WO2016007414A1 - Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy - Google Patents

Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy Download PDF

Info

Publication number
WO2016007414A1
WO2016007414A1 PCT/US2015/039205 US2015039205W WO2016007414A1 WO 2016007414 A1 WO2016007414 A1 WO 2016007414A1 US 2015039205 W US2015039205 W US 2015039205W WO 2016007414 A1 WO2016007414 A1 WO 2016007414A1
Authority
WO
WIPO (PCT)
Prior art keywords
tau
antibody
disease
binding
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/039205
Other languages
English (en)
French (fr)
Inventor
Einar M. Sigurdsson
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
New York University NYU
Original Assignee
New York University NYU
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by New York University NYU filed Critical New York University NYU
Priority to CN201580047108.9A priority Critical patent/CN107073297B/zh
Priority to JP2017500891A priority patent/JP6913018B2/ja
Priority to EP15818480.4A priority patent/EP3166688B1/en
Priority to US15/324,141 priority patent/US10132818B2/en
Priority to ES15818480T priority patent/ES2985805T3/es
Publication of WO2016007414A1 publication Critical patent/WO2016007414A1/en
Anticipated expiration legal-status Critical
Priority to US16/151,555 priority patent/US10859582B2/en
Priority to US17/073,871 priority patent/US11519920B2/en
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6893Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
    • G01N33/6896Neurological disorders, e.g. Alzheimer's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/001Preparation for luminescence or biological staining
    • A61K49/0013Luminescence
    • A61K49/0017Fluorescence in vivo
    • A61K49/005Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
    • A61K49/0058Antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/02Muscle relaxants, e.g. for tetanus or cramps
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/14Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16Anti-Parkinson drugs
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2440/00Post-translational modifications [PTMs] in chemical analysis of biological material
    • G01N2440/14Post-translational modifications [PTMs] in chemical analysis of biological material phosphorylation
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/28Neurological disorders
    • G01N2800/2814Dementia; Cognitive disorders
    • G01N2800/2821Alzheimer

Definitions

  • the present invention relates to antibody-based probes (including single domain antibody fragment, scFv molecules, antibodies, antibody fragments, diabodies, and the epitope-binding domains thereof) that are capable of immunospecifically and selectively binding to a phospho-serine-containing epitope of Tau, such as, for example, Tau-phospho- serine 396/404 peptide.
  • imaging ligands are useful to detect pathological Tau protein conformer if present in a biological sample, especially in conjunction with the diagnosis of Alzheimer's disease or other tauopathy, and thus provide a diagnostic for Alzheimer's disease and other Tau pathologies.
  • the scFv molecules of the present invention have utility as diagnostic markers for, Alzheimer's disease and related tauopathies and as pharmaceutical compositions for the treatment of such conditions.
  • Alzheimer's disease is the most common form of dementia affecting more than 20 million people worldwide.
  • Imaging dyes may not detect pathological Tau in all tauopathies (Fodero-Tavoletti, M. T. et al. (2014) “Assessing THK523 Selectivity For Tau Deposits In Alzheimer 's Disease And Non- Alzheimer 's Disease Tauopathies," Alzheimers. Res. Ther. 6: 11). Imaging these Tau lesions in concert with amyloid- ⁇ ( ⁇ ) is more likely to lead to accurate diagnosis as the regional pattern of Tau aggregates differs between the different tauopathies. Furthermore, all of them except Alzheimer's disease are in part defined by lack of ⁇ deposition.
  • antibody-derived imaging ligands that provide excellent specificity for detecting Tau lesions, and in particular smaller single-chain variable antibody fragments (scFv molecules) which are attractive for in vivo imaging of Tau aggregates. It is envisaged that these antibody-derived imaging ligands can be useful in monitoring disease progression of Tau pathology, the efficacy of Tau-targeting therapies, and to identify ⁇ negative tauopathies.
  • the present invention relates to antibody-based probes (including single domain antibody fragment, scFv molecules, antibodies, antibody fragments, diabodies, and the epitope-binding domains thereof) that are capable of immunospecifically and selectively binding to a phospho-serine-containing epitope of Tau, such as, for example, Tau-phospho- serine 396/404 peptide.
  • imaging ligands are useful to detect pathological Tau protein conformer if present in a biological sample, especially in conjunction with the diagnosis of Alzheimer's disease or other tauopathy, and thus provide a diagnostic for Alzheimer's disease and other Tau pathologies.
  • the scFv molecules of the present invention have utility as diagnostic markers for, Alzheimer's disease and related tauopathies and as pharmaceutical compositions for the treatment of such conditions.
  • the invention concerns a binding molecule that is capable of immunospecifically binding to a phosphorylated Tau peptide having an amino acid sequence consisting of the amino acid sequence of the Tau 396/404 peptide (SEQ ID NO:7): TDHGAE IVYKSPVVSGDTSPRHL, wherein the serine residues at positions 11 and 19 thereof (shown underlined) are phosphorylated, wherein the binding molecule is additionally capable of immunospecifically binding to phosphorylated Tau with greater selectivity than to non- phosphorylated Tau.
  • the invention also pertains to the embodiment of such a binding molecule wherein the molecule is an antibody or comprises an epitope-binding fragment thereof.
  • the invention further pertains to the embodiment of any of such binding molecules wherein the binding molecule comprises such an epitope-binding fragment, and more particularly wherein the molecule is an isolated CDR, a single domain antibody fragment, an scFv or a diabody.
  • the invention particularly pertains to the embodiment of any of such binding molecules wherein upon peripheral injection into a recipient, the binding molecule substantially co- localizes with a Tau aggregate.
  • the epitope-binding fragment comprises any one, any two, any three, any four, any five or all six of:
  • the invention also pertains to the embodiment of such binding molecules wherein the binding molecule is scFv235 (SEQ ID NO: 18).
  • the invention also pertains to the embodiment of any of such binding molecules which is detectably labeled, and especially, any of such binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label
  • the invention also pertains to the use of any of the above-described binding molecules for detecting or measuring the presence or amount of the phosphorylated Tau protein in the brain, or in a biological fluid (e.g. , cerebrospinal fluid, blood, serum, plasma, etc.) of a recipient subject.
  • a biological fluid e.g. , cerebrospinal fluid, blood, serum, plasma, etc.
  • the invention particularly pertains to such a use, the use wherein the detection or measurement comprises in vivo or ex vivo imaging of the binding molecule bound to the phosphorylated Tau protein, and more particularly, wherein the detection or measurement is for diagnosing Alzheimer's disease or another tauopathy of a subject.
  • the invention also pertains to an in vivo medicament for the treatment of Alzheimer's disease or another tauopathy of a subject, wherein the medicament comprises the binding molecule of any of claims 1-8 in an amount effective to treat the Alzheimer's disease or other tauopathy, and one or more carriers, diluents and/or stabilizers.
  • the invention also pertains to the use of such an in vivo medicament for the treatment of Alzheimer's disease or another tauopathy of the subject.
  • the invention particularly pertains to the above -recited uses, wherein the subject is a human.
  • the invention also pertains to a kit for detecting or measuring the presence or amount of the phosphorylated Tau protein in the brain of a subject, or for diagnosing Alzheimer's disease or another tauopathy in a subject, wherein the kit comprises any of the above-recited binding molecules.
  • the invention further pertains to any of the above -recited uses, or to any of the above-recited medicament, or to any of the above-recited kits, wherein the tauopathy is selected from the group comprising frontotemporal dementia, parkinsonism linked to chromosome 17 (FTDP-17), progressive supranuclear palsy, corticobasal degeneration, Pick's disease, progressive subcortical gliosis, tangle only dementia, diffuse neurofibrillary tangles with calcification, argyrophilic grain dementia, amyotrophic lateral sclerosis parkinsonism-dementia complex, dementia pugilistica, Down syndrome, Gerstmann- Straussler-Scheinker disease, Hallerworden-Spatz disease, inclusion body myositis, Creutzfeld- Jakob disease, multiple system atropy, Niemann-Pick disease type C, prion protein cerebral amyloid angiopathy, subacute sclerosing panencephalitis
  • FigureslA-lB show the binding of randomly selected scFv clones generated from antibody 6B2G12 ( Figures 1A and IB) to the non-phosphorylated epitope of SEQ ID NO:27 or the phosphorylated Tau epitope of SEQ ID NO:28.
  • the clones of Figure 1A were panned against the phosphorylated epitope (SEQ ID NO:28).
  • the clones of Figure IB were panned against the non-phosphorylated epitope (SEQ ID NO:27).
  • Figures 2A-2E scFv235 binds selectively to phospho-Tau epitope and to Tau protein in Alzheimer's brain homogenate.
  • Figure 2A shows that scFv235 selectively binds to phospho-Tau-serine 396/404 (P- Ser396/404) epitope in ELISA compared to its non-phospho equivalent epitope (Ser396/404).
  • FIG. 2B shows that scFv235 specifically binds to Tau of Alzheimer's disease brain homogenate.
  • Incubation of a brain homogenate from an individual with Alzheimer's disease with scFv235 results in the immunoprecipitation of Tau bands in the range of 50-70kDa.
  • Western blots with CP27 (human Tau) and polyclonal total Tau antibody (Dako) showed similar results with no other bands detected.
  • a low speed supernatant (LSS) of the brain homogenate is shown in an adjacent lane from the same blot with several additional Tau positive bands.
  • FIG. 2C Incubation of a brain homogenate from an individual with Alzheimer's disease with 6B2G12 results in the immunoprecipitation of Tau bands in the range of 50- 70kDa as well as degradation fragments in the range of 20-30 kDa.
  • Western blots with CP27 (human Tau) and polyclonal total Tau antibody (Dako) showed greater detection of intact Tau with CP27 and smaller Tau fragments with Dako Tau.
  • LSS low speed supernatant
  • Figure 2D Shows the results of differential staining for four human brain sections.
  • Row 1 brain section from Alzheimer's disease individual AD-1;
  • Row 2 brain section from Alzheimer's disease individual AD-2;
  • Row 3 brain section from Pick's disease individual;
  • Row 4 brain section from healthy control individual.
  • Column A section stained with Hoechst to show nuclei;
  • Column B section stained with scFv235;
  • Column C section stained with PHFl;
  • Column D sections merged to show localization (see arrows).
  • Figure 2E Shows that scFv 235 binds to pathological Tau on Alzheimer's disease human brain sections, but exhibits limited binding to control human brain sections.
  • FIGS 3A-3D In vivo imaging of Tau inclusions in P301L, htau/PSl, htau, Tg- SwDI and wild-type mice after intracarotid or intravenously injected fluorescently labeled scFv235 or 6B2G12. Representative images from various groups are shown in different panels.
  • Figure 3A Intracarotid Imaging. Images recorded prior to injection (Column A) and at specified intervals (Column B, Column C and Column D) post-injection. Row 1 : images of P301L (12 months old) transgenic mouse, injected with scFv235 tagged with near infrared dye (680 nm) and imaged before injection (Column A), and at 38 minutes (Column B), 82 minutes (Column C) and 220 minutes (Column D) post-injection. Signal is detected throughout the body with highest intensity in the brain that slowly decreases over time.
