EDVATSQDDC YKFAVSQSST GTVMGAVIME GFYWFDRAR KRIGFAVSAC HVHDEFRTAA VEGPFVTADM EDCGYNIPQT DESTLMTIAY VMAAICALFM LPLCLMVCQW RCLRCLRHQH DDFADDISLL K
387 Murine BACE1, isoform 2 MAPALHWLLL WVGSGMLPAQ GTHLGIRLPL
RSGLAGPPLG LRLPRETDEE SEEPGRRGSF VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI LVDTGSSNFA VGAAPHPFLH RYYQRQLSST YRDLRKGVYV PYTQGKWEGE LGTDLVSIPH GPNVTVRANI AAITESDKFF INGSNWEGIL GLAYAEIARP DDSLEPFFDS LVKQTHIPNI FSLQLCGAGF PLNQTEALAS VGGSMIIGGI DHSLYTGSLW YTPIRREWYY EVIIVRVEIN GQDLKMDCKE TEKFPDGFWL GEQLVCWQAG TTPWNIFPVI SLYLMGEVTN QSFRITILPQ QYLRPVEDVA TSQDDCYKFA VSQSSTGTVM GAVIMEGFYV VFDRARKRIG FAVSACHVHD EFRTAAVEGP FVTADMEDCG YNIPQTDEST LMTIAYVMAA ICALFMLPLC LMVCQWRCLR CLRHQHDDFA DDISLLK
388 human BACE1 ECD MAQALPWLLL WMGAGVLPAH GTQHGIRLPL
RSGLGGAPLG LRLPRETDEE PEEPGRRGSF
VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI
LVDTGSSNFA VGAAPHPFLH RYYQRQLSST
YRDLRKGVYV PYTQGKWEGE LGTDLVSIPH
GPNVTVRANI AAITESDKFF INGSNWEGIL
GLAYAEIAR PDDSLEPFFD SLVKQTHVPN
LFSLQLCGAG FPLNQSEVLA SVGGSMIIGG
IDHSLYTGSL WYTPIRREWY YEVIIVRVEI
NGQDLKMDCK EYNYDKS IVD SGTTNLRLPK
KVFEAAVKS I KAASSTEKFP DGFWLGEQLV
CWQAGTTPWN IFPVISLYLM GEVTNQSFRI
TILPQQYLRP VEDVATSQDD CYKFAISQSS TGTVMGAVIM EGFYVVFDRA RKRIGFAVSA
CHVHDEFRTA AVEGPFVTLD MEDCGYNIPQ
TDESTLMTGR A
389 Murine BACE1 ECD MAPALHWLLL WVGSGMLPAQ GTHLGIRLPL
RSGLAGPPLG LRLPRETDEE SEEPGRRGSF
VEMVDNLRGK SGQGYYVEMT VGSPPQTLNI
LVDTGSSNFA VGAAPHPFLH RYYQRQLSST
YRDLRKGVY VPYTQGKWEG ELGTDLVSIP
HGPNVTVRAN IAAITESDKF FINGSNWEGI
LGLAYAEIAR PDDSLEPFFD SLVKQTHI PN
IFSLQLCGAG FPLNQTEALA SVGGSMIIGG
IDHSLYTGRL WYTPIRREWY YEVIIVRVEI
NGQDLKMDCK EYNYDKSIVD SGTTNLRLPK
KVFEAAVKS I KAASSTEKFP DGFWLGEQLV
CWQAGTTPWN IFPVISLYLM GEVTNQSFRI
TILPQQYLRP VEDVATSQDD CYKFAVSQSS
TGTVMGAVIM EGFYVVFDRA RKRIGFAVSA
CHVHDEFRTA AVEGPFVTAD MEDCGYNIPQ
TDESTLMTGR A
329 Anti- EVQLVQSGAE VKKPGASVKV SCKASGYTFT
TfR52A/ 6266.hlgGl . LALAPG SYWMHWVRQA PGQRLEWIGE IAPTNGRTNY bispecific antibody anti- IEKFKSRATL TVDKSASTAY MELSSLRSED
TfR heavy chain TAVYYCARGT RAYHYWGQGT MVTVSSASTK
GPSVFPLAPS SKSTSGGTAA LGCLVKDYFP
EPVTVSWNSG ALTSGVHTFP AVLQSSGLYS
LSSWTVPSS SLGTQTYICN VNHKPSNTKV
DKKVEPKSCD KTHTCPPCPA PEAAGGPSVF
LFPPKPKDTL MISRTPEVTC WVDVSHEDP
EVKFNWYVDG VEVHNAKTKP REEQYNSTYR
WSVLTVLHQ DWLNGKEYKC KVSNKALGAP
IEKTISKAKG QPREPQVYTL PPSREEMTKN
QVSLSCAVKG FYPSDIAVEW ESNGQPENNY
KTTPPVLDSD GSFFLVSKLT VDKSRWQQGN
VFSCSVMHEA LHNHYTQKSL SLSPGK
330 Anti- DIQMTQSPSS LSASVGDRVT ITCRASDNLY
TfR52A/ 6266.hlgGl . LALAPG SNLAWYQQKP GKSPKLLVYD ATNLADGVPS bispecific antibody anti- RFSGSGSGTD YTLTISSLQP EDFATYYCQH
TfR light chain FWGTPLTFGQ GTKVEIKRTV AAPSVFIFPP
SDEQLKSGTA SVVCLLNNFY PREAKVQWKV
DNALQSGNSQ ESVTEQDSKD STYSLSSTLT
LSKADYEKHK VYACEVTHQG LSSPVTKSFN RGEC
331 Anti- EVQLVQSGAE VKKPGSSVKV SCKASGGTLS
TfR52A/ 6266.hlgGl . LALAPG GYGVSWVRQA PGQGLEWMGN I I PGFGTANY bispecific antibody anti- AQKFQGRVTI TADESTSTAY MELSSLRSED
BACE1 heavy chain TAVYYCARSG GTKYGMLDVW GQGTMVTVSS
ASTKGPSVFP LAPSSKSTSG GTAALGCLVK
DYFPEPVTVS WNSGALTSGV HTFPAVLQSS
GLYSLSSWT VPSSSLGTQT YICNVNHKPS
NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG
PSVFLFPPKP KDTLMISRTP EVTCWVDVS
HEDPEVKFNW YVDGVEVHNA KTKPREEQYN
STYRVVSVLT VLHQDWLNGK EYKCKVSNKA
LGAPIEKTIS KAKGQPREPQ VYTLPPSREE
MTKNQVSLWC LVKGFYPSDI AVEWESNGQP
ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW
QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
332 Anti- EIVMTQSPAT LSVSPGERAT LSCRASQSVS
TfR52A/ 6266.hlgGl . LALAPG SNLAWYQQKP GQAPRLLIYG ASTRATGI PA bispecific antibody anti- RFSGSGSGTE FTLTISSLQS EDFAVYYCQQ
BACE1 light chain LILWPPRTFG GGTKVEIKRT VAAPSVFIFP
PSDEQLKSGT ASVVCLLNNF YPREAKVQWK
VDNALQSGNS QESVTEQDSK DSTYSLSSTL
TLSKADYEKH KVYACEVTHQ GLSSPVTKSF NRGEC Anti- EVQLVQSGAE VKKPGASVKV SCKASGYTFT
TfR52A/6266.hlgGl . LALAPG. YTE SYWMHWVRQA PGQRLEWIGE IAPTNGRTNY bispecific antibody anti- IEKFKSRATL TVDKSASTAY MELSSLRSED TfR heavy chain TAVYYCARGT RAYHYWGQGT MVTVSSASTK
GPSVFPLAPS SKSTSGGTAA LGCLVKDYFP EPVTVSWNSG ALTSGVHTFP AVLQSSGLYS LSSWTVPSS SLGTQTYICN VNHKPSNTKV DKKVEPKSCD KTHTCPPCPA PEAAGGPSVF LFPPKPKDTL YITREPEVTC WVDVSHEDP EVKFNWYVDG VEVHNAKTKP REEQYNSTYR WSVLTVLHQ DWLNGKEYKC KVSNKALGAP IEKTISKAKG QPREPQVYTL PPSREEMTKN QVSLSCAVKG FYPSDIAVEW ESNGQPENNY KTTPPVLDSD GSFFLVSKLT VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK
Anti- DIQMTQSPSS LSASVGDRVT ITCRASDNLY
TfR52A/6266.hlgGl . LALAPG. YTE SNLAWYQQKP GKSPKLLVYD ATNLADGVPS bispecific antibody anti- RFSGSGSGTD YTLTISSLQP EDFATYYCQH TfR light chain FWGTPLTFGQ GTKVEIKRTV AAPSVFIFPP
SDEQLKSGTA SVVCLLNNFY PREAKVQWKV DNALQSGNSQ ESVTEQDSKD STYSLSSTLT LSKADYEKHK VYACEVTHQG LSSPVTKSFN
Anti- EVQLVQSGAE VKKPGSSVKV SCKASGGTLS
TfR52A/6266.hlgGl . LALAPG. YTE GYGVSWVRQA PGQGLEWMGN I I PGFGTANY bispecific antibody anti- AQKFQGRVTI TADESTSTAY MELSSLRSED BACE1 heavy chain TAVYYCARSG GTKYGMLDVW GQGTMVTVSS
ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS GLYSLSSWT VPSSSLGTQT YICNVNHKPS NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG PSVFLFPPKP KDTLYITREP EVTCWVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LGAPIEKTIS KAKGQPREPQ VYTLPPSREE MTKNQVSLWC LVKGFYPSDI AVEWESNGQP ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
Anti- EIVMTQSPAT LSVSPGERAT LSCRASQSVS
TfR52A/6266.hlgGl . LALAPG. YTE SNLAWYQQKP GQAPRLLIYG ASTRATGI PA bispecific antibody anti- RFSGSGSGTE FTLTISSLQS EDFAVYYCQQ BACE1 light chain LILWPPRTFG GGTKVEIKRT VAAPSVFIFP
PSDEQLKSGT ASVVCLLNNF YPREAKVQWK VDNALQSGNS QESVTEQDSK DSTYSLSSTL TLSKADYEKH KVYACEVTHQ GLSSPVTKSF NRGEC
Anti-TfR2/6266.hlgGl . LALAPG EVQLVQSGAE VKKPGASVKV SCKASGYTFT bispecific antibody anti- SYWMHWVRQA PGQRLEWIGE INPTNGRTNY TfR heavy chain IEKFKSRATL TVDKSASTAY MELSSLRSED
TAVYYCARGT RAYHYWGQGT MVTVSSASTK GPSVFPLAPS SKSTSGGTAA LGCLVKDYFP EPVTVSWNSG ALTSGVHTFP AVLQSSGLYS LSSWTVPSS SLGTQTYICN VNHKPSNTKV DKKVEPKSCD KTHTCPPCPA PEAAGGPSVF LFPPKPKDTL MISRTPEVTC WVDVSHEDP EVKFNWYVDG VEVHNAKTKP REEQYNSTYR WSVLTVLHQ DWLNGKEYKC KVSNKALGAP IEKTISKAKG QPREPQVYTL PPSREEMTKN QVSLSCAVKG FYPSDIAVEW ESNGQPENNY KTTPPVLDSD GSFFLVSKLT VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK
338 Anti-TfR2/6266.hlgGl . LALAPG DIQMTQSPSS LSASVGDRVT ITCRASDNLY
bispecific antibody anti- SNLAWYQQKP GKSPKLLVYD ATNLADGVPS TfR light chain RFSGSGSGTD YTLTISSLQP EDFATYYCQH
FAGTPLTFGQ GTKVEIKRTV AAPSVFIFPP SDEQLKSGTA SWCLLNNFY PREAKVQWKV
DNALQSGNSQ ESVTEQDSKD STYSLSSTLT LSKADYEKHK VYACEVTHQG LSSPVTKSFN RGEC
339 Anti-TfR2/6266.hlgGl . LALAPG EVQLVQSGAE VKKPGSSVKV SCKASGGTLS
bispecific antibody anti- GYGVSWVRQA PGQGLEWMGN I I PGFGTANY BACE1 heavy chain AQKFQGRVTI TADESTSTAY MELSSLRSED
TAVYYCARSG GTKYGMLDVW GQGTMVTVSS ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS GLYSLSSWT VPSSSLGTQT YICNVNHKPS NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG PSVFLFPPKP KDTLMISRTP EVTCWVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LGAPIEKTIS KAKGQPREPQ VYTLPPSREE MTKNQVSLWC LVKGFYPSDI AVEWESNGQP ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
340 Anti-TfR2/6266.hlgGl . LALAPG EIVMTQSPAT LSVSPGERAT LSCRASQSVS
bispecific antibody anti- SNLAWYQQKP GQAPRLLIYG ASTRATGI PA BACE1 light chain RFSGSGSGTE FTLTISSLQS EDFAVYYCQQ
LILWPPRTFG GGTKVEIKRT VAAPSVFIFP PSDEQLKSGT ASVVCLLNNF YPREAKVQWK VDNALQSGNS QESVTEQDSK DSTYSLSSTL TLSKADYEKH KVYACEVTHQ GLSSPVTKSF NRGEC
Anti- EVQLVQSGAE VKKPGASVKV SCKASGYTFT
TfR2/6266. hlgGl . LALAPG . YTE SYWMHWVRQA PGQRLEWIGE INPTNGRTNY bispecific antibody anti- IEKFKSRATL TVDKSASTAY MELSSLRSED TfR heavy chain TAVYYCARGT RAYHYWGQGT MVTVSSASTK
GPSVFPLAPS SKSTSGGTAA LGCLVKDYFP EPVTVSWNSG ALTSGVHTFP AVLQSSGLYS LSSWTVPSS SLGTQTYICN VNHKPSNTKV DKKVEPKSCD KTHTCPPCPA PEAAGGPSVF LFPPKPKDTL YITREPEVTC WVDVSHEDP EVKFNWYVDG VEVHNAKTKP REEQYNSTYR WSVLTVLHQ DWLNGKEYKC KVSNKALGAP IEKTISKAKG QPREPQVYTL PPSREEMTKN QVSLSCAVKG FYPSDIAVEW ESNGQPENNY KTTPPVLDSD GSFFLVSKLT VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK
Anti- EVQLVQSGAE VKKPGASVKV SCKASGYTFT
TfR2/ 6266. hlgGl. LALAPG. YTE SYWMHWVRQA PGQRLEWIGE INPTNGRTNY M108L bispecific antibody IEKFKSRATL TVDKSASTAY MELSSLRSED anti-TfR heavy chain TAVYYCARGT RAYHYWGQGT LVTVSSASTK
GPSVFPLAPS SKSTSGGTAA LGCLVKDYFP EPVTVSWNSG ALTSGVHTFP AVLQSSGLYS LSSWTVPSS SLGTQTYICN VNHKPSNTKV DKKVEPKSCD KTHTCPPCPA PEAAGGPSVF LFPPKPKDTL YITREPEVTC WVDVSHEDP EVKFNWYVDG VEVHNAKTKP REEQYNSTYR WSVLTVLHQ DWLNGKEYKC KVSNKALGAP IEKTISKAKG QPREPQVYTL PPSREEMTKN QVSLSCAVKG FYPSDIAVEW ESNGQPENNY KTTPPVLDSD GSFFLVSKLT VDKSRWQQGN VFSCSVMHEA LHNHYTQKSL SLSPGK
Anti- DIQMTQSPSS LSASVGDRVT ITCRASDNLY
TfR2/ 6266. hlgGl. LALAPG. YTE SNLAWYQQKP GKSPKLLVYD ATNLADGVPS bispecific antibody anti- RFSGSGSGTD YTLTISSLQP EDFATYYCQH TfR light chain FAGTPLTFGQ GTKVEIKRTV AAPSVFIFPP
SDEQLKSGTA SWCLLNNFY PREAKVQWKV DNALQSGNSQ ESVTEQDSKD STYSLSSTLT LSKADYEKHK VYACEVTHQG LSSPVTKSFN I Anti- EVQLVQSGAE VKKPGSSVKV SCKASGGTLS
TfR2/6266. hlgGl . LALAPG . YTE GYGVSWVRQA PGQGLEWMGN I I PGFGTANY bispecific antibody anti- AQKFQGRVTI TADESTSTAY MELSSLRSED BACE1 heavy chain TAVYYCARSG GTKYGMLDVW GQGTMVTVSS
ASTKGPSVFP LAPSSKSTSG GTAALGCLVK DYFPEPVTVS WNSGALTSGV HTFPAVLQSS GLYSLSSWT VPSSSLGTQT YICNVNHKPS NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG PSVFLFPPKP KDTLYITREP EVTCWVDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQYN STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LGAPIEKTIS KAKGQPREPQ VYTLPPSREE MTKNQVSLWC LVKGFYPSDI AVEWESNGQP ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
I Anti- EIVMTQSPAT LSVSPGERAT LSCRASQSVS
TfR2/6266. hlgGl . LALAPG . YTE SNLAWYQQKP GQAPRLLIYG ASTRATGIPA bispecific antibody anti- RFSGSGSGTE FTLTISSLQS EDFAVYYCQQ BACE1 light chain LILWPPRTFG GGTKVEIKRT VAAPSVFIFP
PSDEQLKSGT ASVVCLLNNF YPREAKVQWK VDNALQSGNS QESVTEQDSK DSTYSLSSTL TLSKADYEKH KVYACEVTHQ GLSSPVTKSF NRGEC
395 Anti-TfR52A M108L heavy EVQLVQSGAE VKKPGASVKV SCKASGYTFT
chain variable region SYWMHWVRQA PGQRLEWIGE IAPTNGRTNY
IEKFKSRATL TVDKSASTAY MELSSLRSED TAVYYCARGT RAYHYWGQGT LVTVSS
396 Anti-TfR2 M108L heavy chain EVQLVQSGAE VKKPGASVKV SCKASGYTFT
variable region SYWMHWVRQA PGQRLEWIGE INPTNGRTNY
IEKFKSRATL TVDKSASTAY MELSSLRSED TAVYYCARGT RAYHYWGQGT LVTVSS
397 Anti-TfR52A light chain DIQMTQSPSS LSASVGDRVT ITCRASDNLY
variable region SNLAWYQQKP GKSPKLLVYD ATNLADGVPS
RFSGSGSGTD YTLTISSLQP EDFATYYCQH FWGTPLTFGQ GTKVEIK
398 Anti-TfR2 light ch, DIQMTQSPSS LSASVGDRVT ITCRASDNLY
variable region SNLAWYQQKP GKSPKLLVYD ATNLADGVPS
RFSGSGSGTD YTLTISSLQP EDFATYYCQH FAGTPLTFGQ GTKVEIK
399 I Anti-BACEl 6266 heavy chain EVQLVQSGAE VKKPGSSVKV SCKASGGTLS
variable region GYGVSWVRQA PGQGLEWMGN I I PGFGTANY
AQKFQGRVTI TADESTSTAY MELSSLRSED TAVYYCARSG GTKYGMLDVW GQGTMVTVSS
400 I Anti-BACEl 6266 light chain EIVMTQSPAT LSVSPGERAT LSCRASQSVS
variable region SNLAWYQQKP GQAPRLLIYG ASTRATGIPA
RFSGSGSGTE FTLTISSLQS EDFAVYYCQQ LILWPPRTFG GGTKVEIK
375 I VL HVR2 of 6266.3, 6266.6, GASTRAY
6266.7, 6266.8, 6266.11
376 I VH HVR1 of 6266.1, 6266.2, GTLSHYGVS
6266.3, 6266.4, 6266.5,
6266.6,6266.7
377 I VH HVR2 of 6266.1, 6266.2, Nil PGIGTANYAQKFQG
6266.3, 6266.4, 6266.5,
6266.6,6266.7
378 VH HVR3 for 6266.5, 6266.6 ARSGGTQYGMLDV
379 VH HVR3 for 6266.7, 6266.15 ARSGGTKYGELDV
380 VH HVR1 for 6266.8, 6266.9 GTLKGYGVS 381 VH HVR1 for 6266.12 GTLNGYGVS
382 VH HVR1 for 6266.13 GTLSGYGMS
383 VH HVR2 for 6266.14 Nil PGFGVANYAQKFQG
384 VH HVR3 for 6266.8, 6266.9 ARGGGTKYGMLDV
385 VH HVR3 for 6266.14 ARSGGTKWGMLDV
390 hlgGl . LALAPG constant ASTKGPSVFP LAPSSKSTSG GTAALGCLVK region with T366S, L368A DYFPEPVTVS WNSGALTSGV HTFPAVLQSS and Y407V "hole" mutations GLYSLSSWT VPSSSLGTQT YICNVNHKPS
NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG
PSVFLFPPKP KDTLMISRTP EVTCWVDVS
HEDPEVKFNW YVDGVEVHNA KTKPREEQYN
STYRVVSVLT VLHQDWLNGK EYKCKVSNKA
LGAPIEKTIS KAKGQPREPQ VYTLPPSREE
MTKNQVSLSC AVKGFYPSDI AVEWESNGQP
ENNYKTTPPV LDSDGSFFLV SKLTVDKSRW
QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
391 hlgGl. LALAPG constant ASTKGPSVFP LAPSSKSTSG GTAALGCLVK region with T366W "knob" DYFPEPVTVS WNSGALTSGV HTFPAVLQSS mutation GLYSLSSWT VPSSSLGTQT YICNVNHKPS
NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG
PSVFLFPPKP KDTLMISRTP EVTCWVDVS
HEDPEVKFNW YVDGVEVHNA KTKPREEQYN
STYRVVSVLT VLHQDWLNGK EYKCKVSNKA
LGAPIEKTIS KAKGQPREPQ VYTLPPSREE
MTKNQVSLWC LVKGFYPSDI AVEWESNGQP
ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW
QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
392 hlgGl. LALAPG. YTE constant ASTKGPSVFP LAPSSKSTSG GTAALGCLVK region with T366S, L368A DYFPEPVTVS WNSGALTSGV HTFPAVLQSS and Y407V "hole" mutations GLYSLSSWT VPSSSLGTQT YICNVNHKPS
NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG
PSVFLFPPKP KDTLYITREP EVTCWVDVS
HEDPEVKFNW YVDGVEVHNA KTKPREEQYN
STYRVVSVLT VLHQDWLNGK EYKCKVSNKA
LGAPIEKTIS KAKGQPREPQ VYTLPPSREE
MTKNQVSLSC AVKGFYPSDI AVEWESNGQP
ENNYKTTPPV LDSDGSFFLV SKLTVDKSRW
QQGNVFSCSV MHEALHNHYT QKSLSLSPGK
393 hlgGl. LALAPG. YTE constant ASTKGPSVFP LAPSSKSTSG GTAALGCLVK region with T366W "knob" DYFPEPVTVS WNSGALTSGV HTFPAVLQSS mutation GLYSLSSWT VPSSSLGTQT YICNVNHKPS
NTKVDKKVEP KSCDKTHTCP PCPAPEAAGG
PSVFLFPPKP KDTLYITREP EVTCWVDVS
HEDPEVKFNW YVDGVEVHNA KTKPREEQYN
STYRVVSVLT VLHQDWLNGK EYKCKVSNKA
LGAPIEKTIS KAKGQPREPQ VYTLPPSREE
MTKNQVSLWC LVKGFYPSDI AVEWESNGQP
ENNYKTTPPV LDSDGSFFLY SKLTVDKSRW
QQGNVFSCSV MHEALHNHYT QKSLSLSPGK