  • Row 3 images of scFv235 -injected wt (9 months) mouse, before injection and at 37 minutes (Column B), 75 minutes (Column C) and 265 minutes (Column D) post-injection. Very limited brain signal was detected post-injection with no signal in periphery.
  • Row 4 images of 6B2G12-injected P301L (10 months) transgenic mouse, recorded before injection and at 37 minutes (Column B), 170 minutes (Column C) and 291 minutes (Column D) post-injection.
  • FIG. 3B Quantitative analysis of IVIS (in vivo Imaging System) brain signal over time after intracarotid injection: Highest signal was detected in P301L mice injected with scFv235. The older mice (11 and 12 months) had total radiant efficiency (TRE) peak at 2.23E+11 and 2.64E+11 respectively, whereas the younger mice (3 and 8 months) had lower peak signals (1.88E+11 and 1.86E+11 respectively). The same P301L model (7-10 months) had strong but lesser brain signal after 6B2G12 injection, ranging from 2.20E+11 to 1.16E+11.
  • IVIS in vivo Imaging System
  • Figure 3C Intravenous Imaging. Images recorded prior to injection (Column A) and at specified intervals (Column B, Column C and Column D) post-injection. Row 1 : images of P301L (13 months old) transgenic mouse, injected with scFv235 tagged with near infrared dye (680 nm) and imaged before injection (Column A), and at 18 minutes (Column B), 210 minutes (Column C) and 11520 minutes (day 8) (Column D) post-injection. Peak brain signal was detected at 18 min (1754% above pre -injection baseline), with lesser signal at 210 min (18% reduction from peak signal), that had substantially subsided at 8 days (43% reduction).
  • Row 2 images from an Tg-SwDI ⁇ plaque mouse (12 months) recorded before injection, and at 25 minutes (Column B), 60 minutes (Column C) and 11520 minutes (day 8) (Column D) post-injection. Very limited brain signal was detected post-injection with no signal in periphery.
  • Row 3 images of 6B2G12-injected P301L (7 months) transgenic mouse, before injection and at 25 minutes (Column B), 120 minutes (Column C) and 11520 minutes (day 8) (Column D) post-injection.
  • FIG. 3D Quantitative analysis of IVIS brain signal over time after intravenous injection: scFv235 and 6B2G12 were injected into P301L mice. These mice could be imaged at earlier time points post-injection than the intracarotid injected mice as the latter route requires longer postoperative care to prevent bleeding. Peak signal was generally obtained within the first hour post-injection, depending on the animal, at similar intervals for all probes. Overall signal was substantially higher for scFv235 and 6B2G12 compared to control IgG, even though the IgG injected mice had the most robust Tau pathology (see Table 6). One 6B2G12 injected mouse (B15) had comparable IVIS signal to the IgG injected mice but more modest Tau pathology. The signal gradually subsided over 14 days at different rates for individual P301L mice. Very limited signal was detected at all time points in injected Tg- SwDI or wt mice with either probe.
  • FIGs 4A-4D Co-localization of injected scFv235 and 6B2G12 with intraneuronal Tau protein, markers of endosomes-autophagosomes-lysosomes and microglia.
  • Brains were removed 3-4 hours following intracarotid injection and IVIS imaging, fixed, sectioned coronally and stained for: (1) Tau with Tau5 (total Tau), MCI (conformational), PHF1 (phospho-Tau), and (2) early endosomes (EEA1); (3) late endosomes/lysosomes (Rab 7); and (4) autophagosomes (LC3, P62). Sections were also stained with microglia (Iba-1).
  • Figure 4A scFv235 -injected P301L mice (Rows 1-2, 4 and 7: mouse “ ⁇ 12;” Row 3: mouse “ ⁇ 8;” Rows 5-6: mouse “A13") were imaged to identify nuclei (Column A), imaged with scFV235 (Column B), imaged to show PHFl (Column C), and a merged image was created (Column D). Images showed partial co-localization with MCI, Tau5, and PHFl, and complete co-localization with Rab7, EEAl, LC3 and P62.
  • Figure 4B scFv235 -injected htau/PSl mice (Rows 1, 5, 7-8: mouse “ ⁇ 47;” Rows 2- 4 and 6: mouse “B32") were imaged to identify nuclei (Column A), imaged with scFV235 (Column B), imaged to show PHFl (Column C), and a merged image was created (Column D). Images showed partial co-localization of the injected scFv235 with MCI, Tau5, and Iba- 1 (not shown) and complete co-localization with PHFl, Rab7, EEAl, LC3 and P62 antibodies.
  • FIG. 4C 6B2G12-injected P301L mice (Rows 1 and 7: mouse “ ⁇ 52;” Rows 2-6: mouse “A50”) were imaged to identify nuclei (Column A), imaged with scFV235 (Column B), imaged to show PHFl (Column C), and a merged image was created (Column D).
  • Figure 5 shows that scFv235 co-localized with pathological Tau within brain neurons following intracarotid injection in P301L (F6) and htau/PSl (A47) tangle mice, but did not have detectable uptake in control wild-type mice (Rl).
  • the present invention relates to antibody-based probes (including single domain antibody fragment, scFv molecules, antibodies, antibody fragments, diabodies, and the epitope-binding domains thereof) that are capable of immunospecifically and selectively binding to a phospho-serine-containing epitope of Tau, such as, for example, Tau-phospho- serine 396/404 peptide.
  • imaging ligands are useful to detect pathological Tau protein conformer if present in a biological sample, especially in conjunction with the diagnosis of Alzheimer's disease or other tauopathy, and thus provide a diagnostic for Alzheimer's disease and other Tau pathologies.
  • the scFv molecules of the present invention have utility as diagnostic markers for, Alzheimer's disease and related tauopathies and as pharmaceutical compositions for the treatment of such conditions.
  • the antibody-based probes of the present invention provide greater specificity than ⁇ -sheet dyes for detecting Tau lesions in patients with AD or other tauopathies.
  • smaller antibody fragments that bind to Tau are attractive as ligands for in vivo imaging.
  • Their smaller size compared to antibodies leads to better access to Tau aggregates.
  • Another advantage is their relatively rapid clearance from the circulation compared to unmodified antibodies that have longer half-lives.
  • therapeutic antibodies have routinely been co-developed as imaging agents, and several such antibodies and Fab's or smaller diabodies and scFv molecules with better pharmacokinetic properties approved or proposed as tumor imaging agents (see, Kaur, S. et al.
  • Tau is synonym with the Tau protein and refers to any of the Tau protein isoforms (identified in for example UniProt as PI 0636, 1-9).
  • the amino acid numbering of Tau is given with respect to SEQ ID NO: 1 as shown below, Met being amino acid 1.
  • P-Tau refers to a Tau protein that has been phosphorylated at one or more serine or threonine residues.
  • P-Ser 396/404 refers to a polypeptide of Tau that comprises the amino acid sequence of SEQ ID NO:l wherein serine residues 396 and 404 are phosphorylated:
  • Tau is a soluble microtubule-associated protein that is dynamically phosphorylated and dephosphorylated by a host of kinase enzymes during the cell cycle. Tau's ability to stabilize microtubules is dependent on the extent of its phosphorylation. In its dephosphorylated form, the protein is able to interact with tubulin to stabilize microtubules and promote tubulin assembly into microtubules (which form the cytoskeleton of the cell and are the major constituents of the mitotic spindles that pull apart eukaryotic chromosomes in mitosis). In its phosphorylated form, Tau is able to dissociate from microtubules, thereby permitting mitosis to occur.
  • the phosphorylation of Tau acts thus as a direct microtubule association-dissociation switch within the neuron (Pedersen, J.T. et al. (2015) “7aw Immunotherapy For Alzheimer 's Disease “ Trends Mol. Med. 2015 Apr 3. pii: S1471- 4914(15)00058-1; pages 1-9, hereby incorporated by reference herein in its entirety).
  • Tau aggregates of paired helical filaments and straight filaments.
  • Tau aggregates may be intracellular ⁇ e.g., intraneuronal), but may also form outside of the cells.
  • the presence of Tau aggregates impairs Tau's ability to stabilize microtubules and thus leads to microtubule disassembly, dendritic spinal collapse, and the degeneration of axons.
  • Normal Tau contains, on average two phosphorylated sites; the hyperphosphorylated Tau filaments average seven to eight phosphorylated sites.
  • Hyperphosphorylated Tau is the main constituent of the intracellular neurofibrillary tangles that are a main hallmark of Alzheimer's Disease.
  • antibody refers to an intact immunoglobulin as well as a molecule having an epitope-binding fragment thereof.
  • Naturally occurring antibodies typically comprise a tetramer which is usually composed of at least two heavy (H) chains and at least two light (L) chains.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region, usually comprised of three domains (CHI, CH2 and CH3).
  • Heavy chains can be of any isotype, including IgG (IgGl, IgG2, IgG3 and IgG4 subtypes), IgA (IgAl and IgA2 subtypes), IgM and IgE.
  • Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region (CL).
  • Light chains include kappa chains and lambda chains.
  • the heavy and light chain variable region is typically responsible for antigen recognition, while the heavy and light chain constant region may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • the VH and VL regions can be further subdivided into regions of hypervariability, termed “complementarity determining regions,” that are interspersed with regions of more conserved sequence, termed “framework regions" (FR).
  • Each VH and VL is composed of three CDR Domains and four FR Domains arranged from amino-terminus to carboxy-terminus in the following order: FR1-CDR1-FR2- CDR2-FR3-CDR3-FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • antibodies and their epitope-binding fragments that have been "isolated” so as to exist in a physical milieu distinct from that in which it may occur in nature or that have been modified so as to differ from a naturally occurring antibody in amino acid sequence.
  • Fragments of antibodies that exhibit epitope-binding ability can be obtained, for example, by protease cleavage of intact antibodies. More preferably, such fragments will be single domain antibody fragments, scFv molecules, and the epitope-binding domains of antibodies, etc., that are formed using recombinant techniques.
  • the two domains of the Fv fragment, VL and VH are encoded by separate genes, such gene sequences or their encoding cDNA can be joined, using recombinant methods, by a flexible linker (typically of about 10, 12, 15 or more amino acid residues) that enables them to be made as a single protein chain in which the VL and VH regions associate to form monovalent epitope-binding molecules (known as single- chain Fv (scFv) molecules; see e.g., Bird et al. , (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. (U.S.A.) 85:5879-5883).
  • scFv single- chain Fv
  • a flexible linker that is too short (e.g., less than about 9 residues) to enable the VL and VH regions of a single polypeptide chain to associate together
  • a bispecific antibody, diabody, or similar molecule in which two such polypeptide chains associate together to form a bivalent epitope-binding molecule
  • Single domain antibody fragments possess only one variable domains (e.g., VL or VH).
  • epitope-binding fragments encompassed within the present invention include (i) Fab' or Fab fragments, a monovalent fragment consisting of the VL, VN, CL and CHI domains, or a monovalent antibody as described in WO2007059782; (ii) F(ab') 2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) Fd fragments consisting essentially of the VH and CHI domains; (iv) Fv fragments consisting essentially of a VL and VH domain, (v) dAb fragments (Ward et al, Nature 341 , 544-546 (1989)), which consist essentially of a VH domain and also called domain antibodies (Holt et al; Trends Biotechnol.
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they may be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain antibodies or single chain Fv (scFv), see for instance Bird et al, Science 242, 423-426 (1988) and Huston et al, PNAS USA 85, 5879- 5883 (1988)).
  • scFv single chain antibodies or single chain Fv
  • antibody also includes antibody-like polypeptides, such as chimeric antibodies and humanized antibodies, and antibody fragments retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques.
  • An antibody as generated can possess any isotype.
  • isotype refers to the immunoglobulin class (for instance IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM) that is encoded by heavy chain constant region genes.
  • isotypes typically will be guided by the desired effector functions, such as ADCC induction.
  • exemplary isotypes are IgGl, IgG2, IgG3, and IgG4. Either of the human light chain constant regions, kappa or lambda, may be used.
  • the class of an anti-Tau antibody of the present invention may be switched by known methods. For example, an antibody of the present invention that was originally IgM may be class switched to an IgG antibody of the present invention. Further, class switching techniques may be used to convert one IgG subclass to another, for instance from IgGl to IgG2.
  • an antibody of the present invention is an IgGl antibody, for instance an IgGl , ;.
  • Such antibody fragments are obtained using conventional techniques known to those of skill in the art. For example, F(ab')2 fragments may be generated by treating antibody with pepsin. The resulting F(ab')2 fragment may be treated to reduce disulfide bridges to produce Fab' fragments.
  • Fab fragments may be obtained by treating an IgG antibody with papain; Fab' fragments may be obtained with pepsin digestion of IgG antibody.
  • An F(ab') fragment may also be produced by binding Fab' described below via a thioether bond or a disulfide bond.
  • a Fab' fragment is an antibody fragment obtained by cutting a disulfide bond of the hinge region of the F(ab')2.
  • a Fab' fragment may be obtained by treating an F(ab')2 fragment with a reduc-ing agent, such as dithiothreitol.
  • Antibody fragment may also be generated by expression of nucleic acids encoding such fragments in recombinant cells (see for instance Evans et al., J. Immunol. Meth.
  • a chimeric gene encoding a portion of an F(ab')2 fragment could include DNA sequences encoding the CHI domain and hinge region of the H chain, followed by a translational stop codon to yield such a truncated antibody fragment molecule.
  • Suitable fragments capable of binding to a desired epitope may be readily screened for utility in the same manner as an intact antibody.
  • such antibody fragments are a monovalent antibody, preferably a monovalent antibody as described in PCT Publication WO 2007/059782 (which is incorporated herein by reference in its entirety) having a deletion of the hinge region.
  • Such an antibody may be constructed by a method comprising: i) providing a nucleic acid construct encoding the light chain of said monovalent antibody, said construct comprising a nucleotide sequence encoding the VL region of a selected antigen specific anti alpha-synuclein antibody and a nucleotide sequence encoding the constant CL region of an Ig, wherein said nucleotide sequence encoding the VL region of a selected antigen specific antibody and said nucleotide sequence encoding the CL region of an Ig are operably linked together, and wherein, in case of an IgGl subtype, the nucleotide sequence encoding the CL region has been modified such that the CL region does not contain any amino acids capable of forming disulfide bonds
  • the antibody is a monovalent antibody, which comprises:
  • a CH region of an immunoglobulin or a fragment thereof comprising the CH2 and CH3 regions, wherein the CH region or fragment thereof has been modified such that the region corresponding to the hinge region and, if the immunoglobulin is not an IgG4 subtype, other regions of the CH region, such as the CH3 region, do not comprise any amino acid residues, which are capable of forming disulfide bonds with an identical CH region or other covalent or stable non-covalent inter-heavy chain bonds with an identical CH region in the presence of polyclonal human IgG.
  • the heavy chain of the monovalent antibody has been modified such that the entire hinge has been deleted.
  • sequence of said monovalent antibody has been modified so that it does not comprise any acceptor sites for N-linked glycosylation.
  • an antibody or an epitope-binding fragment thereof is said to "immunospecifically" bind a region of another molecule (i.e., an epitope) if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity or avidity with that epitope relative to alternative epitopes. It is also understood by reading this definition that, for example, an antibody or an epitope-binding fragment thereof that specifically binds to a first target may or may not specifically or preferentially bind to a second target.
  • binding in the context of the binding of an antibody or binding fragment thereof to a predetermined antigen typically refers to binding with an affinity corresponding to a K D of about 10 - " 7 M or less, such as about 10 - " 8 M or less, such as about 10 "9 M or less when determined by, for instance, surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument (preferably using the antibody as the ligand and the antigen as the analyte), and which binds to the predetermined antigen with an affinity corresponding to a K D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1,000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
  • a non-specific antigen e.g., BSA, casein
  • the amount with which the affinity is lower is dependent on the K D of the antibody, so that when the K D of the antibody is very low (that is, the antibody is highly specific), then the amount with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000 fold.
  • the term "k d " (sec 1 or 1/s), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k Q ff value.
  • k a (M "1 x sec “1 or 1/M), as used herein, refers to the association rate constant of a particular antibody-antigen interaction.
  • K D refers to the dissociation equilibrium constant of a particular antibody-antigen interaction.
  • KA M 1 or 1/M
  • KA refers to the association equilibrium constant of a particular antibody-antigen interaction and is obtained by dividing the k a by the kd.
  • an antibody or an epitope-binding fragment thereof is said to "selectively" bind to a phosphorylated peptide epitope if it immunospecifically binds to such epitope with higher affinity than it binds (if it binds at all) to a non-phosphorylated peptide epitope having the same amino acid sequence.
  • higher affinity will be at least 10-fold higher, at least 30-fold higher, at least 100-fold higher, at least 300-fold higher, at least 1,000-fold higher, at least 3,000-fold higher, or at least 10,000-fold higher.
  • scFv235 "selectively" binds to the phosphorylated P-Ser396/404 peptide relative to the non- phosphorylated peptide (exhibiting a "selectivity" of about 4,000-fold).
  • the extent of "selectivity" of an antibody, or of an epitope-binding fragment thereof, for phosphorylated Tau is determined by comparing, via ELISA or Biacore, the affinity with which an scFv of such antibody immunospecifically binds to a non-phosphorylated target Tau peptide and to a phosphorylated variant thereof.
  • epitope means an antigenic determinant capable of specific binding to an antibody.
  • Epitopes usually consist of surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former, but not the latter, is lost in the presence of denaturing solvents.
  • the epitope may comprise amino acid residues directly involved in the binding (also called immunodominant component of the epitope) and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked by the specifically antigen binding peptide (in other words, the amino acid residue is within the footprint of the specifically antigen binding peptide).
  • epitope-binding fragment of an antibody means a fragment of an antibody capable of immunospecifically binding to an epitope.
  • An epitope- binding fragment may contain 1, 2, 3, 4, 5 or all 6 of the CDR Domains of such antibody and, although capable of immunospecifically binding to such epitope, may exhibit an immunospecificity, affinity or selectivity toward such epitope that differs from that of such antibody.
  • an epitope-binding fragment will contain all 6 of the CDR Domains of such antibody.
  • An epitope-binding fragment of an antibody may be a single polypeptide chain (e.g., an scFv), or may comprise two or more polypeptide chains, each having an amino-terminus and a carboxyl terminus (e.g., a diabody, an Fab fragment, an Fab 2 fragment, etc.).
  • the antibodies of the present invention, and their Tau epitope-binding fragments will preferably be "humanized,” particularly if employed for therapeutic purposes.
  • the term “humanized” refer to a chimeric molecule, generally prepared using recombinant techniques, having an antigen binding site derived from an immunoglobulin from a non-human species and a remaining immunoglobulin structure based upon the structure and /or sequence of a human immunoglobulin.
  • the antigen-binding site may comprise either complete non-human antibody variable domains fused to human constant domains, or only the complementarity determining regions (CDRs) of such variable domains grafted to appropriate human framework regions of human variable domains.
  • CDRs complementarity determining regions
  • the framework residues of such humanized molecules may be wild type (e.g., fully human) or they may be modified to contain one or more amino acid substitutions not found in the human antibody whose sequence has served as the basis for humanization. Humanization lessens or eliminates the likelihood that a constant region of the molecule will act as an immunogen in human individuals, but the possibility of an immune response to the foreign variable region remains (LoBuglio, A.F. et al. (1989) Mouse/Human Chimeric Monoclonal Antibody In Man: Kinetics And Immune Response Proc. Natl. Acad. Sci. (U.S.A.) 86:4220-4224).
  • variable regions of both heavy and light chains contain three complementarity- determining regions (CDRs) which vary in response to the antigens in question and determine binding capability, flanked by four framework regions (FRs) which are relatively conserved in a given species and which putatively provide a scaffolding for the CDRs.
  • CDRs complementarity- determining regions
  • FRs framework regions
  • humanized antibodies preserve all CDR sequences (for example, a humanized mouse antibody which contains all six CDRs from the mouse antibodies).
  • humanized antibodies have one or more CDRs (one, two, three, four, five, six) which are altered with respect to the original antibody, which are also termed one or more CDRs "derived from" one or more CDRs from the original antibody.
  • CDRs one, two, three, four, five, six
  • the ability to humanize an antigen is well known (see, e.g., US Patents No. 5,225,539; 5,530,101; 5,585,089; 5,859,205; 6,407,213; 6,881,557).
  • the antibody of the invention is a human antibody.
  • Suitable human antibodies may be generated using transgenic or transchromosomal mice carrying parts of the human immune system rather than the mouse system.
  • transgenic and transchromosomic mice include mice referred to herein as HuMAb mice and KM mice, respectively, and are collectively referred to herein as "transgenic mice.”.
  • the HuMAb mouse contains a human immunoglobulin gene minilocus that encodes unrearranged human heavy variable and constant ( ⁇ and Y) and light variable and constant (K) chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and K chain loci (Lonberg, N. et al, Nature 368, 856-859 (1994)). Accordingly, such mice exhibit reduced expression of mouse IgM or IgK and in response to immunization, the introduced human heavy and light chain transgenes, undergo class switching and somatic mutation to generate high affinity human IgG, ⁇ ; monoclonal antibodies (Lonberg, N. et al.
  • HuMAb mice The preparation of HuMAb mice is described in detail in Taylor, L. et al., Nucleic Acids Research 20, 6287-6295 (1992), Chen, J. et al, International Immunology 5, 647-656 (1993), Tuaillon et al, J. Immunol. 152, 2912-2920 (1994), Taylor, L.