Claims

WHAT IS CLAIMED IS:
1. A multispecific antibody comprising a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (TfR) and primate TfR, wherein the antibody does not inhibit the binding of transferrin to TfR; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the second antigen binding site comprises:
a) an HVR-H1 sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201; an HVR-L1 sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248; or
b) an HVR-H1 sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385; an HVR-L1 sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247.
2. A multispecific antibody comprising a first half antibody comprising a first antigen binding site that binds to human TfR and primate TfR, wherein the antibody does not inhibit the binding of transferrin to TfR, and wherein one or more properties of the antibody have been modified to reduce or eliminate the impact of the antibody on reticulocytes and/or reduce the severity or presence of acute clinical symptoms in a subject or mammal treated with the antibody; and a second half antibody comprising a second antigen binding site that binds BACE1, wherein the second antigen binding site comprises:
a) an HVR-H1 sequence selected from SEQ ID NOs: 151 to 156; an HVR-H2 sequence selected from SEQ ID NOs: 172 to 175; an HVR-H3 sequence selected from SEQ ID NOs: 200 and 201; an HVR-L1 sequence selected from SEQ ID NOs: 212 and 213; an HVR-L2 sequence selected from SEQ ID NOs: 219 and 220; and an HVR-L3 sequence selected from SEQ ID NOs: 225 to 228 and 248; or
b) an HVR-H1 sequence selected from SEQ ID NOs: 157 to 171, 376, 381, and 382; an HVR-H2 sequence selected from SEQ ID NOs: 176 to 199, 377, 383, and 405; an HVR-H3 sequence selected from SEQ ID NOs: 202 to 211, 378, 379, 384, and 385; an HVR-L1 sequence selected from SEQ ID NOs: 214 to 218; an HVR-L2 sequence selected from SEQ ID NOs: 219 to 224 and 375; and an HVR-L3 sequence selected from SEQ ID NOs: 229 to 247.
3. The antibody of claim 2, wherein the one or more properties are selected from the effector function of the antibody Fc region, the complement activation function of the antibody, the half-life of the antibody and the affinity of the antibody for Tf .
4. The antibody of claim 2 or claim 3, wherein the one or more properties are selected from the effector function of the antibody Fc region and the complement activation function of the antibody, and wherein the effector function or complement activation function has been reduced or eliminated relative to a wild-type antibody of the same isotype.
5. The antibody of claim 4, wherein the effector function is reduced or eliminated by a method selected from reduction of glycosylation of the antibody, modification of the antibody isotype to an isotype that naturally has reduced or eliminated effector function, and modification of the Fc region.
6. The antibody of claim 5, wherein the glycosylation of the antibody is reduced by a method selected from: production of the antibody in an environment that does not permit wild-type glycosylation; removal of carbohydrate groups already present on the antibody; and modification of the antibody such that wild-type glycosylation does not occur.
7. The antibody of claim 6, wherein the antibody is produced in a non-mammalian cell production system, or where the antibody is produced synthetically.
8. The antibody of claim 6, wherein the Fc region of the antibody comprises a mutation at position 297 such that the wild-type asparagine residue at that position is replaced with another amino acid that interferes with glycosylation at that position.
9. The antibody of any one of the preceding claims, which is a monoclonal antibody.
10. The antibody of any one of the preceding claims, wherein the first antigen binding site is human or humanized.
11. The antibody of any one of the preceding claims, wherein the second antigen binding site is human.
12. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises HV -L3, HVR-H2, and HVR-H3, respectively comprising the amino acid sequences of: SEQ ID NOs: 31, 33 and 34; SEQ ID NOs: 36, 38 and 39; SEQ ID NOs: 36, 40 and 34; SEQ ID NOs: 42, 43 and 44; SEQ ID NOs: 31, 33 and 34; SEQ ID NOs: 46, 48 and 49; SEQ ID NOs: 52, 54 and 55; SEQ ID NOs: 52, 58 and 59; SEQ ID NOs: 62, 63 and 55; SEQ ID NOs: 52, 65 and 55; SEQ ID NOs: 68, 69 and 70; SEQ ID NOs: 73, 75 and 76; SEQ ID NOs: 79, 81 and 82; SEQ ID NOs: 79, 83 and 84; SEQ ID NOs: 87, 89 and 90; SEQ ID NOs: 93, 95 and 96; SEQ ID NOs: 99, 101 and 102; SEQ ID NOs: 127, 33 and 34; SEQ ID NOs:52, 156 and 55; SEQ ID NOs:, 52, 157 and 55, or SEQ ID NOs:, 155, 54 and 55.
13. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises HVR-H1, HVR-H2, and HVR-H3, respectively comprising the amino acid sequences of: SEQ ID NOs: 32, 33 and 34; SEQ ID NOs: 37, 38 and 39; SEQ ID NOs: 32, 40 and 34; SEQ ID NOs: 37, 43 and 44; SEQ ID NOs: 32, 33 and 34; SEQ ID NOs: 47, 48 and 49; SEQ ID NOs: 53, 54 and 55; SEQ ID NOs: 53, 58 and 59; SEQ ID NOs: 53, 63 and 55; SEQ ID NOs: 53, 65 and 55; SEQ ID NOs: 53, 69 and 70; SEQ ID NOs: 74, 75 and 76; SEQ ID NOs: 80, 81 and 82; SEQ ID NOs: 80, 83 and 84; SEQ ID NOs: 88, 89 and 90; SEQ ID NOs: 94, 95 and 96; SEQ ID NOs: 100, 101 and 102; SEQ ID NOs: 53, 156 and 55 or SEQ ID NOs: 53, 157 and 55.
14. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises HVR-Ll, HVR-L2, and HVR-L3, respectively comprising the amino acid sequences of: SEQ ID NOs: 29, 30 and 31 ; SEQ ID NOs: 35, 30 and 36; SEQ ID NOs: 41, 30 and 42; SEQ ID NOs: 29, 30 and 31; SEQ ID NOs: 45, 30 and 46; SEQ ID NOs: 50, 51 and 52; SEQ ID NOs: 56, 57 and 52; SEQ ID NOs: 60, 61 and 62; SEQ ID NOs: 60, 64 and 52; SEQ ID NOs: 66, 67 and 68; SEQ ID NOs: 71, 72 and 73; SEQ ID NOs: 77, 78 and 79; SEQ ID NOs: 85, 86 and 87; SEQ ID NOs: 91, 92 and 93; SEQ ID NOs: 97, 98 and 99, SEQ ID NOs: 29, 30 and 127 or SEQ ID NOs: 50, 51 and 155.
15. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises at least one HVR-H1, HVR-H2, HVR-H3, HVR-Ll, HVR-L2, or HVR-L3 sequence selected from:
a) an HVR-H1 sequence of SEQ ID NO: 47, 53, or 100;
b) an HVR-H2 sequence of SEQ ID NO: 48, 69, 101, 156 or 157;
c) an HVR-H3 sequence of SEQ ID NO: 49, 76, or 102;
d) an HVR-Ll sequence of SEQ ID NO: 45, 66 or 97;
e) an HVR-L2 sequence of SEQ ID NOs: 30, 67 or 98; and
f) an HVR-L3 sequence of SEQ ID NOs: 46, 68 or 102.
16. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises (a) a VH sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 7, 8, 9, 10, 15, 16, 17, 18, 20, 25, 26, 27, 28, 108, 114, 120, 126, 403 or 404; (b) a VL sequence having at least 95% sequence identity to the amino acid sequence of SEQ ID NO:4, 5, 6, 11, 12, 13, 14, 19, 21, 22, 23, 24, 105, 111, 117, 123, 401, 402 or (c) a VH sequence as in (a) and a VL sequence as in (b).
17. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises a heavy chain variable region (VH) sequence of
a) SEQ ID NO: 108;
b) SEQ ID NO: 114; c) SEQ ID NO: 120;
d) SEQ ID NO: 126;
e) SEQ ID NO: 403; or
f) SEQ ID NO: 404.
18. The antibody of of any one of the preceding claims, wherein the first antigen binding site comprises a light chain variable region (VL) sequence of
a) SEQ ID NO: 105;
b) SEQ ID NO: 111;
c) SEQ ID NO: 117;
d) SEQ ID NO: 123;
e) SEQ ID NO: 402; or
f) SEQ ID NO: 401.
19. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises:
a) a VH sequence of SEQ ID NO: 108 and a VL sequence of SEQ ID NO:105;
b) a VH sequence of SEQ ID NO: 114 and a VL sequence of SEQ ID NO: 111 ;
c) a VH sequence of SEQ ID NO: 120 and a VL sequence of SEQ ID NO: 117;
d) a VH sequence of SEQ ID NO: 126 and a VL sequence of SEQ ID NO: 123;
e) a VH sequence of SEQ ID NO: 403 and a VL sequence of SEQ ID NO: 105; f) a VH sequence of SEQ ID NO: 404 and a VL sequence of SEQ ID NO: 105; g) a VH sequence of SEQ ID NO: 108 and a VL sequence of SEQ ID NO: 155; h) a VH sequence of SEQ ID NO: 108 and a VL sequence of SEQ ID NO: 401 ; i) a VH sequence of SEQ ID NO: 108 and a VL sequence of SEQ ID NO: 402; j) a VH sequence of SEQ ID NO: 403 and a VL sequence of SEQ ID NO: 401 ; k) a VH sequence of SEQ ID NO: 404 and a VL sequence of SEQ ID NO: 401 ;
1) a VH sequence of SEQ ID NO: 403 and a VL sequence of SEQ ID NO: 105; or m) a VH sequence of SEQ ID NO: 404 and a VL sequence of SEQ ID NO: 105.
20. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises the heavy chain variable region and the light chain variable region of an antibody selected from 7A4, 8A2, 15D2, 10D11, 7B10, 15G11, 16G5, 13C3, 16G4, 16F6, 7G7, 4C2, 1B12, and 13D4.
21. The antibody of any one of claims 1 to 19, wherein the first antigen binding site comprises the heavy chain variable region and the light chain variable region of an antibody selected from 15Gl l.vl, 15Gl l.v2, 15Gl l .v3, 15Gl l .v4, 15Gl l .v5, 7A4.vl; 7A4.v2, 7A4.v3, 7A4.v4, 7A4.v5, 7A4.v6, 7A4.v7, 7A4.v8, 7A4.v9, 7A4.vlO, 7A4.vl l, 7A4.vl2, 7A4.vl3, 7A4.vl4, 7A4.vl5, 7G7.vl , 16F6.vl , 16F6.v2, 16F6.v3, 16F6.v4, 15G1 1.N52A, 15G1 1.T53A and 15G11.W92A.
22. The antibody of any one of the preceding claims, wherein the first antigen binding site comprises a sequence corresponding to, or one or more HVR sequences set forth for, any one of the clones in Figures 3, 4 and 19.
23. The antibody of any one of the preceding claims, wherein the first antigen binding site binds to the same epitope on TfR as an antibody selected from antibodies 7A4, 8A2, 15D2, 10D11 , 7B10, 15G1 1 , 16G5, 13C3, 16G4, 16F6, 7G7, 4C2, 1B12, 13D4, 15Gl l .vl, 15Gl l .v2, 15G11.V3, 15G11.V4, 15Gl l .v5, 7A4.vl ; 7A4.v2, 7A4.v3, 7A4.v4, 7A4.v5, 7A4.v6, 7A4.v7, 7A4.v8, 7A4.v9, 7A4.vl O, 7A4.vl l , 7A4.vl2, 7A4.vl3, 7A4.vl4, 7A4.vl5, 7G7.vl , 16F6.vl , 16F6.v2, 16F6.v3, 16F6.v4, 15G1 1.N52A, 15Gl l .T53A or 15G1 1.W92A.
24. The antibody of any one of the preceding claims, wherein the antibody has an affinity (KD) for human TfR of about 1 pM to about 100 μΜ.
25. The antibody of any one of the preceding claims, wherein the antibody has an affinity (KD) for human TfR of about 20 nM to 1 μΜ, or about 30 nM to 1 μΜ, or about 40 nM to 1 μΜ.
27. The antibody of any one of the preceding claims, wherein the second antigen binding site comprises the HVR-H1 , HVR-H2, HVR-H3, HVR-Ll , HVR-L2, and HVR-L3 of an antibody selected from the antibodies in Table 1.
28. The antibody of claim 27, wherein the antibody is 6266.
29. The antibody of claim 28, wherein the antibody comprises an HVR-H1 of SEQ ID NO: 15; an HVR-H2 sequence of SEQ ID NO: 29; an HVR-H3 sequence of SEQ ID NO: 52; an HVR-Ll sequence of SEQ ID NO: 65; an HVR-L2 sequence of SEQ ID NO: 71 ; and an HVR-L3 sequence of SEQ ID NO: 80.
30. The antibody of any one of the preceding claims, wherein the second antigen binding site comprises:
a) a heavy chain variable region sequence having at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374; or
b) a light chain variable region sequence having at least 90% sequence identity to an amino acid sequence selected from SEQ ID NOs: 298 to 328, 345 to 351 , and 359 to 366; or
c) a heavy chain variable region sequence as in (a) and a light chain variable domain sequence as in (b).
31. The antibody of any one of the preceding claims, wherein the second antigen binding site comprises:
a) a heavy chain variable region sequence selected from SEQ ID NOs: 249 to 297, 352 to 358, and 367 to 374; or
b) a light chain variable region sequence selected from SEQ ID NOs: 298 to 328, 345 to 351, and 359 to 366; or
c) a heavy chain variable region sequence as in (a) and a light chain variable domain sequence as in (b).
32. The antibody of any one of the preceding claims, wherein the second antigen binding site comprises:
a) a heavy chain variable domain sequence having at least 90% sequence identity to a sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374; or
b) a light chain variable domain sequence having at least 90% sequence identity to a sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366; or
c) a heavy chain variable domain sequence as in (a) and a light chain variable domain sequence as in (b).
33. The antibody of any one of the preceding claims, wherein the second antigen binding site comprises:
a) a heavy chain variable domain sequence having a sequence selected from SEQ ID NOs: 288, 352 to 358, and 367 to 374; or
b) a light chain variable domain sequence having a sequence selected from SEQ ID NOs: 306, 345 to 351, and 359 to 366; or
c) a heavy chain variable domain sequence as in (a) and a light chain variable domain sequence as in (b) ; or
d) a heavy chain variable domain sequence and a light chain variable domain sequence of an antibody selected from 6266 and 6266 variants 1-15.
34. The antibody of any one of the preceding claims, wherein antibody modulates the activity of BACEl.
35. The antibody of claim 34, wherein the antibody inhibits the activity of BACEl .
36. The antibody of claim 34 or claim 35, wherein BACEl activity is measured using a homogeneous time-resolved fluorescence (HTRF) assay.
37. The antibody of claim 34 or claim 35, wherein BACEl activity is measured using a cell line that expresses a BACEl substrate.
38. The antibody of claim 37, wherein the BACEl substrate is amyloid precursor protein (APP).
39. The antibody of claim 34 or claim 35, wherein BACE1 activity is measured in tissue from an animal that has been administered the multispecific antibody.
40. The antibody of claim 39, wherein the tissue is brain tissue.
41. The antibody of claim 39 or claim 40, wherein the animal is selected from a mouse, rat, rabbit, dog, monkey, and non-human primate.
42. The antibody of any one of the preceding claims, wherein the antibody is an IgG antibody.
43. The antibody of claim 42, wherein the antibody is an IgGl or IgG4 antibody.
44. The antibody of claim 43, wherein the antibody is an IgGl antibody.
45. The antibody of any one of the preceding claims, wherein the antibody comprises a first heavy chain constant region and a second heavy chain constant region, wherein the first heavy chain constant region comprises a knob mutation and the second heavy chain constant region comprises a hole mutation.
46. The antibody of claim 44, wherein the first heavy chain constant region is fused to the first antigen binding site.
47. The antibody of claim 45 or claim 46, wherein the second heavy chain constant region is fused to the second antigen binding site.
48. The antibody of claim 45, wherein the first heavy chain constant region is fused to the second antigen binding site.
49. The antibody of claim 45 or claim 48, wherein the second heavy chain constant region is fused to the first antigen binding site.
50. The antibody of any one of claims 45 to 49, wherein the antibody is an IgGl antibody and wherein the knob mutation comprises a T366W mutation.
51. The antibody of any one of claims claim 45 to 50, wherein the antibody is an IgGl antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V.
52. The antibody of any one of claims 45 to 49, wherein the antibody is an IgG4 antibody and wherein the knob mutation comprises a T366W mutation.
53. The antibody of any one of claims 45 to 49 and 52, wherein the antibody is an IgG4 antibody and wherein the hole mutation comprises at least one, at least two, or three mutations selected from T366S, L368A, and Y407V mutations.
54. The antibody of any one of the preceding claims, wherein the effector function is reduced or eliminated by at least one modification of the Fc region.
55. The antibody of claim 54, wherein the effector function or complement activation function is reduced or eliminated by deletion of all or a portion of the Fc region, or by engineering the antibody such that it does not include an Fc region or non-Fc region competent for effector function or complement activation function.
56. The antibody of claim 55, wherein the modification is selected from: a point mutation of the Fc region to impair binding to one or more Fc receptors selected from the following positions: 234, 235, 238, 239, 248, 249, 252, 254, 265, 268, 269, 270, 272, 278, 289, 292, 293, 294, 295, 296, 297, 298, 301, 303, 322, 324, 327, 329, 333, 335, 338, 340, 373, 376, 382, 388, 389, 414, 416, 419, 434, 435, 437, 438, and 439; a point mutation of the Fc region to impair binding to Clq selected from the following positions: 270, 322, 329, and 321 ; eliminating some or all of the Fc region, and a point mutation at position 132 of the CHI domain.
57. The antibody of claim 56, wherein the modification is at least one point mutation of the Fc region to impair binding to one or more Fc receptors selected from 234, 235, 265, 297 and 329.
58. The antibody of claim 57, wherein the modification is at positions 297, or positions 265 and 297.
59. The antibody of claim 57, wherein the modification is at positions 234, 235 and
329.
60. The antibody of claim 58, wherein the modification is N297G; D265A and N297A or D265A and N297G.
61. The antibody of claim 59, wherein the modification is L234A, L235A, and P329G.
62. The antibody of any one of the preceding claims, wherein the antibody comprises a modification in the FcRn binding domain of the antibody at a position selected from: 252, 254, 256, 434 and 436.
63. The antibody of claim 62, wherein the half-life of the is greater than the half-life of the parent application that lacks the modification in the FcRn binding domain .
64. The antibody of claim 62 or claim 63, wherein the modification is at positions 252, 254, and 256.
65. The antibody of claim 62 or claim 63, wherein the modification is at positions 434 and 436.
66. The antibody of claim 64, wherein the modification is M252Y, S254T and T256E.
67. The antibody of claim 65, wherein the modification is N434A and Y436I.
68. The antibody of any one of the preceding claims, wherein the first half antibody comprises a first heavy chain and a first light chain, and the second half antibody comprises a second heavy chain and a second light chain, wherein: a) the first heavy chain and the first light chain are selected from SEQ ID NOs: 329 and 330, SEQ ID NOs: 333 and 334, SEQ ID NOs: 337 and 338, SEQ ID NOs: 341 and 342, and SEQ ID NOs: 394 and 342; and
b) the second heavy chain and the second light chain are selected from SEQ ID NOs:
331 and 332, SEQ ID NOs: 335 and 336, SEQ ID NOs: 339 and 340, and SEQ ID NOs: 343 and 344.
69. The antibody of claim 68, wherein:
a) the first heavy chain and the first light chain are selected from SEQ ID NOs: 333 and 334, SEQ ID NOs: 341 and 342, and SEQ ID NOs: 394 and 342; and b) the second heavy chain and the second light chain are selected from SEQ ID NOs:
335 and 336, and SEQ ID NOs: 343 and 344.
70. A multispecific antibody comprising a first half antibody comprising a first antigen binding site that binds to human transferrin receptor (TfR) and primate TfR, and a second half antibody comprising a second antigen binding site that binds BACE1, wherein:
a) the first half antibody comprises a first heavy chain having the sequence of SEQ ID NO: 394 and a first light chain having the sequence of SEQ ID NO: 342, and the second half antibody comprises a second heavy chain having the sequence of SEQ ID NO: 343 and a second light chain having the sequence of SEQ ID NO: 344; or b) the first half antibody comprises a first heavy chain variable region comprising the sequence of SEQ ID NO: 396 and a first light chain variable region comprising the sequence of SEQ ID NO: 398, and the second half antibody comprises a second heavy chain variable region comprising the sequence of SEQ ID NO: 399 and a second light chain variable region comprising the sequence of SEQ ID NO: 400.
71. An isolated nucleic acid encoding:
a) the antibody of any one of claims 1 to 70;
b) the first half antibody of any one of claims 1 to 70; or
c) the second half antibody of any one of claims 1 to 70.
72. A composition comprising a first isolated nucleic acid encoding the first half antibody of any one of claims 1 to 70 and a second isolated nucleic acid encoding the second half antibody of any one of claims 1 to 70.
73. A host cell comprising the nucleic acid of claim 71 or the composition of claim 72.
74. A method of producing an antibody or a half antibody comprising culturing the host cell of claim 73 to produce the antibody or the half antibody, and optionally recovering the antibody or half antibody from the host cell.
75. A pharmaceutical formulation comprising the antibody of any one of claims 1-70 and a pharmaceutically acceptable carrier.
76. The pharmaceutical formulation of claim 75, comprising a compound that mitigates or contributes to the reduction of impact on reticulocyte levels or acute clinical symptoms.
77. The pharmaceutical formulation of claim 76, wherein the compound protects reticulocytes from antibody-related depletion or supports the growth, development, or
reestablishment of reticulocytes.
78. The pharmaceutical formulation of claim 76 or 77, wherein the compound is selected from erythropoietin (EPO), an iron supplement, vitamin C, folic acid, and vitamin B12, or is red blood cells or reticulocytes.
79. A method of treating a neurological disease or disorder in a subject comprising administering to the subject an effective amount of the antibody of any one of claims 1 to 70.
80. A method of reducing amyloid plaques in a subject suffering from, or at risk of contracting, a neurological disease or disorder comprising administering to the subject an effective amount of the antibody of any one of claims 1 to 70.
81. A method of inhibiting amyloid plaque formation in a subject suffering from, or at risk of developing, a neurological disease or disorder comprising administering to the subject an effective amount of the antibody of any one of claims 1 to 70.
82. The method of any one of claims 79 to 81, wherein the neurological disease or disorder is selected from Alzheimer's disease (AD), traumatic brain injury, stroke, glaucoma, dementia, muscular dystrophy (MD), multiple sclerosis (MS), amyotrophic lateral sclerosis (ALS), cystic fibrosis, Angelman's syndrome, Liddle syndrome, Paget's disease, traumatic brain injury, Lewy body disease, postpoliomyelitis syndrome, Shy-Draeger syndrome, olivopontocerebellar atrophy, Parkinson's disease, multiple system atrophy, striatonigral degeneration, supranuclear palsy, bovine spongiform encephalopathy, scrapie, Creutzfeldt- Jakob syndrome, kuru, Gerstmann- Straussler-Scheinker disease, chronic wasting disease, fatal familial insomnia, bulbar palsy, motor neuron disease, Canavan disease, Huntington's disease, neuronal ceroid-lipofuscinosis, Alexander's disease, Tourette's syndrome, Menkes kinky hair syndrome, Cockayne syndrome, Halervorden- Spatz syndrome, lafora disease, Rett syndrome, hepatolenticular degeneration, Lesch-Nyhan syndrome, and Unverricht-Lundborg syndrome, Pick's disease, and spinocerebellar ataxia.
83. The method of claim 82, wherein the neurological disease or disorder is selected from Alzheimer's disease, stroke, traumatic brain injury and glaucoma.
84. A method of reducing amyloid-β (Αβ) protein in a subject comprising
administering to the patient an effective amount of the antibody of any one of claims 1 to 70.
85. The method of claim 84, wherein the subject is suffering from, or at risk of contracting, a neurological disease or disorder.
86. The method of claim 85, wherein the neurological disease or disorder is selected from Alzheimer's disease, stroke, traumatic brain injury and glaucoma.
87. The method of any one of claims 79 to 86, wherein the dose amount and/or frequency of administration is modulated to reduce the concentration of antibody to which the red blood cells are exposed.
88. The method of claim 87, further comprising monitoring the subject for depletion of red blood cells.
89. The method of any one of claims 79 to 88, wherein the dose is Tf -sarurating.
90. The method of any one of claims 79 to 89, wherein administration of the antibody is at a dose and/or dose frequency calibrated to minimize acute clinical symptoms of the antibody administration.
91. A method of diagnosing a neurological disease or disorder in a subject comprising contacting a biological sample isolated from the subject with an antibody of any one of claims 1 to 70 under conditions suitable for binding of the antibody to a BACE1 polypeptide, and detecting whether a complex is formed between the antibody and the BACE1 polypeptide.
92. A method of determining whether a subject is eligible for therapy with an anti- BACE1 antibody, comprising contacting a biological sample isolated from the subject with an antibody of any one of claims 1 to 70 under conditions suitable for binding of the antibody to a BACE1 polypeptide, and detecting whether a complex is formed between the antibody and the BACE1 polypeptide, wherein the presence of a complex between the antibody and BACE1 is indicative of a subject eligible for therapy with an anti-BACEl antibody.
93. The method of claims 91 or 92, wherein the biological sample is selected from serum, plasma, saliva, gastric secretions, mucus, cerebrospinal fluid, lymphatic fluid, neuronal tissue, brain tissue, cardiac tissue or vascular tissue.
94. The antibody of any of claims 1 to 70 for use as a medicament.
95. The antibody of any one of claims 1 to 70 for use in treating a neurological disorder.
96. The antibody of claim 95 for use in treating a neurological disorder selected from Alzheimer's disease (AD), traumatic brain injury, stroke, glaucoma, dementia, muscular dystrophy (MD), multiple sclerosis (MS), amyotrophic lateral sclerosis (ALS), cystic fibrosis, Angelman's syndrome, Liddle syndrome, Paget's disease, traumatic brain injury, Lewy body disease, postpoliomyelitis syndrome, Shy-Draeger syndrome, olivopontocerebellar atrophy, Parkinson's disease, multiple system atrophy, striatonigral degeneration, supranuclear palsy, bovine spongiform encephalopathy, scrapie, Creutzfeldt- Jakob syndrome, kuru, Gerstmann-Straussler-Scheinker disease, chronic wasting disease, fatal familial insomnia, bulbar palsy, motor neuron disease, Canavan disease, Huntington's disease, neuronal ceroid-lipofuscinosis, Alexander's disease, Tourette's syndrome, Menkes kinky hair syndrome, Cockayne syndrome, Halervorden-Spatz syndrome, lafora disease, Rett syndrome, hepatolenticular degeneration, Lesch-Nyhan syndrome, and Unverricht-Lundborg syndrome, Pick's disease, and spinocerebellar ataxia.
97. The antibody of any one of claims 1 to 70 for use in decreasing and/or inhibiting amyloid-β (Αβ) protein production.
98. Use of the antibody of any one of claims 1 to 70 in the manufacture of a medicament.
99. The use of claim 98, wherein the medicament is for the treatment of a neurological disorder selected from the group consisting of Alzheimer's disease (AD), traumatic brain injury, stroke, glaucoma, dementia, muscular dystrophy (MD), multiple sclerosis (MS), amyotrophic lateral sclerosis (ALS), cystic fibrosis, Angelman's syndrome, Liddle syndrome, Paget's disease, traumatic brain injury, Lewy body disease, postpoliomyelitis syndrome, Shy-Draeger syndrome, olivopontocerebellar atrophy, Parkinson's disease, multiple system atrophy, striatonigral degeneration, supranuclear palsy, bovine spongiform encephalopathy, scrapie, Creutzfeldt- Jakob syndrome, kuru, Gerstmann-Straussler-Scheinker disease, chronic wasting disease, fatal familial insomnia, bulbar palsy, motor neuron disease, Canavan disease, Huntington's disease, neuronal ceroid-lipofuscinosis, Alexander's disease, Tourette's syndrome, Menkes kinky hair syndrome, Cockayne syndrome, Halervorden-Spatz syndrome, lafora disease, Rett syndrome, hepatolenticular degeneration, Lesch-Nyhan syndrome, and Unverricht-Lundborg syndrome, Pick's disease, and spinocerebellar ataxia.
100. The use of claim 98, wherein the medicament is for reducing and/or inhibiting amyloid-β (Αβ) protein production.
PCT/US2015/061402 2014-11-19 2015-11-18 Anti-transferrin receptor / anti-bace1 multispecific antibodies and methods of use Ceased WO2016081640A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
EP15804651.6A EP3221361B1 (en) 2014-11-19 2015-11-18 Anti-transferrin receptor / anti-bace1 multispecific antibodies and methods of use
US15/525,821 US11008403B2 (en) 2014-11-19 2015-11-18 Anti-transferrin receptor / anti-BACE1 multispecific antibodies and methods of use
CN201580061990.2A CN107250158B (en) 2014-11-19 2015-11-18 Anti-transferrin receptor/anti-BACE1 multispecific antibodies and methods of use
JP2017526560A JP6993228B2 (en) 2014-11-19 2015-11-18 Anti-transferrin receptor / anti-BACE1 multispecific antibody and usage
HK18104566.6A HK1245289B (en) 2014-11-19 2015-11-18 Anti-transferrin receptor / anti-bace1 multispecific antibodies and methods of use