  • the HCo7 mice have a JKD disruption in their endogenous light chain (kappa) genes (as described in Chen et al, EMBO J. 12, 821-830 (1993)), a CMD disruption in their endogenous heavy chain genes (as described in Example 1 of WO 01/14424), a KCo5 human kappa light chain transgene (as described in Fishwild et al., Nature Biotechnology 14, 845- 851 (1996)), and a HCo7 human heavy chain transgene (as described in US 5,770,429).
  • the HCol2 mice have a JKD disruption in their endogenous light chain (kappa) genes (as described in Chen et al, EMBO J. 12, 821-830 (1993)), a CMD disruption in their endogenous heavy chain genes (as described in Example 1 of WO 01/14424), a KCo5 human kappa light chain transgene (as described in Fishwild et al., Nature Biotechnology 14, 845- 851 (1996)), and a HCol2 human heavy chain transgene (as described in Example 2 of WO 01/14424).
  • kappa endogenous light chain
  • CMD disruption in their endogenous heavy chain genes as described in Example 1 of WO 01/14424
  • KCo5 human kappa light chain transgene as described in Fishwild et al., Nature Biotechnology 14, 845- 851 (1996)
  • HCol2 human heavy chain transgene as described in Example 2 of WO 01/14424.
  • the endogenous mouse kappa light chain gene has been homozygously disrupted as described in Chen et al, EMBO J. 12, 811-820 (1993) and the endogenous mouse heavy chain gene has been homozygously disrupted as described in Example 1 of WO 01/09187.
  • This mouse strain carries a human kappa light chain transgene, KCo5, as described in Fishwild et al, Nature Biotechnology 14, 845-851 (1996).
  • This mouse strain also carries a human heavy chain transchromosome composed of chromosome 14 fragment hCF (SC20) as described in WO 02/43478.
  • Splenocytes from these transgenic mice may be used to generate hybridomas that secrete human monoclonal antibodies according to well-known techniques.
  • Human monoclonal or polyclonal antibodies of the present invention, or antibodies of the present invention originating from other species may also be generated transgenically through the generation of another non-human mammal or plant that is transgenic for the immunoglobulin heavy and light chain sequences of interest and production of the antibody in a recoverable form therefrom.
  • antibodies may be produced in, and recovered from, the milk of goats, cows, or other mammals. See for instance US 5,827,690, US 5,756,687, US 5,750,172 and US 5,741,957.
  • CDR residues not contacting antigen and not in the SDRs can be identified based on previous studies (for example residues H60-H65 in CDR H2 are often not required), from regions of Kabat CDRs lying outside Chothia hypervariable loops (see, Kabat et al. (1992) SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST, National Institutes of Health Publication No. 91- 3242; Chothia, C. et al. (1987) Canonical Structures For The Hypervariable Regions Of Immunoglobulins," J.
  • substitutions are potentially advantageous in decreasing the number of mouse amino acids in a humanized antibody and consequently decreasing potential immunogenicity.
  • substitutions can also cause changes of affinity, and significant reductions in affinity are preferably avoided.
  • Positions for substitution within CDRs and amino acids to substitute can also be selected empirically.
  • a polynucleotide encoding the CDR is mutagenized (for example via random mutagenesis or by a site-directed method ⁇ e.g., polymerase chain- mediated amplification with primers that encode the mutated locus)) to produce a CDR having a substituted amino acid residue.
  • a site-directed method e.g., polymerase chain- mediated amplification with primers that encode the mutated locus
  • the BLOSUM62.iij substitution score for that substitution can be identified.
  • the BLOSUM system provides a matrix of amino acid substitutions created by analyzing a database of sequences for trusted alignments (Eddy, S.R.
  • BLOSUM62.iij the BLOSUM62 database
  • Table 1 presents the BLOSUM62.iij substitution scores (the higher the score the more conservative the substitution and thus the more likely the substitution will not affect function). If an antigen-binding fragment comprising the resultant CDR fails to bind to RORl, for example, then the BLOSUM62.iij substitution score is deemed to be insufficiently conservative, and a new candidate substitution is selected and produced having a higher substitution score.
  • the BLOSUM62.iij substitution score will be 0, and more conservative changes (such as to aspartate, asparagine, glutamine, or lysine) are preferred.
  • the invention thus contemplates the use of guided or random mutagenesis to identify improved CDRs.
  • conservative substitutions may be defined by substitutions within the classes of amino acids reflected in one or more of the following three tables:
  • More conservative substitutions groupings include: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, and asparagine-glutamine.
  • Phage display technology can alternatively be used to increase (or decrease) CDR affinity.
  • This technology referred to as affinity maturation, employs mutagenesis or "CDR walking" and re-selection uses the target antigen or an antigenic fragment thereof to identify antibodies having CDRs that bind with higher (or lower) affinity to the antigen when compared with the initial or parental antibody (See, e.g. Glaser et al. (1992) J. Immunology 149:3903). Mutagenizing entire codons rather than single nucleotides results in a semi- randomized repertoire of amino acid mutations.
  • Libraries can be constructed consisting of a pool of variant clones each of which differs by a single amino acid alteration in a single CDR and which contain variants representing each possible amino acid substitution for each CDR residue.
  • Mutants with increased (or decreased) binding affinity for the antigen can be screened by contacting the immobilized mutants with labeled antigen. Any screening method known in the art can be used to identify mutant antibodies with increased or decreased affinity to the antigen (e.g., ELISA) (See Wu et al. 1998, Proc. Natl. Acad. Sci. (U.S.A.) 95:6037; Yelton et al., 1995, J. Immunology 155: 1994). CDR walking which randomizes the Light Chain may be used possible (see, Schier et al., 1996, J. Mol. Bio. 263:551).
  • transgenic non-human animal refers to a non-human animal having a genome comprising one or more human heavy and/or light chain transgenes or transchromosomes (either integrated or non-integrated into the animal's natural genomic DNA) and which is capable of expressing fully human antibodies.
  • a transgenic mouse can have a human light chain transgene and either a human heavy chain transgene or human heavy chain transchromosome, such that the mouse produces human anti-Tau antibody when immunized with Tau antigen and/or cells expressing Tau.
  • the human heavy chain transgene may be integrated into the chromosomal DNA of the mouse, as is the case for transgenic mice, for instance HuMAb mice, such as HCo7 or HCol2 mice, or the human heavy chain transgene may be maintained extrachromosomally, as is the case for transchromosomal KM mice as described in WO02/43478.
  • transgenic and transchromosomal mice are capable of producing multiple isotypes of human monoclonal antibodies to a given antigen (such as IgG, IgA, IgM, IgD and/or IgE) by undergoing V-D-J recombination and isotype switching.
  • scFv molecules single-chain variable antibody fragments
  • scFv molecules are formed as a fusion protein of the variable regions of the heavy (H) and light chains (L) domains of an antibody, connected to one another via a short linker peptide of from about 10 to about 25 amino acid residues.
  • the linker is usually rich in glycine for flexibility ⁇ e.g., GGGGS GGGG S GGGGS (SEQ ID NO:2) (Fisher, A. et al. (2009) Efficient Isolation Of Soluble Intracellular Single-Chain Antibodies Using The Twin- Arginine Translocation Machinery " J. Nol. Biol. 385(1):299-311; Bird, R.E. et al. (1988) "Single-Chain Antigen-Binding Proteins," Science 242:423-426; Huston, J.S. et al.
  • a particularly preferred linker for the present invention has the amino acid sequence (SEQ ID NO:4): S S GGGGS GGGGGGS SRS S .
  • the scFv may include a poly histidine ("His-Tag”) (e.g., (SEQ ID NO:5) HHHHHH).
  • His-Tag poly histidine
  • the imidazole side chains of the histidine residues of the His-Tag can engage in reversible coordinative bonds to certain transition metal ions, such as Co 2+ , Zn 2+ and especially Ni +2 .
  • transition metal ions such as Co 2+ , Zn 2+ and especially Ni +2 .
  • the scFv may additionally or alternatively include an "HA-Tag” such as (SEQ ID NO:6) GAY PYDVPDYAS .
  • Human influenza hemagglutinin (HA) is a surface glycoprotein required for the infectivity of the human virus.
  • the HA-tag is derived from the human influenza hemagglutinin (HA) surface glycoprotein, and permits detection of the scFv using an anti-HA-Tag antibody (Millipore).
  • scFv molecules may be expressed directly or as a fusion protein that is linked to an N-terminal leader peptide that is cleaved in order to yield the scFv (see, e.g., Huston, J.S. et al. (1988) "Protein Engineering Of Antibody Binding Sites: Recovery Of Specific Activity In An Anti-Digoxin Single-Chain Fv Analogue Produced In Escherichia coli," Proc. Natl. Acad. Sci. (U.S.A.) 85:5879-5883).
  • the scFv may be fused to the modified trp LE leader peptide (MLE)), and cleaved away by acid cleavage of the Asp-Pro peptide bond
  • MLE modified trp LE leader peptide
  • an scFv can be linked to another scFv (which may be the same or different) in order to form a bivalent molecule. This can be done by producing a single peptide chain with two VH and two VL regions, yielding tandem scFv molecules (Xiong, C.-Y. et al. (2006) “Development Of Tumor Targeting Anti-MUC-1 Multimer: Effects Of di-scFv Unpaired Cysteine Location On PEGylation And Tumor Binding," Protein Engineering Design and Selection 19(8):359-367; Kufer, P. et al. (2004) “A Revival Of Bispecific Antibodies,” Trends in Biotechnology 22(5) :238-24).
  • diabody drugs could be dosed much lower than other therapeutic antibodies and are capable of highly specific targeting of tumors in vivo (Adams, G.P. et al. (1998) "Prolonged in vivo Tumour Retention Of A Human Diabody Targeting The Extracellular Domain Of Human HER2/neu,” Brit. J. Cancer 77(9): 1405-1412). Still shorter linkers (one or two amino acids) lead to the formation of trimers, so-called triabodies or tribodies. Tetrabodies have also been produced. They exhibit an even higher affinity to their targets than diabodies (Le Gall, F. et al.
  • scFv molecules were isolated from libraries of scFv molecules that had been generated from Tau antibody hybridomas using a combinatorial phage display technology (see, for example, U.S. Patent Nos. 5,565,332; 5,580,717; 5,733,743; 6,265,150; and Winter, G. et al. (1994) "Making Antibodies By Phage Display Technology," Annu. Rev. Immunol. 12.433-455). Numerous phospho-Tau-selective scFv molecules were identified and their reactivity toward Tau confirmed by immunoprecipitation, staining of human and mouse tauopathy tissue as well as affinity assays.
  • the Light Chain Variable Domain of antibody 6B2G12 has the amino acid sequence (SEQ ID NO:8) (CDRs are underlined):
  • the Heavy Chain Variable Domain of antibody 6B2G12 has the amino acid sequence (SEQ ID NO:9) (CDRs are underlined):
  • This antibody was used to form the scFv molecule: scFv235.