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462081965P 2014-11-19 2014-11-19
US62/081,965 2014-11-19

Publications (1)

Publication Number Publication Date
WO2016081640A1 true WO2016081640A1 (en) 2016-05-26

Family

ID=54780464

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/061402 Ceased WO2016081640A1 (en) 2014-11-19 2015-11-18 Anti-transferrin receptor / anti-bace1 multispecific antibodies and methods of use

Country Status (5)

Country Link
US (1) US11008403B2 (en)
EP (1) EP3221361B1 (en)
JP (1) JP6993228B2 (en)
CN (1) CN107250158B (en)
WO (1) WO2016081640A1 (en)

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018152375A3 (en) * 2017-02-17 2018-09-27 Denali Therapeutics Inc. Engineered polypeptides
WO2019094576A1 (en) * 2017-11-08 2019-05-16 Denali Therapeutics Inc. Bace-tau bispecific antibodies
WO2019157224A1 (en) 2018-02-07 2019-08-15 Regeneron Pharmaceuticals, Inc. Methods and compositions for therapeutic protein delivery
KR20190097067A (en) 2016-12-26 2019-08-20 쿄와 기린 가부시키가이샤 Antibodies That Bind to Myelin Oligodendrosite Glycoproteins
US10457717B2 (en) 2017-02-17 2019-10-29 Denali Therapeutics Inc. Engineered polypeptides
WO2020004490A1 (en) 2018-06-26 2020-01-02 協和キリン株式会社 Antibody binding to chondroitin sulfate proteoglycan-5
WO2020004492A1 (en) 2018-06-26 2020-01-02 協和キリン株式会社 Antibody binding to cell adhesion molecule 3
US10537633B2 (en) 2016-03-04 2020-01-21 Jn Biosciences Llc Antibodies to TIGIT
JP2020530465A (en) * 2017-08-10 2020-10-22 デナリ セラピューティクス インコーポレイテッドDenali Therapeutics Inc. Affinity-based method for using transferrin receptor-binding proteins
US10870837B2 (en) 2017-10-02 2020-12-22 Denali Therapeutics Inc. Fusion proteins comprising enzyme replacement therapy enzymes
US10882920B2 (en) 2014-11-19 2021-01-05 Genentech, Inc. Antibodies against BACE1 and use thereof for neural disease immunotherapy
WO2021076931A1 (en) * 2019-10-18 2021-04-22 Centivax, Inc. Antibodies and uses thereof
US11612150B2 (en) 2017-02-17 2023-03-28 Denali Therapeutics Inc. Transferrin receptor transgenic models
US11643446B2 (en) 2019-12-23 2023-05-09 Denali Therapeutics Inc. Progranulin variants
US11773185B2 (en) 2017-11-08 2023-10-03 Denali Therapeutics Inc. Anti-BACE1 antibodies and methods of use thereof
US11795232B2 (en) 2017-02-17 2023-10-24 Denali Therapeutics Inc. Engineered transferrin receptor binding polypeptides
US11820824B2 (en) 2020-06-02 2023-11-21 Arcus Biosciences, Inc. Antibodies to TIGIT
US11884944B2 (en) 2020-10-14 2024-01-30 Denali Therapeutics Inc. Fusion proteins comprising sulfoglucosamine sulfohydrolase enzymes and methods thereof
WO2024026494A1 (en) 2022-07-29 2024-02-01 Regeneron Pharmaceuticals, Inc. Viral particles retargeted to transferrin receptor 1
WO2024026488A2 (en) 2022-07-29 2024-02-01 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a modified transferrin receptor locus
US11958891B2 (en) 2017-01-26 2024-04-16 Surrozen Operating, Inc. Tissue-specific Wnt signal enhancing molecules and uses thereof
US11993645B2 (en) 2017-01-11 2024-05-28 The Board Of Trustees Of The Leland Stanford Junior University Compositions comprising R-Spondin (RSPO) surrogate molecules
US12240876B2 (en) 2020-11-16 2025-03-04 Surrozen Operating, Inc. Liver-specific Wnt signal enhancing molecules and uses thereof
WO2025090898A1 (en) * 2023-10-26 2025-05-01 Biogen Ma Inc. Anti-transferrin receptor antibodies and uses thereof cross reference to related applications
US12466884B2 (en) 2018-07-09 2025-11-11 Surrozen Operating, Inc. Tissue-specific WNT signal enhancing molecules and uses
US12527877B2 (en) 2024-01-24 2026-01-20 Arrowhead Pharmaceuticals, Inc. Anti-transferrin receptor antibodies, conjugates thereof, and uses thereof
WO2025265013A3 (en) * 2024-06-20 2026-02-19 Arrowhead Pharmaceuticals, Inc. Rnai agents for inhibiting expression of huntingtin (htt), compositions thereof, and methods of use
WO2026076250A1 (en) 2024-10-03 2026-04-09 Genentech, Inc. Lipid nanoparticles for delivery to the cns from systemic administration