  • the Light Chain Variable Domain of scFv235 has the amino acid sequence (SEQ ID NO: 10) (CDRs are underlined and the difference from the parental antibody is shown in italics):
  • the Heavy Chain Variable Domain of scFv235 has the amino acid sequence (SEQ ID NO:ll) (CDRs are underlined):
  • the Light Chain Variable Domain CDR1 of scFv235 and antibody 6B2G12 both have the amino acid sequence (SEQ ID NO:12): KSSQSLLYSNGKTYLN.
  • the Light Chain Variable Domain CDR2 of scFv235 and antibody 6B2G12 both have the amino acid sequence (SEQ ID NO:13): LVSKLDS.
  • the Light Chain Variable Domain CDR3 of scFv235 and antibody 6B2G12 both have the amino acid sequence (SEQ ID NO:14): VQGTHSPLT.
  • the Heavy Chain Variable Domain CDR1 of scFv235 and antibody 6B2G12 both have the amino acid sequence (SEQ ID NO:15): EYTFTEYTKH.
  • the Heavy Chain Variable Domain CDR2 of scFv235 and antibody 6B2G12 both have the amino acid sequence (SEQ ID NO:16): SINPNNGDTYYNQKFTD.
  • the Heavy Chain Variable Domain CDR3 of scFv235 and antibody 6B2G12 both have the amino acid sequence (SEQ ID NO: 17): GDSAWFAY.
  • amino acid residues 1-114 are the amino acid residues of the Light Chain Variable Domain of scFv235 (SEQ ID NO: 10)
  • amino acid residues 115-132 are the amino acid residues of the linker (SEQ ID NO:4)
  • amino acid residues 133-249 are the amino acid residues of the Heavy Chain Variable Domain of scFv235 (SEQ ID NO: 11).
  • scFv235 is prepared as a fusion protein that includes an N-terminal leader peptide portion having the amino acid sequence (SEQ ID NO: 19): IQEEFKMKKTAIAIAVALAGFATVAQAA, and/or a C-terminal sequence peptide portion.
  • the C-terminal sequence peptide portion may include: an antibody constant domain, such as (SEQ ID NO:20): AKTTPPSVTSGQAGQ (Hussein, A.H. et al.
  • a preferred C-terminal peptide portion has the amino acid sequence (SEQ ID NO:21): AKTTPPSVTSGQAGQHHHHHHGAYPYDVPDYAS, and thus includes (in the N-terminus to C-Terminus direction) SEQ ID NO:20, SEQ ID NO:5, and SEQ ID NO:6.
  • the scFv235 fusion protein will comprise the amino acid sequence of any of SEQ ID Nos:22-26 (in which the N-terminal and/or C- Terminal peptide portions of the ScFv fusion are underlined):
  • SEQ ID NO:22 (a fusion of SEQ ID NOs: 19 and 18):
  • SEQ ID NO:23 (a fusion of SEQ ID NOs: 18 and 20):
  • SEQ ID NO:24 (a fusion of SEQ ID NOs: 18 and 21):
  • SEQ ID NO:25 (a fusion of SEQ ID NOs: 19, 18 and 20):
  • SEQ ID NO:26 (a fusion of SEQ ID NOs: 19, 18 and 21):
  • a limited set of proteins and peptides are transported across the blood-brain barrier via receptor-mediated transcytosis (Herve, F. et al. (2008) “CNS Delivery Via Adsorptive Transcytosis " AAPS J. 10(3):455-472), the three best-studied ligands being insulin, iron-transferrin and LDL-cholesterol (Bickel, U. et al. (2001) "Delivery Of Peptides And Proteins Through The Blood-Brain Barrier " Adv. Drug Deliv. Rev. 46:247-279; Tuma, P.L. et al. (2003) “Transcytosis: Crossing Cellular Barriers " Physiol. Rev. 83:871-932).
  • transport of an scFv across the blood-brain barrier can be promoted by fusing the scFv to an antibody, or an epitope-binding fragment thereof, that is immunospecific for a receptor of such ligands ⁇ e.g., the human insulin receptor (HIR), the transferrin receptor (TfR), low density lipoprotein receptor-related proteins 1 (LRPl) and 2 (LRP2), non-toxic diphtheria toxin receptor/ Heparin binding epidermal growth factor-like growth factor, etc).
  • HIR human insulin receptor
  • TfR transferrin receptor
  • LRPl low density lipoprotein receptor-related proteins 1
  • LRP2 low density lipoprotein receptor-related proteins
  • non-toxic diphtheria toxin receptor/ Heparin binding epidermal growth factor-like growth factor etc.
  • the scFv may be augmented to contain a polycationic peptide that facilitates adsorptive-mediated transcytosis.
  • Suitable polycationic peptides include hexamethylene- diamine, putrescine, spermidine and spermine (Herve, F. et al. (2008) “CNS Delivery Via Adsorptive Transcytosis " AAPS J. 10(3):455-472; Kandimalla, K.K. et al. (2006) "Physiological And Biophysical Factors That Influence Alzheimer 's Disease Amyloid Plaque Targeting Of Native And Putrescine Modified Human Amyloid Beta40," J. Pharmacol. Exp. Ther. 318: 17-25).
  • the scFv may be augmented to comprise polycationic groups via treatment that amidates some or all of its carboxylic groups (i.e., the carboxy-terminal group, or the carboxylic side chains of glutamate or aspartate residue(s) of the scFv).
  • the scFv may be augmented to contain a cell-penetrating peptide ("CPP")
  • CPP cell-penetrating peptide
  • Such peptides include the HIV-1 trans-activating transcriptional activator (TAT) peptide, the Herpes Simplex Virus type-1 transcription factor (HSV VP -22) peptide, antennapedia and penetratin (Wadia, J.S. et al. (2004) “Transducible TAT-HA Fusogenic Peptide Enhances Escape Of TAT-Fusion Proteins After Lipid Raft Macropinocytosis," Nat. Med. 10:310-315; Richard, J.P. et al. (2003) “Cell-Penetrating Peptides. A Reevaluation Of The Mechanism Of Cellular Uptake,” J. Biol. Chem. 278:585-590; Temsamani, J. et al. (2004) “The Use Of Cell-Penetrating Peptides For Drug Delivery,” Drug Discov. Today 9: 1012-1019).
  • TAT HIV-1 trans-activating transcriptional activator
  • HSV VP -22 Herpes Simplex Virus type-1 transcription factor
  • the present invention relates to the use of Tau-immunospecific, phospho-Tau- selective, antibodies or Tau-immunospecific, phospho-Tau-selective binding fragments thereof to diagnose and/or treat Alzheimer's disease or tauopathy in a subject patient.
  • diagnostic utility such uses may involve detecting, in the subject (i.e., in vivo), the presence of a pathological Tau conformer using the 6B2G12 antibody of the present invention, or an epitope-binding fragment thereof (especially scFv235), that has preferably been detectably labeled (such molecules being collectively referred to herein as the diagnostic molecules of the present invention).
  • a pathological Tau conformer ex vivo e.g., in a biopsy sample, or post-mortem
  • such Tau-immunospecific, phospho-Tau-selective, antibodies or Tau-immunospecific, phospho-Tau-selective binding fragments may be humanized antibodies.
  • such uses may involve the administration of a therapeutically effective amount of the 6B2G12 antibody of the present invention, or of an epitope-binding fragment thereof (especially scFv235) to a patient having one or more symptoms of Alzheimer's disease or such tauopathy, and thus in need of such therapy, or it may involve the administration of a prophylactically effective amounts of the 6B2G12 antibody of the present invention, or of an epitope-binding fragment thereof (especially scFv235) to a patient not exhibiting such symptoms, or exhibiting symptoms of mild dementia or pre-tauopathy that is indicative of incipient Alzheimer's disease or tauopathy, such molecules being collectively referred to herein as the therapeutic molecules of the present invention.
  • scFv235 has specificity for P- Ser 396/404, however, scFv molecules having specificity for other Tau peptide(s), for example, those described in US 2008/0050383, may be used in concert with scFv235.
  • tauopathy encompasses any neurodegenerative disease that involves the pathological aggregation of the microtubule protein Tau within the brain. Accordingly, in addition to both familial and sporadic Alzheimer's disease, the tauopathies of the present invention include, without limitation, frontotemporal dementia, parkinsonism linked to chromosome 17 (FTDP-17), progressive supranuclear palsy, corticobasal degeneration, Pick's disease, progressive subcortical gliosis, tangle only dementia, diffuse neurofibrillary tangles with calcification, argyrophilic grain dementia, amyotrophic lateral sclerosis parkinsonism-dementia complex, dementia pugilistica, Down syndrome, Gerstmann-Straussler-Scheinker disease, Hallerworden-Spatz disease, inclusion body myositis, Creutzfeld- Jakob disease, multiple system atropy, Niemann-Pick disease type C, pri
  • the Tau-binding molecules of the present invention are preferably produced via the recombinant expression of a nucleic acid molecule that encodes their constituent polypeptide chain(s).
  • the invention thus accordingly also relates to an expression vector encoding such one or more polypeptide chains of an antibody of the invention or a fragment thereof.
  • An expression vector in the context of the present invention may be any suitable DNA or RNA vector, including chromosomal, non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid sequence comprising a suitable set of expression control elements).
  • suitable DNA or RNA vector including chromosomal, non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid sequence comprising a suitable set of expression control elements).
  • examples of such vectors include derivatives of SV40, bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral nucleic acid (RNA or DNA) vectors.
  • an anti-Tau antibody- encoding nucleic acid is comprised in a naked DNA or RNA vector, including, for example, a linear expression element (as described in, for instance, Sykes and Johnston, Nat Biotech 12, 355-59 (1997)), a compacted nucleic acid vector (as described in for instance US 6,077,835 and/or WO 00/70087), a plasmid vector such as pBR322, pUC 19/18, or pUC 118/119, a "midge" minimally-sized nucleic acid vector (as described in, for instance, Schakowski et al, Mol Ther 3, 793-800 (2001)), or as a precipitated nucleic acid vector construct, such as a CaP04 -precipitated construct (as described in, for instance, WO 00/46147, Benvenisty and Reshef, PNAS USA 83, 9551-55 (1986), Wigler et al, Cell 14, 725 (1978), and
  • the vector is suitable for expression of an anti-Tau antibody or a Tau-binding fragment thereof in a bacterial cell.
  • expression vectors such as BlueScript (Stratagene), pIN vectors (Van Heeke & Schuster, J Biol Chem 264, 5503-5509 (1989), pET vectors (Novagen, Madison, WI) and the like).
  • An expression vector may also or alternatively be a vector suitable for expression in a yeast system. Any vector suitable for expression in a yeast system may be employed. Suitable vectors include, for example, vectors comprising constitutive or inducible promoters such as alpha factor, alcohol oxidase and PGH (reviewed in: F. Ausubel et al, ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley InterScience New York (1987), and Grant et al, Methods in Enzymol 153, 516-544 (1987)).
  • constitutive or inducible promoters such as alpha factor, alcohol oxidase and PGH
  • an anti-Tau antibody-encoding nucleic acid molecule may comprise or be associated with any suitable promoter, enhancer, and other expression- facilitating elements.