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020105621A1 (en) * 2018-11-20 2020-05-28 株式会社ペルセウスプロテオミクス Inhibitor of cellular iron uptake
WO2020138487A1 (en) * 2018-12-28 2020-07-02 協和キリン株式会社 BISPECIFIC ANTIBODY BINDING TO TfR
EP4026560A4 (en) * 2019-09-04 2023-10-25 Perseus Proteomics Inc. Therapeutic agent for polycythemia
EP4085251B1 (en) * 2020-01-02 2024-07-31 F. Hoffmann-La Roche AG Method for determining the amount of a therapeutic antibody in the brain
CN121754667A (en) * 2020-04-08 2026-03-31 阿里亚达治疗公司 Compositions and methods for blood brain barrier delivery
CN112409487B (en) * 2020-11-27 2022-04-29 宁波赛珀生物技术有限公司 Anti-soluble transferrin receptor antibodies and uses thereof
WO2023122647A2 (en) * 2021-12-22 2023-06-29 The University Of Chicago Methods for detecting or treating influenza infections
CN114437207B (en) * 2022-01-10 2023-07-21 中国人民解放军空军军医大学 Humanized anti-Hantaan virus (HTNV) Fab antibody with neutralizing activity and its application
WO2023196954A2 (en) * 2022-04-08 2023-10-12 The Wistar Institute Of Anatomy And Biology Bispecific binding molecules that target fshr and cd3
CN118374458B (en) * 2024-05-27 2025-11-21 上海市杨浦区中心医院(同济大学附属杨浦医院) Mouse anti-human CTRB1 monoclonal paired antibody and hybridoma cell strain secreting same

Citations (134)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
WO1995002421A1 (en) 1993-07-16 1995-01-26 Alkermes, Inc. Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
EP0425235B1 (en) 1989-10-25 1996-09-25 Immunogen Inc Cytotoxic agents comprising maytansinoids and their therapeutic use
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5573905A (en) 1992-03-30 1996-11-12 The Scripps Research Institute Encoded combinatorial chemical libraries
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
US5589369A (en) 1992-02-11 1996-12-31 Cell Genesys Inc. Cells homozygous for disrupted target loci
US5591669A (en) 1988-12-05 1997-01-07 Genpharm International, Inc. Transgenic mice depleted in a mature lymphocytic cell-type
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US5693780A (en) 1991-07-25 1997-12-02 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
US5739116A (en) 1994-06-03 1998-04-14 American Cyanamid Company Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
WO2000061739A1 (en) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Method for controlling the activity of immunologically functional molecule
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
WO2001029246A1 (en) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
WO2001062801A2 (en) 2000-02-24 2001-08-30 Washington University Humanized antibodies that sequester amyloid beta peptide
WO2002003911A2 (en) 2000-07-07 2002-01-17 Lars Lannfelt Prevention and treatment of alzheimer's disease
US20020025313A1 (en) 1992-07-27 2002-02-28 Micklus Michael J. Targeting of liposomes to the blood-brain barrier
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
WO2002046237A2 (en) 2000-12-06 2002-06-13 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
WO2003016467A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company Use of antibodies having high affinity for soluble ass to treat conditions and diseases related to ass
WO2003016466A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company ANTI-Aβ ANTIBODIES
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
WO2003077858A2 (en) 2002-03-12 2003-09-25 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
US20030190311A1 (en) 2000-12-12 2003-10-09 Dall'acqua William Molecules with extended half-lives, compositions and uses thereof
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
WO2004029629A1 (en) 2002-09-27 2004-04-08 Janssen Pharmaceutica N.V. N-11 truncated amyloid-beta nomoclonal antibodies, compositions, methods and uses
WO2004032868A2 (en) 2002-10-09 2004-04-22 Rinat Neuroscience Corp. Methods of treating alzheimer's disease using antibodies directed against amyloid beta peptide and compositions thereof
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
WO2004108895A2 (en) 2003-05-30 2004-12-16 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
WO2005028511A2 (en) 2003-03-28 2005-03-31 Centocor, Inc. Anti-amyloid antibodies, compositions, methods and uses
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
WO2005035586A1 (en) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. Fused protein composition
WO2005035778A1 (en) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. PROCESS FOR PRODUCING ANTIBODY COMPOSITION BY USING RNA INHIBITING THE FUNCTION OF α1,6-FUCOSYLTRANSFERASE
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
WO2005053742A1 (en) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. Medicine containing antibody composition
US20050142141A1 (en) 2002-11-27 2005-06-30 Pardridge William M. Delivery of enzymes to the brain
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
WO2006036291A2 (en) 2004-07-30 2006-04-06 Rinat Neuroscience Corp. Antibodies directed against amyloid-beta peptide and methods using same
WO2006039470A2 (en) 2004-09-29 2006-04-13 Centocor, Inc. Anti- amyloid antibodies, compositions, methods and uses
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
WO2006066089A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized amyloid beta antibodies for use in improving cognition
WO2006066171A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Amyloid βετα antibodies for use in improving cognition
WO2006066049A2 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
WO2006095041A1 (en) 2005-03-09 2006-09-14 Consejo Superior De Investigaciones Científicas Method for the in vitro diagnosis of alzheimer's disease using a monoclonal antibody
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070196363A1 (en) 1997-05-02 2007-08-23 Genentech, Inc. Method for Making Multispecific Antibodies Having Heteromultimeric and Common Components
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2009027105A2 (en) 2007-08-31 2009-03-05 Neurimmune Therapeutics Ag Method of providing patient specific immune response in amyloidoses and protein aggregation disorders
WO2009036379A2 (en) 2007-09-14 2009-03-19 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US20090182127A1 (en) 2006-06-22 2009-07-16 Novo Nordisk A/S Production of Bispecific Antibodies
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2010105256A1 (en) 2009-03-13 2010-09-16 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
US20110287009A1 (en) 2010-04-23 2011-11-24 Genentech, Inc. Production of Heteromultimeric Proteins
WO2012009568A2 (en) 2010-07-16 2012-01-19 Adimab, Llc Antibody libraries
WO2012075037A1 (en) * 2010-11-30 2012-06-07 Genentech, Inc. Low affinity blood brain barrier receptor antibodies and uses therefor
US20120251531A1 (en) 2011-03-29 2012-10-04 Genentech, Inc. ANTIBODY Fc VARIANTS
WO2013177062A2 (en) 2012-05-21 2013-11-28 Genentech, Inc. Methods for improving safety of blood-brain barrier transport
WO2014189973A2 (en) * 2013-05-20 2014-11-27 Genentech, Inc. Anti-transferrin receptor antibodies and methods of use

Family Cites Families (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPS633262A (en) 1986-06-24 1988-01-08 Toshiba Corp Method and instrument for analyzing reticulocyte
HUT69771A (en) 1990-08-17 1995-09-28 Univ Boston Proteases causing abnormal degradation of amyloid beta-proteine precursors
US5200339A (en) 1990-08-17 1993-04-06 Abraham Carmela R Proteases causing abnormal degradation of amyloid β-protein precursor
JPH07509444A (en) 1991-11-26 1995-10-19 アルカーメス・インコーポレーテツド Method for producing transferrin receptor-specific antibody-nerve drug or diagnostic drug complex
US6015555A (en) 1995-05-19 2000-01-18 Alkermes, Inc. Transferrin receptor specific antibody-neuropharmaceutical or diagnostic agent conjugates
US5744346A (en) 1995-06-07 1998-04-28 Athena Neurosciences, Inc. β-secretase
US6221645B1 (en) 1995-06-07 2001-04-24 Elan Pharmaceuticals, Inc. β-secretase antibody
JPH11507538A (en) 1995-06-07 1999-07-06 アテナ ニューロサイエンシズ インコーポレイティド β-secretase, antibodies to β-secretase, and assays for detecting β-secretase inhibition
US6329163B1 (en) 1995-06-07 2001-12-11 Elan Pharmaceuticals, Inc. Assays for detecting β-secretase inhibition
AU1684097A (en) 1996-12-11 1998-07-03 Athena Neurosciences, Inc. Beta-secretase isolated from human 293 cells
GB9701684D0 (en) 1997-01-28 1997-03-19 Smithkline Beecham Plc Novel compounds
US6699671B1 (en) 1998-09-24 2004-03-02 Pharmacia & Upjohn Company Alzheimer's disease secretase, APP substrates therefor, and uses therefor
US7456007B1 (en) 1998-12-31 2008-11-25 Elan Pharmaceuticals, Inc. β-secretase enzyme compositions and methods
US7115410B1 (en) 1999-02-10 2006-10-03 Elan Pharmaceuticals, Inc. β-secretase enzyme compositions and methods
GB2364059B (en) 1999-02-10 2004-01-14 Elan Pharm Inc Beta-Secretase enzyme compositions and methods
WO2000058479A1 (en) 1999-03-26 2000-10-05 Amgen Inc. Beta secretase genes and polypeptides
CA2374610A1 (en) 1999-06-28 2001-01-04 Jordan J. N. Tang Catalytically active recombinant memapsin and methods of use thereof
GB9924957D0 (en) 1999-10-21 1999-12-22 Smithkline Beecham Plc Novel treatment
US7514408B1 (en) 1999-12-02 2009-04-07 Elan Pharmaceuticals, Inc. β-secretase enzyme compositions and methods
CA2410898A1 (en) 2000-07-19 2002-01-24 Pharmacia & Upjohn Company Substrates and assays for .beta.-secretase activity
WO2002025276A1 (en) 2000-09-22 2002-03-28 Wyeth Crystal structure of bace and uses thereof
US20020157122A1 (en) 2000-10-27 2002-10-24 Wong Philip C. Beta-secretase transgenic organisms, anti-beta-secretase antibodies, and methods of use thereof
US7217556B1 (en) 2000-12-23 2007-05-15 Pfizer Inc Crystallization and structure determination of glycosylated human beta secretase, an enzyme implicated in Alzheimer's disease
US7601528B1 (en) 2000-12-23 2009-10-13 Elan Pharmaceuticals, Inc. Crystallization and structure determination of glycosylated human beta secretase, an enzyme implicated in alzheimer's disease
WO2002053594A2 (en) 2000-12-28 2002-07-11 Oklahoma Medical Research Foundation Inhibitors of memapsin 2 and use thereof
US7384773B1 (en) 2001-05-10 2008-06-10 Pfizer Inc Crystal of HIV protease-cleaved human beta secretase and method for crystallization thereof
CA2448142A1 (en) 2001-05-22 2002-11-28 Merck & Co., Inc. Beta-secretase substrates and uses thereof
JP4547152B2 (en) 2001-10-23 2010-09-22 オクラホマ メディカル リサーチ ファウンデーション β-secretase inhibitors and methods of use
US20030224512A1 (en) 2002-05-31 2003-12-04 Isis Pharmaceuticals Inc. Antisense modulation of beta-site APP-cleaving enzyme expression
US7166454B1 (en) 2002-05-24 2007-01-23 Schering Corporation Codon-optimized β-secretase and methods of refolding and processing
EP2305710A3 (en) 2002-06-03 2013-05-29 Genentech, Inc. Synthetic antibody phage libraries
US7314726B2 (en) 2002-10-15 2008-01-01 Bristol-Myers Squibb Company Beta secretase exosite binding peptides and methods for identifying beta secretase modulators
JP4739192B2 (en) 2003-05-02 2011-08-03 イーラン ファーマスーティカルズ、インコーポレイテッド Glycosylation variants of BACE
JP4794301B2 (en) 2003-06-11 2011-10-19 中外製薬株式会社 Antibody production method
SG128680A1 (en) 2003-07-22 2007-01-30 Crucell Holland Bv Binding molecules against sars-coronavirus and uses thereof
US20050106667A1 (en) 2003-08-01 2005-05-19 Genentech, Inc Binding polypeptides with restricted diversity sequences
US7758859B2 (en) 2003-08-01 2010-07-20 Genentech, Inc. Anti-VEGF antibodies
US20070185042A1 (en) 2003-08-08 2007-08-09 The Brigham And Women's Hospital, Inc. President And Fellows Of Harvard College Sirna based methods for treating alzheimer's disease
US20070149763A1 (en) 2003-10-15 2007-06-28 Bristol-Myers Squibb Company Beta secretase exosite binding peptides and methods for identifying beta secretase modulators
WO2005045021A1 (en) 2003-11-06 2005-05-19 Exonhit Therapeutics Sa Bace455, an alternative splice variant of the human beta-secretase
WO2005049802A2 (en) 2003-11-14 2005-06-02 Massachusetts Institute Of Technology Anti-hydroxylase antibodies and uses thereof
PT1740616E (en) 2004-04-30 2012-03-23 Inst Nat Sante Rech Med Anti-tfr antibody.
US20080220445A1 (en) 2004-10-01 2008-09-11 Takeda Pharmaceutical Company Limited Method of Screening Transmembrane Enzyme Inhibitory Substance
US20060147451A1 (en) 2004-10-04 2006-07-06 Genentech, Inc. Modulators of hepatocyte growth factor activator
US8802820B2 (en) 2004-11-12 2014-08-12 Xencor, Inc. Fc variants with altered binding to FcRn
CA2618508A1 (en) 2005-08-10 2007-02-22 Oklahoma Medical Research Foundation Truncated memapsin 2 for use for treating alzheimer's disease
US8053569B2 (en) 2005-10-07 2011-11-08 Armagen Technologies, Inc. Nucleic acids encoding and methods of producing fusion proteins
UA96139C2 (en) 2005-11-08 2011-10-10 Дженентек, Інк. Anti-neuropilin-1 (nrp1) antibody
BRPI0706840A2 (en) 2006-01-05 2011-04-05 Genentech Inc polynucleotide isolated anti-ephb4 antibodies, vector, host cell, method for producing an anti ephb4 antibody, method for producing an anti ephb4 immunoconjugate, method for detecting ephb4, method for diagnosing a composition disorder, method for inhibiting angiogenesis, method for treating a cancer, tumor and / or cell proliferation disorder and use of an antibody
SI1976884T1 (en) 2006-01-20 2013-04-30 Genetech, Inc. Anti-ephrinb2 antibodies and methods using same
EP2032606B1 (en) 2006-05-30 2013-11-27 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
BRPI0717638A2 (en) 2006-10-27 2013-11-12 Genentech Inc ANTICORPORS AND IMMUNOCUSED AND USES FOR THEM
US20100047232A1 (en) 2006-11-14 2010-02-25 Jasvinder Atwal Modulators of neuronal regeneration
MX2009008430A (en) 2007-02-09 2009-10-28 Genentech Inc Anti-robo4 antibodies and uses therefor.
WO2008129023A2 (en) 2007-04-19 2008-10-30 Vib Vzw Oligonucleotide compositions for the treatment of alzheimer's disease
ES2447844T3 (en) 2008-04-03 2014-03-13 Vib Vzw Individual domain antibodies capable of modulating BACE1 activity
WO2009155609A1 (en) 2008-06-20 2009-12-23 Oklahoma Medical Research Foundation IMMUNOGENIC MEMAPSIN 2 β-SECRETASE PEPTIDES AND METHODS OF USE
TW201019959A (en) 2008-08-19 2010-06-01 Regeneron Pharma Human antibodies to human RANKL
US8790642B2 (en) 2008-08-29 2014-07-29 Genentech, Inc. Cross-reactive and bispecific anti-IL-17A/F antibodies
US20100233156A1 (en) 2009-03-09 2010-09-16 Georgetown University Treating Central Nervous System Injury with Beta and Gamma Secretase Inhibitors
WO2010146058A1 (en) 2009-06-15 2010-12-23 Vib Vzw Bace1 inhibitory antibodies
US20140286966A1 (en) * 2010-07-06 2014-09-25 Youngman Oh Methods and compositions for the treatment of metabolic syndrome, obstructive respiratory disorders, cancer and related diseases
WO2012064836A1 (en) 2010-11-10 2012-05-18 Genentech, Inc. Methods and compositions for neural disease immunotherapy
US20140256820A1 (en) * 2010-12-13 2014-09-11 Fukuoka University Therapeutic agent for blood-brain barrier disruption syndrome
EP2686345B1 (en) 2011-03-16 2018-04-25 Amgen Inc. Fc variants
RU2013150331A (en) 2011-04-20 2015-05-27 Рош Гликарт Аг METHOD AND DEVICES FOR A pH-DEPENDENT PASSAGE OF A HEMATOENCEPHALIC BARRIER
JP6134725B2 (en) 2011-10-14 2017-05-24 ジェネンテック, インコーポレイテッド BACE1 peptide inhibitors
JP6594855B2 (en) 2013-03-15 2019-10-23 ゼンコア インコーポレイテッド Heterodimeric protein
CN103897033A (en) * 2014-03-31 2014-07-02 中国药科大学 TfR (transferrin receptor) specific binding peptide and application thereof
US10508151B2 (en) 2014-11-19 2019-12-17 Genentech, Inc. Anti-transferrin receptor antibodies and methods of use
JP6859259B2 (en) 2014-11-19 2021-04-14 ジェネンテック, インコーポレイテッド Antibodies to BACEl and its use for neurological disease immunotherapy

Patent Citations (146)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4737456A (en) 1985-05-09 1988-04-12 Syntex (U.S.A.) Inc. Reducing interference in ligand-receptor binding assays
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US6982321B2 (en) 1986-03-27 2006-01-03 Medical Research Council Altered antibodies
US5567610A (en) 1986-09-04 1996-10-22 Bioinvent International Ab Method of producing human monoclonal antibodies and kit therefor
US5500362A (en) 1987-01-08 1996-03-19 Xoma Corporation Chimeric antibody with specificity to human B cell surface antigen
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
US5624821A (en) 1987-03-18 1997-04-29 Scotgen Biopharmaceuticals Incorporated Antibodies with altered effector functions
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
US5770701A (en) 1987-10-30 1998-06-23 American Cyanamid Company Process for preparing targeted forms of methyltrithio antitumor agents
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US6248516B1 (en) 1988-11-11 2001-06-19 Medical Research Council Single domain ligands, receptors comprising said ligands methods for their production, and use of said ligands and receptors
US5591669A (en) 1988-12-05 1997-01-07 Genpharm International, Inc. Transgenic mice depleted in a mature lymphocytic cell-type
EP0404097A2 (en) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispecific and oligospecific, mono- and oligovalent receptors, production and applications thereof
US5416064A (en) 1989-10-25 1995-05-16 Immunogen, Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
EP0425235B1 (en) 1989-10-25 1996-09-25 Immunogen Inc Cytotoxic agents comprising maytansinoids and their therapeutic use
US5959177A (en) 1989-10-27 1999-09-28 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6417429B1 (en) 1989-10-27 2002-07-09 The Scripps Research Institute Transgenic plants expressing assembled secretory antibodies
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6150584A (en) 1990-01-12 2000-11-21 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5229275A (en) 1990-04-26 1993-07-20 Akzo N.V. In-vitro method for producing antigen-specific human monoclonal antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5750373A (en) 1990-12-03 1998-05-12 Genentech, Inc. Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants
US5571894A (en) 1991-02-05 1996-11-05 Ciba-Geigy Corporation Recombinant antibodies specific for a growth factor receptor
US5821337A (en) 1991-06-14 1998-10-13 Genentech, Inc. Immunoglobulin variants
WO1993001161A1 (en) 1991-07-11 1993-01-21 Pfizer Limited Process for preparing sertraline intermediates
US5693780A (en) 1991-07-25 1997-12-02 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5648237A (en) 1991-09-19 1997-07-15 Genentech, Inc. Expression of functional antibody fragments
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5587458A (en) 1991-10-07 1996-12-24 Aronex Pharmaceuticals, Inc. Anti-erbB-2 antibodies, combinations thereof, and therapeutic and diagnostic uses thereof
WO1993008829A1 (en) 1991-11-04 1993-05-13 The Regents Of The University Of California Compositions that mediate killing of hiv-infected cells
WO1993016185A2 (en) 1992-02-06 1993-08-19 Creative Biomolecules, Inc. Biosynthetic binding protein for cancer marker
US5589369A (en) 1992-02-11 1996-12-31 Cell Genesys Inc. Cells homozygous for disrupted target loci
US5573905A (en) 1992-03-30 1996-11-12 The Scripps Research Institute Encoded combinatorial chemical libraries
US20020025313A1 (en) 1992-07-27 2002-02-28 Micklus Michael J. Targeting of liposomes to the blood-brain barrier
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5635483A (en) 1992-12-03 1997-06-03 Arizona Board Of Regents Acting On Behalf Of Arizona State University Tumor inhibiting tetrapeptide bearing modified phenethyl amides
US5780588A (en) 1993-01-26 1998-07-14 Arizona Board Of Regents Elucidation and synthesis of selected pentapeptides
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
WO1995002421A1 (en) 1993-07-16 1995-01-26 Alkermes, Inc. Transferrin receptor specific ligand-neuropharmaceutical agent fusion proteins
US5767285A (en) 1994-06-03 1998-06-16 American Cyanamid Company Linkers useful for the synthesis of conjugates of methyltrithio antitumor agents
US5877296A (en) 1994-06-03 1999-03-02 American Cyanamid Company Process for preparing conjugates of methyltrithio antitumor agents
US5773001A (en) 1994-06-03 1998-06-30 American Cyanamid Company Conjugates of methyltrithio antitumor agents and intermediates for their synthesis
US5739116A (en) 1994-06-03 1998-04-14 American Cyanamid Company Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents
US5789199A (en) 1994-11-03 1998-08-04 Genentech, Inc. Process for bacterial production of polypeptides
US5840523A (en) 1995-03-01 1998-11-24 Genetech, Inc. Methods and compositions for secretion of heterologous polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
WO1996027011A1 (en) 1995-03-01 1996-09-06 Genentech, Inc. A method for making heteromultimeric polypeptides
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US5712374A (en) 1995-06-07 1998-01-27 American Cyanamid Company Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates
US5714586A (en) 1995-06-07 1998-02-03 American Cyanamid Company Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates
US6267958B1 (en) 1995-07-27 2001-07-31 Genentech, Inc. Protein formulation
WO1997030087A1 (en) 1996-02-16 1997-08-21 Glaxo Group Limited Preparation of glycosylated antibodies
US20070196363A1 (en) 1997-05-02 2007-08-23 Genentech, Inc. Method for Making Multispecific Antibodies Having Heteromultimeric and Common Components
WO1998050431A2 (en) 1997-05-02 1998-11-12 Genentech, Inc. A method for making multispecific antibodies having heteromultimeric and common components
US20070178552A1 (en) 1997-05-02 2007-08-02 Genentech, Inc. Method for Making Multispecific Antibodies Having Heteromultimeric and Common Components
US6171586B1 (en) 1997-06-13 2001-01-09 Genentech, Inc. Antibody formulation
WO1998058964A1 (en) 1997-06-24 1998-12-30 Genentech, Inc. Methods and compositions for galactosylated glycoproteins
WO1999022764A1 (en) 1997-10-31 1999-05-14 Genentech, Inc. Methods and compositions comprising glycoprotein glycoforms
US7189826B2 (en) 1997-11-24 2007-03-13 Institute For Human Genetics And Biochemistry Monoclonal human natural antibodies
US7087409B2 (en) 1997-12-05 2006-08-08 The Scripps Research Institute Humanization of murine antibody
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6602684B1 (en) 1998-04-20 2003-08-05 Glycart Biotechnology Ag Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity
US6040498A (en) 1998-08-11 2000-03-21 North Caroline State University Genetically engineered duckweed
US7371826B2 (en) 1999-01-15 2008-05-13 Genentech, Inc. Polypeptide variants with altered effector function
US7332581B2 (en) 1999-01-15 2008-02-19 Genentech, Inc. Polypeptide variants with altered effector function
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2000061739A1 (en) 1999-04-09 2000-10-19 Kyowa Hakko Kogyo Co., Ltd. Method for controlling the activity of immunologically functional molecule
US6420548B1 (en) 1999-10-04 2002-07-16 Medicago Inc. Method for regulating transcription of foreign genes
US7125978B1 (en) 1999-10-04 2006-10-24 Medicago Inc. Promoter for regulating expression of foreign genes
WO2001029246A1 (en) 1999-10-19 2001-04-26 Kyowa Hakko Kogyo Co., Ltd. Process for producing polypeptide
US20070117126A1 (en) 1999-12-15 2007-05-24 Genentech, Inc. Shotgun scanning
US6630579B2 (en) 1999-12-29 2003-10-07 Immunogen Inc. Cytotoxic agents comprising modified doxorubicins and daunorubicins and their therapeutic use
WO2001062801A2 (en) 2000-02-24 2001-08-30 Washington University Humanized antibodies that sequester amyloid beta peptide
US20060025576A1 (en) 2000-04-11 2006-02-02 Genentech, Inc. Multivalent antibodies and uses therefor
WO2002003911A2 (en) 2000-07-07 2002-01-17 Lars Lannfelt Prevention and treatment of alzheimer's disease
WO2002031140A1 (en) 2000-10-06 2002-04-18 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions
US20030115614A1 (en) 2000-10-06 2003-06-19 Yutaka Kanda Antibody composition-producing cell
US20020164328A1 (en) 2000-10-06 2002-11-07 Toyohide Shinkawa Process for purifying antibody
US20070061900A1 (en) 2000-10-31 2007-03-15 Murphy Andrew J Methods of modifying eukaryotic cells
US7041870B2 (en) 2000-11-30 2006-05-09 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
WO2002046237A2 (en) 2000-12-06 2002-06-13 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US20030190311A1 (en) 2000-12-12 2003-10-09 Dall'acqua William Molecules with extended half-lives, compositions and uses thereof
WO2003011878A2 (en) 2001-08-03 2003-02-13 Glycart Biotechnology Ag Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
WO2003016467A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company Use of antibodies having high affinity for soluble ass to treat conditions and diseases related to ass
WO2003016466A2 (en) 2001-08-17 2003-02-27 Eli Lilly And Company ANTI-Aβ ANTIBODIES
US20030157108A1 (en) 2001-10-25 2003-08-21 Genentech, Inc. Glycoprotein compositions
US20040093621A1 (en) 2001-12-25 2004-05-13 Kyowa Hakko Kogyo Co., Ltd Antibody composition which specifically binds to CD20
WO2003077858A2 (en) 2002-03-12 2003-09-25 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
US20040132140A1 (en) 2002-04-09 2004-07-08 Kyowa Hakko Kogyo Co., Ltd. Production process for antibody composition
US20040110704A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells of which genome is modified
US20040109865A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Antibody composition-containing medicament
WO2003084570A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. DRUG CONTAINING ANTIBODY COMPOSITION APPROPRIATE FOR PATIENT SUFFERING FROM FcϜRIIIa POLYMORPHISM
US20040110282A1 (en) 2002-04-09 2004-06-10 Kyowa Hakko Kogyo Co., Ltd. Cells in which activity of the protein involved in transportation of GDP-fucose is reduced or lost
WO2003085119A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO FcϜ RECEPTOR IIIa
WO2003085107A1 (en) 2002-04-09 2003-10-16 Kyowa Hakko Kogyo Co., Ltd. Cells with modified genome
US20050119455A1 (en) 2002-06-03 2005-06-02 Genentech, Inc. Synthetic antibody phage libraries
WO2004029629A1 (en) 2002-09-27 2004-04-08 Janssen Pharmaceutica N.V. N-11 truncated amyloid-beta nomoclonal antibodies, compositions, methods and uses
WO2004032868A2 (en) 2002-10-09 2004-04-22 Rinat Neuroscience Corp. Methods of treating alzheimer's disease using antibodies directed against amyloid beta peptide and compositions thereof
US20050014934A1 (en) 2002-10-15 2005-01-20 Hinton Paul R. Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis
US20050142141A1 (en) 2002-11-27 2005-06-30 Pardridge William M. Delivery of enzymes to the brain
WO2004056312A2 (en) 2002-12-16 2004-07-08 Genentech, Inc. Immunoglobulin variants and uses thereof
US20050079574A1 (en) 2003-01-16 2005-04-14 Genentech, Inc. Synthetic antibody phage libraries
US20050260186A1 (en) 2003-03-05 2005-11-24 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases
US20060104968A1 (en) 2003-03-05 2006-05-18 Halozyme, Inc. Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases
WO2005028511A2 (en) 2003-03-28 2005-03-31 Centocor, Inc. Anti-amyloid antibodies, compositions, methods and uses
WO2004108895A2 (en) 2003-05-30 2004-12-16 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2005035586A1 (en) 2003-10-08 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. Fused protein composition
WO2005035778A1 (en) 2003-10-09 2005-04-21 Kyowa Hakko Kogyo Co., Ltd. PROCESS FOR PRODUCING ANTIBODY COMPOSITION BY USING RNA INHIBITING THE FUNCTION OF α1,6-FUCOSYLTRANSFERASE
US20050123546A1 (en) 2003-11-05 2005-06-09 Glycart Biotechnology Ag Antigen binding molecules with increased Fc receptor binding affinity and effector function
US7498298B2 (en) 2003-11-06 2009-03-03 Seattle Genetics, Inc. Monomethylvaline compounds capable of conjugation to ligands
WO2005053742A1 (en) 2003-12-04 2005-06-16 Kyowa Hakko Kogyo Co., Ltd. Medicine containing antibody composition
US7527791B2 (en) 2004-03-31 2009-05-05 Genentech, Inc. Humanized anti-TGF-beta antibodies
US20050266000A1 (en) 2004-04-09 2005-12-01 Genentech, Inc. Variable domain library and uses
WO2005100402A1 (en) 2004-04-13 2005-10-27 F.Hoffmann-La Roche Ag Anti-p-selectin antibodies
WO2006036291A2 (en) 2004-07-30 2006-04-06 Rinat Neuroscience Corp. Antibodies directed against amyloid-beta peptide and methods using same
WO2006029879A2 (en) 2004-09-17 2006-03-23 F.Hoffmann-La Roche Ag Anti-ox40l antibodies
US7521541B2 (en) 2004-09-23 2009-04-21 Genetech Inc. Cysteine engineered antibodies and conjugates
WO2006039470A2 (en) 2004-09-29 2006-04-13 Centocor, Inc. Anti- amyloid antibodies, compositions, methods and uses
WO2006044908A2 (en) 2004-10-20 2006-04-27 Genentech, Inc. Antibody formulation in histidine-acetate buffer
WO2006066049A2 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized antibodies that recognize beta amyloid peptide
WO2006066171A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Amyloid βετα antibodies for use in improving cognition
WO2006066089A1 (en) 2004-12-15 2006-06-22 Neuralab Limited Humanized amyloid beta antibodies for use in improving cognition
WO2006095041A1 (en) 2005-03-09 2006-09-14 Consejo Superior De Investigaciones Científicas Method for the in vitro diagnosis of alzheimer's disease using a monoclonal antibody
US20070160598A1 (en) 2005-11-07 2007-07-12 Dennis Mark S Binding polypeptides with diversified and consensus vh/vl hypervariable sequences
US20070237764A1 (en) 2005-12-02 2007-10-11 Genentech, Inc. Binding polypeptides with restricted diversity sequences
US20070292936A1 (en) 2006-05-09 2007-12-20 Genentech, Inc. Binding polypeptides with optimized scaffolds
US20090182127A1 (en) 2006-06-22 2009-07-16 Novo Nordisk A/S Production of Bispecific Antibodies
US20080069820A1 (en) 2006-08-30 2008-03-20 Genentech, Inc. Multispecific antibodies
WO2008077546A1 (en) 2006-12-22 2008-07-03 F. Hoffmann-La Roche Ag Antibodies against insulin-like growth factor i receptor and uses thereof
US20090002360A1 (en) 2007-05-25 2009-01-01 Innolux Display Corp. Liquid crystal display device and method for driving same
WO2009027105A2 (en) 2007-08-31 2009-03-05 Neurimmune Therapeutics Ag Method of providing patient specific immune response in amyloidoses and protein aggregation disorders
WO2009036379A2 (en) 2007-09-14 2009-03-19 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
WO2009089004A1 (en) 2008-01-07 2009-07-16 Amgen Inc. Method for making antibody fc-heterodimeric molecules using electrostatic steering effects
WO2010105256A1 (en) 2009-03-13 2010-09-16 Adimab, Inc. Rationally designed, synthetic antibody libraries and uses therefor
US20110287009A1 (en) 2010-04-23 2011-11-24 Genentech, Inc. Production of Heteromultimeric Proteins
WO2012009568A2 (en) 2010-07-16 2012-01-19 Adimab, Llc Antibody libraries
WO2012075037A1 (en) * 2010-11-30 2012-06-07 Genentech, Inc. Low affinity blood brain barrier receptor antibodies and uses therefor
US20120171120A1 (en) 2010-11-30 2012-07-05 Genentech, Inc. Low affinity blood brain barrier receptor antibodies and uses therefor
US20120251531A1 (en) 2011-03-29 2012-10-04 Genentech, Inc. ANTIBODY Fc VARIANTS
WO2013177062A2 (en) 2012-05-21 2013-11-28 Genentech, Inc. Methods for improving safety of blood-brain barrier transport
WO2014189973A2 (en) * 2013-05-20 2014-11-27 Genentech, Inc. Anti-transferrin receptor antibodies and methods of use