  • suitable promoter, enhancer, and other expression- facilitating elements include strong expression promoters (e.g., human CMV IE promoter/enhancer as well as RSV, SV40, SL3-3, MMTV, and HIV LTR promoters), effective poly (A) termination sequences, an origin of replication for plasmid product in E. coli, an antibiotic resistance gene as selectable marker, and/or a convenient cloning site (e.g., a polylinker).
  • Nucleic acids may also comprise an inducible promoter as opposed to a constitutive promoter such as CMV IE (the skilled artisan will recognize that such terms are actually descriptors of a degree of gene expression under certain conditions).
  • the invention relates to a recombinant eukaryotic or prokaryotic host cell, such as a transfectoma, which produces an antibody of the invention as defined herein or a bispecific molecule of the invention as defined herein.
  • host cells include yeast, bacteria, and mammalian cells, such as CHO or HEK cells.
  • the present invention provides a cell comprising a nucleic acid stably integrated into the cellular genome that comprises a sequence coding for expression of an anti-Tau antibody of the present invention or a Tau-binding fragment thereof.
  • the present invention provides a cell comprising a non-integrated nucleic acid, such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of an anti-Tau antibody of the present invention, or such fragment thereof.
  • a non-integrated nucleic acid such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of an anti-Tau antibody of the present invention, or such fragment thereof.
  • the invention relates to a method for producing an anti-Tau antibody of the present invention, said method comprising the steps of a) culturing a hybridoma or a host cell of the invention as described herein above, and b) purifying the antibody of the invention from the culture media.
  • the produced anti-Tau antibodies and Tau-binding fragments thereof may be modified by inclusion of any suitable number of modified amino acids and/or associations with such conjugated substituents.
  • Suitability in this context is generally determined by the ability to at least substantially retain anti-Tau selectivity and/or the anti- Tau specificity associated with the non-derivatized parent anti-Tau antibody.
  • the inclusion of one or more modified amino acids may be advantageous in, for example, increasing polypeptide serum half-life, reducing polypeptide antigenicity, or increasing polypeptide storage stability.
  • Amino acid(s) are modified, for example, co-translationally or post- translationally during recombinant production (e.g., N-linked glycosylation at N-X-S/T motifs during expression in mammalian cells) or modified by synthetic means.
  • Non- limiting examples of a modified amino acid include a glycosylated amino acid, a sulfated amino acid, a prenylated (e.
  • the modified amino acid may, for instance, be selected from a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, or an amino acid conjugated to an organic derivatizing agent.
  • such molecules may be formed to comprise carbohydrate moieties, such as polyoxyethylated polyols or polyethylene glycol (PEG) ⁇ e.g., a PEG with a molecular weight of between about 1,000 and about 40,000, such as between about 2,000 and about 20,000, e.g., about 3,000-12,000 g/mol)
  • PEG polyethylene glycol
  • the Tau-binding molecules of the present invention are often administered as pharmaceutical compositions comprising an active therapeutic agent and a variety of other pharmaceutically acceptable components. See REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY (21 st Edition) (2005) (Troy, D.B. et al. (Eds.) Lippincott Williams & Wilkins (Pubis.), Baltimore MD), which is hereby incorporated by reference in its entirety. The preferred form depends on the intended mode of administration and therapeutic application.
  • compositions can also include, depending on the formulation desired, pharmaceutically acceptable, non-toxic carriers, excipients, diluents, fillers, salts, buffers, detergents (e.g., a nonionic detergent, such as Tween-20 or Tween- 80), stabilizers (e.g., sugars or protein-free amino acids), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition, and which are vehicles commonly used to formulate pharmaceutical compositions for animal or human administration.
  • the diluent is selected to not to affect the biological activity of the combination.
  • compositions or formulation may also include other carriers, or non-toxic, nontherapeutic, non-immunogenic stabilizers and the like.
  • aqueous and nonaqueous carriers examples include water, saline, phosphate buffered saline, ethanol, dextrose, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, corn oil, peanut oil, cottonseed oil, and sesame oil, carboxymethyl cellulose colloidal solutions, tragacanth gum and injectable organic esters, such as ethyl oleate, and/or various buffers.
  • Other carriers are well known in the pharmaceutical arts.
  • Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the present invention is contemplated.
  • compositions may also include large, slowly metabolized macromolecules, such as proteins, polysaccharides like chitosan, polylactic acids, polyglycolic acids and copolymers (e.g., latex functionalized sepharose, agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (e.g., oil droplets or liposomes).
  • Suitability for carriers and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen compound or pharmaceutical composition of the present invention (e.g., less than a substantial impact (10% or less relative inhibition, 5% or less relative inhibition, etc.)) on antigen binding.
  • compositions of the present invention may also comprise pharmaceutically acceptable antioxidants for instance (1) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha- tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethyl enediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
  • water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
  • oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), but
  • compositions of the present invention may also comprise isotonicity agents, such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
  • isotonicity agents such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
  • compositions of the present invention may also contain one or more adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
  • adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
  • the compounds of the present invention may be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems.
  • Such carriers may include gelatin, glyceryl monostearate, glyceryl distearate, biodegradable, biocompatible polymers such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid alone or with a wax, or other materials well known in the art. Methods for the preparation of such formulations are generally known to those skilled in the art. See, e.g., Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978.
  • the compounds of the present invention may be formulated to ensure proper distribution in vivo.
  • Pharmaceutically acceptable carriers for parenteral administration include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the present invention is contemplated. Supplementary active compounds may also be incorporated into the compositions.
  • compositions for injection must typically be sterile and stable under the conditions of manufacture and storage.
  • the composition may be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
  • the carrier may be a aqueous or nonaqueous solvent or dispersion medium containing for instance water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
  • the proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • a coating such as lecithin
  • surfactants it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as glycerol, mannitol, sorbitol, or sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions may be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
  • Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients e.g.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above.
  • sterile powders for the preparation of sterile injectable solutions examples of methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
  • dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • examples of methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • agents of the present invention are typically formulated as injectable dosages of a solution or suspension of the substance in a physiologically acceptable diluent with a pharmaceutical carrier that can be a sterile liquid such as water, oil, saline, glycerol, or ethanol.
  • a pharmaceutical carrier that can be a sterile liquid such as water, oil, saline, glycerol, or ethanol.
  • auxiliary substances such as wetting or emulsifying agents, surfactants, pH buffering substances and the like can be present in compositions.
  • Other components of pharmaceutical compositions are those of petroleum, animal, vegetable, or synthetic origin. Peanut oil, soybean oil, and mineral oil are all examples of useful materials.
  • glycols such as propylene glycol or polyethylene glycol, are preferred liquid carriers, particularly for injectable solutions.
  • Agents of the invention can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained release of the active ingredient.
  • An exemplary composition comprises scFv235 at about 5 mg/mL, formulated in aqueous buffer consisting of 50 mM L-histidine, 150 mM NaCl, adjusted to pH 6.0 with HC1.
  • compositions are thus prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared.
  • the preparation also can be emulsified or encapsulated in liposomes or micro particles, such as polylactide, polyglycolide, or copolymer, for enhanced adjuvant effect (Langer, et al., Science 249: 1527 (1990); Hanes, et al., Advanced Drug Delivery Reviews 28:97-119 (1997), which are hereby incorporated by reference in their entirety).
  • Additional formulations suitable for other modes of administration include oral, intranasal, and pulmonary formulations, suppositories, and transdermal applications.
  • the molecules of the present invention can be administered by parenteral, topical, oral or intranasal means for prophylactic and/or therapeutic treatment.
  • Intramuscular injection for example, into the arm or leg muscles
  • intravenous infusion are preferred methods of administration of the molecules of the present invention.
  • such molecules are administered as a sustained release composition or device, such as a MedipadTM device (Elan Pharm. Technologies, Dublin, Ireland).
  • the molecules of the present invention are injected directly into a particular tissue where deposits have accumulated, for example intracranial injection.
  • a pharmaceutical composition of the present invention is administered parenterally.
  • parenteral administration and “administered parenterally” as used herein denote modes of administration other than enteral and topical administration, usually by injection, and include epidermal, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intracranial, intraorbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoracic, epidural and intrasternal injection, subcutaneous and infusion.
  • pharmaceutical composition is administered by intravenous or subcutaneous injection or infusion.
  • compositions or medicaments are administered to a patient susceptible to, or otherwise at risk of, Alzheimer's disease in an amount sufficient to eliminate or reduce the risk, lessen the severity, or delay the outset of the disease, including biochemical, histologic and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presented during development of the disease.
  • the therapeutic molecules of the present invention are administered to such patient in an amount sufficient to cure, treat, or at least partially arrest, the symptoms of the disease (as adduced by biochemical, histologic and/or behavioral assessment), including its complications and intermediate pathological phenotypes in development of the disease.
  • the administration of the therapeutic molecules of the present invention reduces or eliminates mild cognitive impairment in patients that have not yet developed characteristic Alzheimer's pathology.
  • Effective doses of the provided therapeutic molecules of the present invention, for the treatment of the above-described conditions may vary depending upon many different factors, including means of administration, target site, physiological state of the patient, other medications administered, and whether treatment is prophylactic or therapeutic. Treatment dosages are typically titrated to optimize their safety and efficacy. On any given day that a dosage is given, the dosage may range from about 0.0001 to about 100 mg/kg, and more usually from about 0.01 to about 5 mg/kg, of the host body weight. For example, dosages can be 1 mg/kg body weight or 10 mg/kg body weight or within the range of 1-10 mg/kg body weight.
  • Exemplary dosages thus include: from about 0.1 to about 10 mg/kg/body weight, from about 0.1 to about 5 mg/kg/body weight, from about 0.1 to about 2 mg/kg/body weight, from about 0.1 to about 1 mg/kg/body weight, for instance about 0.15 mg/kg/body weight, about 0.2 mg/kg/body weight, about 0.5 mg/kg/body weight, about 1 mg/kg/body weight, about 1.5 mg/kg/body weight, about 2 mg/kg/body weight, about 5 mg/kg/body weight, or about 10 mg/kg/body weight
  • a physician or veterinarian having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required.
  • the physician or veterinarian could start doses of the anti-Tau antibody or fragment employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
  • a suitable daily dose of a composition of the present invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect.
  • Such an effective dose will generally depend upon the factors described above.
  • Administration may e.g. be intravenous, intramuscular, intraperitoneal, or subcutaneous, and for instance administered proximal to the site of the target.
  • the effective daily dose of a pharmaceutical composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms. While it is possible for a compound of the present invention to be administered alone, it is preferable to administer the compound as a pharmaceutical composition as described above.
  • An exemplary treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months.
  • one, two or more antibodies (or epitope-binding fragments thereof) will be administered in conjunction with the administration of the therapeutic molecules of the present invention, in which case the dosage of each such administered molecule falls within the ranges indicated.
  • the dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic.