Non-Patent Citations (164)

* Cited by examiner, † Cited by third party
Title
"Remington's Pharmaceutical Sciences", 1980
ADOLFFSON ET AL., J. NEUROSCI., vol. 32, no. 28, 2012, pages 9677 - 9689
AGNEW, CHEM INTL. ED. ENGL., vol. 33, 1994, pages 183 - 186
ALMAGRO; FRANSSON, FRONT. BIOSCI., vol. 13, 2008, pages 1619 - 1633
ATWAL ET AL., SCI. TRANSL. MED., vol. 3, 2011, pages 84RA43
ATWAL JASVINDER K ET AL: "A therapeutic antibody targeting BACE1 inhibits amyloid-[beta] production in vivo", SCIENCE TRANSLATIONAL MEDICINE, AAAS - AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 3, no. 84, 25 May 2011 (2011-05-25), XP009155719, ISSN: 1946-6242 *
ATWELL, S.; RIDGWAY, J. B.; WELLS, J. A.; CARTER, P., J. MOL. BIOL., vol. 270, 1997, pages 26 - 35
BACA ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 10678 - 10684
BENNET ET AL., NATURE, vol. 403, 2000, pages 46 - 53
BENNETT; HORUK, METHODS IN ENZYMOLOGY, vol. 288, 1997, pages 134 - 148
BOERNER ET AL., J. IMMUNOL., vol. 147, 1991, pages 86
BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81
BRODEUR ET AL.: "Monoclonal Antibody Production Techniques and Applications", 1987, MARCEL DEKKER, INC., pages: 51 - 63
BRUGGEMANN, M. ET AL., J. EXP. MED., vol. 166, 1987, pages 1351 - 1361
BRUGGERMANN ET AL., YEAR IN IMMUNO., vol. 7, 1993, pages 33
CARTER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 4285
CARTER, P., IMMUNOL. METHODS, vol. 248, 2001, pages 7 - 15
CARTER, P., J. IMMUNOL. METHODS, vol. 248, 2001, pages 7 - 15
CHALELA JA; GOMES J, EXPERT REV. NEUROTHER. 2004, vol. 4, 2004, pages 267
CHAPARRO-RIGGERS ET AL., J. BIOL. CHEM., vol. 287, no. 14, pages 11090 - 11097
CHARI ET AL., CANCER RES., vol. 52, 1992, pages 127 - 131
CHARLTON: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 245 - 254
CHEN ET AL., J. MOL. BIOL., vol. 293, 1999, pages 865 - 881
CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOWDHURY, METHODS MOL. BIOL., vol. 207, 2008, pages 179 - 196
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLARKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
CLYNES ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 95, 1998, pages 652 - 656
COUCH ET AL., SCI. TRANS. MED., vol. 5, 2013, pages 183RA57
COUCH ET AL., SCI. TRANSL. MED., vol. 5, 2013, pages 183RA57
COUCH JESSICA A ET AL: "Addressing safety liabilities of TfR bispecific antibodies that cross the blood-brain barrier", SCIENCE TRANSLATIONAL MEDICINE, AAAS - AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 5, no. 183, 1 May 2013 (2013-05-01), pages - 64, XP008163922, ISSN: 1946-6242, DOI: 10.1126/SCITRANSLMED.3005338 *
COWEN ET AL., J. NEUROCHEM., vol. 89, 2004, pages 273 - 285
CRAGG, M.S. ET AL., BLOOD, vol. 101, 2003, pages 1045 - 1052
CRAGG, M.S.; M.J. GLENNIE, BLOOD, vol. 103, 2004, pages 2738 - 2743
CUNNINGHAM; WELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085
DALL'ACQUA ET AL., J. BIOL. CHEM., vol. 281, 2006, pages 23514 - 23524
DALL'ACQUA ET AL., METHODS, vol. 36, 2005, pages 43 - 60
D'ONOFRIO ET AL., CLIN. LAB. HAEMATOL., vol. 1, 1996, pages 29 - 34
DUBOWCHIK ET AL., BIOORG. & MED. CHEM. LETTERS, vol. 12, 2002, pages 1529 - 1532
DUNCAN; WINTER, NATURE, vol. 322, 1988, pages 738 - 40
FARES AL-EJEH ET AL., CLIN. CANCER RES., vol. 13, 2007, pages 5519S - 5527S
FELGENHAUER, KLIN. WSCHR., vol. 52, 1974, pages 1158 - 1164
FELLOUSE, PROC. NATL. ACAD. SCI. USA, vol. 101, no. 34, 2004, pages 12467 - 12472
FLATMAN ET AL., J. CHROMATOGR. B, vol. 848, 2007, pages 79 - 87
GAZZANO-SANTORO ET AL., J. IMMUNOL. METHODS, vol. 202, 1996, pages 163
GERNGROSS, NAT. BIOTECH., vol. 22, 2004, pages 1409 - 1414
GLENNER; WONG, BIOCHEM BIOPHYS RES. COMM., vol. 129, 1984, pages 885 - 890
GRAHAM ET AL., J. GEN VIROL., vol. 36, 1977, pages 59
GREENBERG ET AL., LANCET NEUROL., vol. 8, 2009, pages 165 - 74
GRIFFITH ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
GRIFFITHS ET AL., EMBO J, vol. 12, 1993, pages 725 - 734
GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368
GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587
HARLOW; LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY
HELLSTROM, I ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 82, 1985, pages 1499 - 1502
HELLSTROM, I. ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 83, 1986, pages 7059 - 7063
HESSELL ET AL., NATURE, vol. 449, 2007, pages 101 - 104
HETHWA ET AL., AM. J. PHYSIOL., vol. 289, 2005, pages E301 - 305
HINMAN ET AL., CANCER RES., vol. 53, 1993, pages 3336 - 3342
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HOOGENBOOM ET AL.: "Methods in Molecular Biology", vol. 178, 2001, HUMAN PRESS, pages: 1 - 37
HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1992, pages 381 - 388
HUDSON ET AL., NAT. MED., vol. 9, 2003, pages 129 - 134
IDUSOGIE ET AL., J. IMMUNOL., vol. 164, 2000, pages 4178 - 4184
IGAWA ET AL., NATURE BIOTECHNOL., vol. 28, no. 11, pages 1203 - 1208
IMPERIALI; SHANNON, BIOCHEMISTRY, vol. 30, no. 18, 1991, pages 4374 - 4380
JAKOBOVITS ET AL., NATURE, vol. 362, 1993, pages 255 - 258
JAKOBOVITS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 2551
JEFFREY ET AL., BIOORGANIC & MED. CHEM. LETTERS, vol. 16, 2006, pages 358 - 362
JOHNSON ET AL., CURRENT OPINION IN STRUCTURAL BIOLOGY, vol. 3, 1993, pages 564 - 571
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NATIONAL INSTITUTES OF HEALTH
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", vol. 1-3, 1991, NIH PUBLICATION 91-3242
KAM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 102, 2005, pages 11600 - 11605
KANDA, Y. ET AL., BIOTECHNOL. BIOENG., vol. 94, no. 4, 2006, pages 680 - 688
KASHMIRI ET AL., METHODS, vol. 36, 2005, pages 25 - 34
KATSURI, BIOCHEM J., vol. 323, 1997, pages 415 - 419
KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249
KINDT ET AL.: "Kuby Immunology", 2007, W.H. FREEMAN AND CO., pages: 91
KING ET AL., J. MED. CHEM., vol. 45, 2002, pages 4336 - 4343
KLIMKA ET AL., BR. J. CANCER, vol. 83, 2000, pages 252 - 260
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
KONTERMANN, ACTA PHARMACOL. SIN., vol. 26, 2005, pages 1 - 9
KORNACKER ET AL., BIOCHEM., vol. 44, 2005, pages 11567 - 11573
KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553
KOZBOR, J. IMMUNOL., vol. 133, 1984, pages 3001
KRATZ ET AL., CURRENT MED. CHEM., vol. 13, 2006, pages 477 - 523
KUMARA-N, AM J NEURORADIOL, vol. 31, 2010, pages 5
LEE ET AL., J. IMMUNOL. METHODS, vol. 284, no. 1-2, 2004, pages 119 - 132
LEE ET AL., J. MOL. BIOL., vol. 340, no. 5, 2004, pages 1073 - 1093
LEE ET AL., JMB, 2004, pages 1073 - 1093
LI ET AL., NAT. BIOTECH., vol. 24, 2006, pages 210 - 215
LI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, 2006, pages 3557 - 3562
LODE ET AL., CANCER RES., vol. 58, 1998, pages 2925 - 2928
LONBERG, CURR. OPIN. IMMUNOL., vol. 20, 2008, pages 450 - 459
LONBERG, NAT. BIOTECH., vol. 23, 2005, pages 1117 - 1125
MACCALLUM ET AL., J. MOL. BIOL., vol. 262, 1996, pages 732 - 745
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MARKS ET AL., J. MOL. BIOL., vol. 222, 1992, pages 581 - 597
MARKS; BRADBURY: "Methods in Molecular Biology", vol. 248, 2003, HUMAN PRESS, pages: 161 - 175
MARVIN; ZHU, ACTA PHARMACOL. SIN., vol. 26, no. 6, 2005, pages 649 - 658
MATHER ET AL., ANNALS N.Y. ACAD. SCI., vol. 383, 1982, pages 44 - 68
MATHER, BIOL. REPROD., vol. 23, 1980, pages 243 - 251
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553
MCCAFFERTY ET AL., NATURE, vol. 348, pages 552 - 554
MERCHANT, A. M.; ZHU, Z.; YUAN, J. Q.; GODDARD, A.; ADAMS, C. W.; PRESTA, L. G.; CARTER, P., NAT. BIOTECHNOL., vol. 16, 1998, pages 677 - 681
MILSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537
MOLLNES; KIRSCHFINK, MOLEC. IMMUNOL., vol. 43, 2006, pages 107 - 121
MORRIS: "Methods in Molecular Biology", vol. 66, 1996, HUMANA PRESS, article "Epitope Mapping Protocols"
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
NAGY ET AL., PROC. NATL. ACAD. SCI. USA, vol. 97, 2000, pages 829 - 834
NATURE PROTOCOLS, vol. 2, 2007, pages 2212 - 2221
NELSON, MABS, vol. 2, no. 1, 2010, pages 77 - 83
NI, XIANDAI MIANYIXUE, vol. 26, no. 4, 2006, pages 265 - 268
OKAZAKI ET AL., J. MOL. BIOL., vol. 336, 2004, pages 1239 - 1249
OSBOURN ET AL., METHODS, vol. 36, 2005, pages 61 - 68
PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498
PAUL STEVEN M: "Therapeutic antibodies for brain disorders", SCIENCE TRANSLATIONAL MEDICINE, AAAS - AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 3, no. 84, 25 May 2011 (2011-05-25), pages 84ps20, XP009155720, ISSN: 1946-6242 *
PETKOVA, S.B. ET AL., INT'L. IMMUNOL., vol. 18, no. 12, 2006, pages 1759 - 1769
PLUCKTHIIN: "The Pharmacology of Monoclonal Antibodies", vol. 113, 1994, SPRINGER-VERLAG, pages: 269 - 315
PORTOLANO ET AL., J. IMMUNOL., vol. 150, 1993, pages 880 - 887
PREKUMAR ET AL., AM. J PATHOL., vol. 148, 1996, pages 2083 - 95
PRESTA ET AL., CANCER RES., vol. 57, 1997, pages 4593 - 4599
PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
QUEEN ET AL., PROC. NAT'L ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033
RATLIFF-SCHAUB ET AL., AUTISM, vol. 9, 2005, pages 256 - 265
RAVETCH; KINET, ANNU. REV. IMMUNOL., vol. 9, 1991, pages 457 - 492
RIDGWAY, J. B.; PRESTA, L. G.; CARTER, P., PROTEIN ENG., vol. 9, 1996, pages 617 - 621
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 329
RIPKA ET AL., ARCH. BIOCHEM. BIOPHYS., vol. 249, 1986, pages 533 - 545
ROSOK ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 22611 - 22618
S. SOPPER ET AL: "Lymphocyte subsets and expression of differentiation markers in blood and lymphoid organs of rhesus monkeys", CYTOMETRY, vol. 29, no. 4, 1 December 1997 (1997-12-01), pages 351 - 362, XP055132941, ISSN: 0196-4763, DOI: 10.1002/(SICI)1097-0320(19971201)29:4<351::AID-CYTO12>3.3.CO;2-6 *
SCHNEIDER ET AL., NATURE, vol. 311, 1984, pages 675 - 678
SHAKIN-ESHLEMAN ET AL., J. BIOL. CHEM., vol. 271, 1996, pages 6363 - 6366
SHIELDS ET AL., J. BIOL. CHEM., vol. 9, no. 2, 2001, pages 6591 - 6604
SIDHU ET AL., J. MOL. BIOL., vol. 338, no. 2, 2004, pages 299 - 310
SIEGEL ET AL., J. IMMUNOL. METHODS, vol. 286, 2004, pages 141 - 53
SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296
SPERLING ET AL., ALZHEIMER'S & DEMENTIA, vol. 7, 2011, pages 367
TAO ET AL., J. EXP. MED., vol. 173, 1991, pages 1025 - 1028
TORGOV ET AL., BIOCONJ. CHEM., vol. 16, 2005, pages 717 - 721
TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655
TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60
URLAUB ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VAN DER ZEE ET AL., CLIN EXP. IMMUNOL., vol. 64, 1986, pages 415 - 422
VAN DIJK; VAN DE WINKEL, CURR. OPIN. PHARMACOL., vol. 5, 2001, pages 368 - 74
VASSAR ET AL., SCIENCE, vol. 286, 1999, pages 735 - 741
VIDARTE ET AL., J. BIOL. CHEM., vol. 276, no. 41, 2001, pages 38217 - 38223
VITETTA ET AL., SCIENCE, vol. 238, 1987, pages 1098
VOLLMERS; BRANDLEIN, HISTOLOGY AND HISTOPATHOLOGY, vol. 20, no. 3, 2005, pages 927 - 937
VOLLMERS; BRANDLEIN, METHODS AND FINDINGS IN EXPERIMENTAL AND CLINICAL PHARMACOLOGY, vol. 27, no. 3, 2005, pages 185 - 91
WINTER ET AL., ANN. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455
WRIGHT ET AL., TIBTECH, vol. 15, 1997, pages 26 - 32
WU ET AL., NATURE BIOTECHNOLOGY, 2007
XU ET AL., PROTEIN ENG. DES. SEL., vol. 26, 2013, pages 663 - 70
YAMANE-OHNUKI ET AL., BIOTECH. BIOENG., vol. 87, 2004, pages 614
YAZAKI; WU: "Methods in Molecular Biology", vol. 248, 2003, HUMANA PRESS, pages: 255 - 268
YEUNG ET AL., J. IMMUNOL., vol. 182, 2009, pages 7663 - 7671
YU ET AL., SCI. TRANSL. MED., vol. 3, 2011, pages 84RA44
YU ET AL., SCI. TRANSL. MED., vol. 3, no. 84, 25 May 2011 (2011-05-25), pages 84RA44
YU Y JOY ET AL: "Boosting brain uptake of a therapeutic antibody by reducing its affinity for a transcytosis target", SCIENCE TRANSLATIONAL MEDICINE, AAAS - AMERICAN ASSOCIATION FOR THE ADVANCEMENT OF SCIENCE, US, vol. 3, no. 84 84ra44, 25 May 2011 (2011-05-25), pages 1 - 8, XP008148394, ISSN: 1946-6242, DOI: 10.1126/SCITRANSLMED.3002230 *
ZATSEPIN ET AL., RUSS. CHEM. REV., vol. 74, 2005, pages 77 - 95
ZHU ET AL., PROTEIN SCIENCE, vol. 6, 1997, pages 781 - 788