  • a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
  • a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the patient shows partial or complete amelioration of symptoms of disease. Thereafter, the patent can be administered such therapeutic molecule using a prophylactic dosage regime.
  • the molecules of the present invention are usually administered on multiple occasions. Intervals between single dosages (e.g., a bolus or infusion) can be weekly, monthly, or yearly. In some methods, dosage is adjusted to achieve a plasma concentration of 1-1000 ⁇ g/ml and in some methods 25-300 ⁇ g/ml. Alternatively, the therapeutic molecules of the present invention can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the patient. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. scFv molecules generally have short serum half-lives.
  • Another aspect of the present invention is a combination therapy wherein an additional antibody, or an epitope-binding fragment thereof, recognizing the Tau protein, or an immunogenic epitope thereof, is administered in combination with a therapeutic molecule of the present invention.
  • an additional antibody, or an epitope-binding fragment thereof, recognizing the Tau protein, or an immunogenic epitope thereof is administered in combination with a therapeutic molecule of the present invention.
  • amyloidogenic diseases such as, Alzheimer's disease and Down's syndrome
  • immune modulation to clear amyloid-beta ( ⁇ ) deposits is an emerging therapy.
  • Immunotherapies targeting ⁇ have consistently resulted in cognitive improvements. It is likely that Tau and ⁇ pathologies are synergistic. Therefore, a combination therapy targeting the clearance of both pathologies at the same time may be more effective than targeting each individually.
  • a combination therapy which targets the clearance of both Tau and a-synuclein proteins simultaneously may be more effective than targeting each individually.
  • Detecting the presence of a pathological Tau conformer in a subject using a diagnostic molecule of the present invention can be achieved by obtaining a biological sample from the subject (e.g., blood, urine, cerebral spinal fluid), contacting the biological sample with said diagnostic antibody, and detecting binding of the diagnostic molecule to a pathological Tau protein conformer in the sample from the subject.
  • a biological sample from the subject e.g., blood, urine, cerebral spinal fluid
  • Assays for carrying out the detection of a pathological Tau protein in a biological sample that may be readily adapted to the detection of the diagnostic molecules of the present invention are well known in the art and include, without limitation, ELISA, immunohistochemistry, Western blot.
  • detecting the presence of a pathological Tau protein conformer in a subject using a diagnostic molecule of the present invention can be achieved using in vivo imaging techniques.
  • In vivo imaging involves administering to the subject the diagnostic antibody having antigenic specificity for a pathological Tau peptide and detecting binding of the diagnostic antibody reagent to the pathological Tau protein conformer in vivo.
  • the diagnostic molecules of the present invention can be administered by injection ⁇ e.g., intravenous injection, intracarotid injection, etc.) into the body of the patient, or directly into the brain by intracranial injection.
  • the dosage of such molecule should be from about 0.0001 mg/kg to about 100 mg/kg, and more usually from about 0.01 mg/kg to about 5 mg/kg, of the host body weight.
  • dosages can be about 1 mg/kg body weight or about 10 mg/kg body weight or within the range of about 1-10 mg/kg.
  • the diagnostic molecules of the present invention is labeled, although in some methods, the molecule may be unlabeled and a secondary labeling agent is used to bind to such molecule (coupled or conjugated either directly to the molecule or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art).
  • a secondary labeling agent is used to bind to such molecule (coupled or conjugated either directly to the molecule or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art).
  • the choice of label depends on the means of detection.
  • a fluorescent label such as a rare earth chelate ⁇ e.g., a europium chelate
  • a fluorescein-type label ⁇ e.g., fluorescein, fluorescein isothiocyanate, 5-carboxyfluorescein, 6-carboxy fluorescein, dichlorotriazinylamine fluorescein
  • a rhodamine-type label ⁇ e.g., ALEXA FLUOR® 568 (Invitrogen), TAMRA® or dansyl chloride), VIVOTAG 680 XL FLUOROCHROMETM (Perkin Elmer), phycoerythrin; umbelliferone, Lissamine; a cyanine; a phycoerythrin, Texas Red, BODIPY FL-SE® (Invitrogen) or an analogue thereof, is suitable for optical detection.
  • ALEXA FLUOR® 568 Invitrogen
  • Chemoluminescent labels may be employed ⁇ e.g., luminol, luciferase, luciferin, and aequorin). Such diagnosis and detection can also be accomplished by coupling the diagnostic molecule of the present invention to detectable substances including, but not limited to, various enzymes, enzymes including, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase, or to prosthetic group complexes such as, but not limited to, streptavidin/biotin and avidin/biotin.
  • Radiolabels include, but are not limited to, bismuth ( 213 Bi), carbon ( n C, 13 C, 14 C), chromium ( 51 Cr), cobalt ( 57 Co, 60 Co), copper ( 64 Cu), dysprosium ( 165 Dy), erbium ( 169 Er), fluorine ( 18 F), gadolinium ( 153 Gd, 159 Gd), gallium ( 68 Ga, 67 Ga), germanium ( 68 Ge), gold ( 198 Au), holmium ( 166 Ho), hydrogen ( 3 H), indium ( lu In, 112 In, 113 In, 115 In), iodine ( 121 I, 123 I, 125 I, 131 I), iridium ( 192 Ir), iron ( 59 Fe), krypton ( 81m Kr), lanthane ( 213 Bi), carbon ( n C, 13 C, 14 C), chromium ( 51 Cr), cobalt ( 57 Co, 60 Co), copper ( 64 Cu), dysprosium (
  • radiolabeled amino acids and related peptide derivatives are known in the art (see for instance Junghans et al., in Cancer Chemotherapy and Biotherapy 655-686 (2nd edition, Chafner and Longo, eds., Lippincott Raven (1996)) and US Patents No. 4,681,581; 4,735,210; 5,101,827; 5,102,990; RE 35,500; 5,648,471 and 5,697,902.
  • a radioisotope may be conjugated by a chloramine T method (Lindegren, S. et al.
  • Diagnosis is performed by comparing the number, size, and/or intensity of labeled pathological Tau conformers, Tau aggregates, and/or neurofibrillary tangles in a sample from the subject or in the subject, to corresponding baseline values.
  • the base line values can represent the mean levels in a population of non-diseased individuals. Baseline values can also represent previous levels determined in the same subject.
  • the diagnostic methods described above can also be used to monitor a subject's response to therapy.
  • detecting the presence of pathological Tau in a subject is determined prior to the commencement of treatment.
  • the level of pathological Tau in the subject at this time point is used as a baseline value.
  • the detection of pathological Tau protein conformers, Tau aggregates, and/or neurofibrillary tangles is repeated, and the measured values thereafter compared with the baseline values.
  • a decrease in values relative to baseline signals a positive response to treatment. Values can also increase temporarily in biological fluids as pathological Tau is being cleared from the brain.
  • kits for performing the above- described diagnostic and monitoring methods.
  • kits contain the diagnostic antibody of the present invention.
  • the kit can also include a detectable label.
  • the diagnostic antibody itself may contain the detectable label (e.g., fluorescent molecule, biotin, etc.) which is directly detectable or detectable via a secondary reaction (e.g., reaction with streptavidin).
  • a second reagent containing the detectable label may be utilized, where the second reagent has binding specificity for the primary antibody.
  • the antibodies of the kit may be supplied pre-bound to a solid phase, such as to the wells of a microtiter dish.
  • Such diagnosis comprises: a) administering to a subject an effective amount of such labeled molecule; b) waiting for a time interval following administration in order to allow the labeled molecule to concentrate at sites (if any) of aggregated Tau and to allow unbound labeled molecule to be cleared to a background level; c) determining a background level; and d) detecting such labeled molecule in the subject, such that detection of labeled molecule above the background level is indicative that the subject has a tauopathy, or is indicative of the severity of such tauopathy.
  • the antibody is labeled with an imaging moiety suitable for detection using a particular imaging system known to those skilled in the art.
  • Background levels may be determined by various methods known in the art, including comparing the amount of labeled molecule detected to a standard value previously determined for a particular imaging system.
  • Methods and systems that may be used in the diagnostic methods of the invention include, but are not limited to, computed tomography (CT), whole body scan such as positron emission tomography (PET), magnetic resonance imaging (MRI), and sonography.
  • CT computed tomography
  • PET positron emission tomography
  • MRI magnetic resonance imaging
  • sonography sonography
  • treatment means ameliorating, slowing or reversing the progress or severity of a disease or disorder, or ameliorating, slowing or reversing one or more symptoms or side effects of such disease or disorder.
  • treatment or “treating” further means an approach for obtaining beneficial or desired clinical results, where "beneficial or desired clinical results” include, without limitation, alleviation of a symptom, diminishment of the extent of a disorder or disease, stabilized (i.e., not worsening) disease or disorder state, delay or slowing of the progression a disease or disorder state, amelioration or palliation of a disease or disorder state, and remission of a disease or disorder, whether partial or total, detectable or undetectable.
  • an “effective amount,” when applied to an antibody of the invention, refers to an amount sufficient, at dosages and for periods of time necessary, to achieve an intended biological effect or a desired therapeutic result including, without limitation, clinical results.
  • the phrase "therapeutically effective amount” when applied to an antibody of the invention is intended to denote an amount of the antibody that is sufficient to ameliorate, palliate, stabilize, reverse, slow or delay the progression of a disorder or disease state, or of a symptom of the disorder or disease.
  • the method of the present invention provides for administration of the antibody in combinations with other compounds. In such instances, the "effective amount" is the amount of the combination sufficient to cause the intended biological effect.
  • one aspect of the present invention relates to a method of preventing or treating Alzheimer's disease or other tauopathy in a subject via the administration of an effective amount of antibody 6B2G12 or of an epitope-binding fragment thereof (especially scFv235) to prevent or treat such Alzheimer's disease or other tauopathy.
  • Such administration may be provided in order to promote the clearance of Tau aggregates from the brain of a subject or may be provided in order to slow a tangle-related behavioral phenotype in a subject. Additionally, such administration may be provided prophylactically in order to delay, impede, attenuate or prevent the onset of Alzheimer's disease, or other tauopathy associated with the neurofibrillary tangle.
  • An amount adequate to accomplish therapeutic or prophylactic treatment is defined, respectively, as a therapeutically effective dose or a prophylactically effective dose.
  • agents are usually administered in several dosages until a sufficient immune response has been achieved. Typically, the immune response is monitored and repeated dosages are given if the immune response starts to wane.
  • a therapeutically effective or prophylactically effective dose of such an antibody or epitope-binding fragment thereof may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the molecule to elicit a desired response in the subject.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effect.
  • Patients amenable to treatment include individuals having Alzheimer's disease or such other tauopathy who show clinically recognized symptoms or indications of such conditions, as well as patients not presently showing symptoms of such conditions.
  • Alzheimer's disease is definitively diagnosed only post-mortem biopsy, individuals suffering from Alzheimer's disease are clinically diagnosed using the "Alzheimer's Disease and Related Disorders Association (“ADRDA”) Criteria (Carrillo, M.C. et al. (2013) "Revisiting The Framework Of The National Institute On Aging-Alzheimer's Association Diagnostic Criteria," Alzheimers Dement. 9(5):594-601; Budson, A.E. et al.
  • Such individuals can alternatively be distinguished from those having diseases or conditions that are un-related to Alzheimer's disease or other tauopathy by the presence of correlated risk factors (i.e., one or more factors that have been found to possess greater than 50% coincidence with Alzheimer's disease or such other tauopathy).
  • correlated risk factors include the finding that a patient has had relatives who have experienced Alzheimer's disease or such other tauopathy, or present a family history of hypercholesterolemia or atherosclerosis.
  • Such correlated risk factors particularly include the finding that a patient possesses one or more genetic or biochemical markers that have been correlated with (i.e., found to possess greater than 50% coincidence with) the occurrence of such actual disease.
  • genetic markers of risk toward Alzheimer's disease include correlated mutations in the APP gene, for example, mutations at position 717 and positions 670 and 671 of the APP gene (referred to as the Hardy and Swedish mutations respectively).
  • Other suitable markers of known genetic risk include correlated mutations in the presenilin genes (PS1 and PS2) and in the ApoE4 gene (Bekris, L.M. et al. (2010) “Genetics of Alzheimer Disease “ J. Geriatr. Psychiatry Neurol. 23(4):213-227).
  • PS1 mutations include the substitutions: R35Q; A79V; V82L; L85P; V89L; V94M; V96F; V97L; F105I; F105L; F105V; L113P; L113Q; Y115C; Y115D; Y115H; T116I; T116N; P117A; P117L; P117R; P117S; E120D; E120D; E120G; E120K; E123K; N135D; N135S; A136G; Ml 391; Ml 391; M139K; M139T; M139V; I143F; I143M; I143N; I143T; I143V; M146I; M146I; M146L; M146L; M146V; T147I; L153V; Y154C; Y154N; H163R; H163Y; W165C; W165G; L166H; L166P; L166R; S169
  • Such PS2 mutations include the substitutions: R29H; G34S; R62C; R62H; R71W; A85V; T122P; T122R; S130L; V139M; N141I; L143H; V148I; R163H; M174V; S175C; Y231C; Q228L; M239V; M230I; A252T; P334R; T430M; and D439A.
  • ApoE4 alleles include the ⁇ 4 allele, ⁇ 3 allele and ⁇ 2 allele (Verghese, P.B. et al. (2011) "Apolipoprotein E In Alzheimer's Disease And Other Neurological Disorders," Lancet Neurol. 10(3):241-252).
  • the therapeutic molecules of the present invention can be administered prophylactically to the general population without the need for any assessment of the risk of the subject patient.
  • the present methods are especially useful for the prophylactic treatment of individuals who do have a known genetic risk of Alzheimer's disease.
  • treatment can begin at any age ⁇ e.g., 10, 20, 30). Usually, however, it is not necessary to begin treatment until a patient reaches 40, 50, 60, 70, 80 or 90 years of age. Treatment typically entails the administration of multiple dosages over a period of time. Treatment can be monitored by assaying antibody, or activated T-cell or B-cell responses to the therapeutic agent over time. If the response falls, a booster dosage is indicated.
  • treatment can begin ante-natally by administering the therapeutic agent to the mother during pregnancy or shortly after the patient's birth.
  • the present invention provides:
  • a binding molecule that is capable of immunospecifically binding to phosphorylated Tau with more than 2000 fold greater selectivity than for non-phosphorylated Tau, wherein the molecule is an antibody or an epitope-binding fragment thereof.
  • any of the above-described binding molecules wherein the molecule immunospecifically binds to the Tau 396/404 peptide (SEQ ID NO:7): TDHGAE IVYKSPVVSGDTSPRHL, wherein the serine residues at positions 11 and 19 thereof are phosphorylated.
  • the epitope-binding fragment comprises one or more of:
  • detectably labeled binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label.
  • the detection or measurement comprises in vivo imaging of the binding molecule bound to the phosphorylated Tau protein.
  • the detection or measurement comprises ex vivo imaging of the binding molecule bound to the phosphorylated Tau protein.
  • detectably labeled binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label;
  • detectably labeled binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label, for diagnosing Alzheimer's disease or another tauopathy of a subject.
  • detectably labeled binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label;
  • detectably labeled binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label, for diagnosing Alzheimer's disease or another tauopathy of a subject;
  • the medicament is an in vivo medicament that is administered to the subject.
  • detectably labeled binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label;
  • detectably labeled binding molecules wherein the detectable label is a fluorescent label, a chemoluminescent label, a paramagnetic label, a radioisotopic label or an enzyme label, for diagnosing Alzheimer's disease or another tauopathy of a subject;
  • the medicament is incubated ex vivo with a biopsy sample of the subject.
  • the tauopathy is selected from the group comprising frontotemporal dementia, parkinsonism linked to chromosome 17 (FTDP-17), progressive supranuclear palsy, corticobasal degeneration, Pick's disease, progressive subcortical gliosis, tangle only dementia, diffuse neurofibrillary tangles with calcification, argyrophilic grain dementia, amyotrophic lateral sclerosis parkinsonism-dementia complex, dementia pugilistica, Down syndrome, Gerstmann- Straussler-Scheinker disease, Hallerworden-Spatz disease, inclusion body myositis, Creutzfeld- Jakob disease, multiple system atropy, Niemann-Pick disease type C, prion protein cerebral amyloid angiopathy, subacute sclerosing panencephalitis, myotonic dystrophy, non-gu
  • scFv molecules were generated from hybridoma clone 6B2G12 (raised against P- Ser396/404 of the Tau protein) (Congdon, E.E. et al. (2013) "Antibody Uptake into Neurons Occurs Primarily via Clathrin-dependent Fcgamma Receptor Endocytosis and Is a Prerequisite for Acute Tau Protein Clearance," J. Biol. Chem. 288:35452-35465; Gu, J. et al. (2013) 'Two Novel Tau Antibodies Targeting The 396/404 Region Are Primarily Taken Up By Neurons And Reduce Tau Protein Pathology," J. Biol. Chem. 288(46):33081-33095).
  • the hybridoma cell line 6B2G12 was grown at 37°C with 5% C0 2 in RPMI medium containing streptomycin (50 ⁇ g/ml) and Penicillin G (50 U/ml), and its mRNA was isolated and purified as per the protocol of an RNA isolation kit (Promega), and subsequently stored at -80°C.
  • the first strand cDNA was constructed as per the protocol of a first strand cDNA synthesis kit (Takara kit (TAK6115A)).
  • Clones were screened for their ability to express scFv molecules that were immunospecific for the P-Ser396, 404 Tau epitope using peptides (Keck Foundation, Yale University) having the sequences of Tau-serine 396/404 (SEQ ID NO:27):
  • scFv were produced as described in Barbas, C. F., Ill et al. (2001) "Phage Display: A Laboratory Manual " Cold Spring Harbor Press, Cold spring Harbor, NY. Briefly, scFv235 was produced in competent non-suppressor E. coli cells (Top 10 cells, Invitrogen) in super broth (SB) medium (10 g MOPS, 30 g tryptone, 20 g yeast extract per liter) with 50 ⁇ g/ml of carbenicillin and 20 ml of 1M MgC12 per liter. The culture was induced by adding ImM IPTG (isopropyl-P-D-thiogalactoside) and scFv235 was isolated from the pellet as described in Barbas, C. F., Ill et al. (2001).
  • SB super broth
  • scFv235 showed superior phospho-epitope specificity both when the peptide is coated on ELISA plates ( Figure 2A) as well as in Biacore when the molecule was immobilized and the binding peptides are in solution. Furthermore, scFv235 or its parent antibody, 6B2G12, immunoprecipitated Tau protein in brain homogenates of individuals who had Alzheimer's disease ( Figures 2B-2C), and show partial co-localization staining with pathological Tau on fixed Alzheimer's and Pick's disease brain tissue ( Figure 2D-2E). Significantly, scFv235 detected only full length Tau protein bands, whereas 6B2G12 bound to both full length and degraded Tau fragments.
  • the His-tagged scFv235 was purified using Ni-NTA agarose resin loaded in a gravity column, following the Qiagen kit protocol. The antibody fragment was then dialyzed in PBS and used for further characterization. Phospho-selectivity of the purified scFv was first confirmed in an ELISA assay as described by Asuni, A.A. et al. (2007) "Immunotherapy Targeting Pathological Tau Conformers In A Tangle Mouse Model Reduces Brain Pathology With Associated Functional Improvements " J. Neurosci.
  • scFv235/antibody (10 ⁇ / ⁇ ) was diluted in 10 mM sodium acetate, pH 5.0, and was immobilized on a separate CM5 sensor chip with an amine coupling kit (7 min contact time at 5 ⁇ /min flow rate). Unreacted surface-bound material was blocked with ethanolamine. One channel of each sensor chip, prepared in the same way without scFv235 or antibody, was used to monitor the nonspecific binding of the peptide. All measurements were done with HBS-EP buffer (10 mM HEPES at pH 7.4, 150 mM NaCl, 3.4 mM EDTA and 0.005% surfactant P20) at flow rate of 5 ⁇ /min at 25°C.
  • Antibody 6B2G12 thus has a K a for the non-phosphorylated peptide that is about 3 times lower than its K a for the phosphorylated peptide, and a Ka for the non-phosphorylated peptide that is about double its IQ for the phosphorylated peptide.
  • scFv235 which is derived from this antibody, exhibits a K a for the non- phosphorylated peptide that is about 400 times lower than its K a for the phosphorylated peptide, and a K d for the non-phosphorylated peptide that is about ten times lower than its IQ for the phosphorylated peptide.
  • Dynabeads His-Tag Isolation and Dynabeads Protein G kits were used for immunoprecipitation of Tau in AD brain homogenate (250 ⁇ g) with scFv235 or antibody (10 ⁇ g), with the protocol as per the kit instructions. The pulled down proteins were separated on 10% acrylamide gels, followed by Western blotting. The proteins were transferred from the gels onto nitrocellulose membranes. The membranes were blocked with 5% skimmed milk in PBS for 1 h at room temperature. Then the blot was incubated with 1 : 1000 dilution of CP27 (human specific Tau antibody) or total Tau antibody (Dako), overnight at 4°C.
  • CP27 human specific Tau antibody
  • Dako total Tau antibody
  • the scFv molecules specifically pulled down Tau bands in the range of 50-70 kDa, bound to pathological Tau in AD and Pick's disease brain sections, and had affinity on Biacore toward the phospho-epitope (1.04 x 10 "6 - 6.05 x 10 ⁇ 8 M) and the non-phospho- epitope (4.06 x 10 "3 - 1.86 x 10 ⁇ 8 M).
  • the His-Tag purified scFv235 was labeled using ALEXA® FLUOR 568 protein labeling kit (Molecular Probes, Invitrogen) as per the kit instructions.
  • ALEXA® FLUOR 568 protein labeling kit Molecular Probes, Invitrogen
  • AD Pick's disease and age-matched control brains (