Cited By (44)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11746160B2 (en) 2014-11-19 2023-09-05 Genentech, Inc. Antibodies against BACE1 and use thereof for neural disease immunotherapy
US10882920B2 (en) 2014-11-19 2021-01-05 Genentech, Inc. Antibodies against BACE1 and use thereof for neural disease immunotherapy
US10537633B2 (en) 2016-03-04 2020-01-21 Jn Biosciences Llc Antibodies to TIGIT
US11723971B2 (en) 2016-03-04 2023-08-15 JN Biosciences, LLC Antibodies to TIGIT
US11117963B2 (en) 2016-12-26 2021-09-14 Kyowa Hakko Kirin Co., Ltd. Antibody which binds to myelin oligodendrocyte glycoprotein
KR20190097067A (en) 2016-12-26 2019-08-20 쿄와 기린 가부시키가이샤 Antibodies That Bind to Myelin Oligodendrosite Glycoproteins
US12297268B2 (en) 2016-12-26 2025-05-13 Kyowa Kirin Co., Ltd. Antibody which binds to myelin oligodendrocyte glycoprotein
US11993645B2 (en) 2017-01-11 2024-05-28 The Board Of Trustees Of The Leland Stanford Junior University Compositions comprising R-Spondin (RSPO) surrogate molecules
US11958891B2 (en) 2017-01-26 2024-04-16 Surrozen Operating, Inc. Tissue-specific Wnt signal enhancing molecules and uses thereof
WO2018152375A3 (en) * 2017-02-17 2018-09-27 Denali Therapeutics Inc. Engineered polypeptides
US11912778B2 (en) 2017-02-17 2024-02-27 Denali Therapeutics Inc. Methods of engineering transferrin receptor binding polypeptides
US11795232B2 (en) 2017-02-17 2023-10-24 Denali Therapeutics Inc. Engineered transferrin receptor binding polypeptides
US12162948B2 (en) 2017-02-17 2024-12-10 Denali Therapeutics Inc. Methods of engineering transferrin receptor binding polypeptides
US11612150B2 (en) 2017-02-17 2023-03-28 Denali Therapeutics Inc. Transferrin receptor transgenic models
US10457717B2 (en) 2017-02-17 2019-10-29 Denali Therapeutics Inc. Engineered polypeptides
US11732023B2 (en) 2017-02-17 2023-08-22 Denali Therapeutics Inc. Engineered polypeptides
EP3665194A4 (en) * 2017-08-10 2021-07-07 Denali Therapeutics Inc. AFFINITY BASED METHODS FOR USING TRANSFERRIN RECEPTOR BINDING PROTEINS
JP2020530465A (en) * 2017-08-10 2020-10-22 デナリ セラピューティクス インコーポレイテッドDenali Therapeutics Inc. Affinity-based method for using transferrin receptor-binding proteins
JP2023123757A (en) * 2017-08-10 2023-09-05 デナリ セラピューティクス インコーポレイテッド Affinity-based methods for using transferrin receptor-binding proteins
US10870837B2 (en) 2017-10-02 2020-12-22 Denali Therapeutics Inc. Fusion proteins comprising enzyme replacement therapy enzymes
US11866742B2 (en) 2017-10-02 2024-01-09 Denali Therapeutics Inc. Fusion proteins comprising enzyme replacement therapy enzymes
US11773185B2 (en) 2017-11-08 2023-10-03 Denali Therapeutics Inc. Anti-BACE1 antibodies and methods of use thereof
WO2019094576A1 (en) * 2017-11-08 2019-05-16 Denali Therapeutics Inc. Bace-tau bispecific antibodies
US12258597B2 (en) 2018-02-07 2025-03-25 Regeneron Pharmaceuticals, Inc. Methods and compositions for therapeutic protein delivery
WO2019157224A1 (en) 2018-02-07 2019-08-15 Regeneron Pharmaceuticals, Inc. Methods and compositions for therapeutic protein delivery
WO2020004492A1 (en) 2018-06-26 2020-01-02 協和キリン株式会社 Antibody binding to cell adhesion molecule 3
US11873337B2 (en) 2018-06-26 2024-01-16 Kyowa Kirin Co., Ltd. Antibody binding to cell adhesion molecule 3
KR20210025023A (en) 2018-06-26 2021-03-08 쿄와 기린 가부시키가이샤 Antibodies that bind to chondroitin sulfate proteoglycan-5
KR20210027295A (en) 2018-06-26 2021-03-10 쿄와 기린 가부시키가이샤 Antibodies that bind to cell adhesion molecule 3
US11965035B2 (en) 2018-06-26 2024-04-23 Kyowa Kirin Co., Ltd. Antibody binding to chondroitin sulfate proteoglycan 5
WO2020004490A1 (en) 2018-06-26 2020-01-02 協和キリン株式会社 Antibody binding to chondroitin sulfate proteoglycan-5
US12466884B2 (en) 2018-07-09 2025-11-11 Surrozen Operating, Inc. Tissue-specific WNT signal enhancing molecules and uses
WO2021076931A1 (en) * 2019-10-18 2021-04-22 Centivax, Inc. Antibodies and uses thereof
US11643446B2 (en) 2019-12-23 2023-05-09 Denali Therapeutics Inc. Progranulin variants
US12415854B2 (en) 2020-06-02 2025-09-16 Arcus Biosciences, Inc. Antibodies to TIGIT
US11820824B2 (en) 2020-06-02 2023-11-21 Arcus Biosciences, Inc. Antibodies to TIGIT
US11884944B2 (en) 2020-10-14 2024-01-30 Denali Therapeutics Inc. Fusion proteins comprising sulfoglucosamine sulfohydrolase enzymes and methods thereof
US12240876B2 (en) 2020-11-16 2025-03-04 Surrozen Operating, Inc. Liver-specific Wnt signal enhancing molecules and uses thereof
WO2024026488A2 (en) 2022-07-29 2024-02-01 Regeneron Pharmaceuticals, Inc. Non-human animals comprising a modified transferrin receptor locus
WO2024026494A1 (en) 2022-07-29 2024-02-01 Regeneron Pharmaceuticals, Inc. Viral particles retargeted to transferrin receptor 1
WO2025090898A1 (en) * 2023-10-26 2025-05-01 Biogen Ma Inc. Anti-transferrin receptor antibodies and uses thereof cross reference to related applications
US12527877B2 (en) 2024-01-24 2026-01-20 Arrowhead Pharmaceuticals, Inc. Anti-transferrin receptor antibodies, conjugates thereof, and uses thereof
WO2025265013A3 (en) * 2024-06-20 2026-02-19 Arrowhead Pharmaceuticals, Inc. Rnai agents for inhibiting expression of huntingtin (htt), compositions thereof, and methods of use
WO2026076250A1 (en) 2024-10-03 2026-04-09 Genentech, Inc. Lipid nanoparticles for delivery to the cns from systemic administration

Also Published As

Publication number Publication date
JP2018505652A (en) 2018-03-01
JP6993228B2 (en) 2022-03-03
US20180057604A1 (en) 2018-03-01
HK1245289A1 (en) 2018-08-24
US11008403B2 (en) 2021-05-18
CN107250158A (en) 2017-10-13
EP3221361A1 (en) 2017-09-27
CN107250158B (en) 2022-03-25
EP3221361B1 (en) 2021-04-21

Similar Documents

Publication Publication Date Title
US11098129B2 (en) Anti-transferrin receptor antibodies and methods of use
US11008403B2 (en) Anti-transferrin receptor / anti-BACE1 multispecific antibodies and methods of use
US10808036B2 (en) Anti-transferrin receptor antibodies and methods of use
US20180000964A1 (en) Blood brain barrier receptor antibodies and methods of use
WO2020132230A2 (en) Modified antibody fcs and methods of use
HK1215584B (en) Anti-transferrin receptor antibodies and methods of use
BR112015029009B1 (en) ANTIBODIES, PHARMACEUTICAL FORMULATION AND USES OF AN ANTIBODY
HK1245289B (en) Anti-transferrin receptor / anti-bace1 multispecific antibodies and methods of use

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15804651

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2015804651

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 15525821

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2017526560

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE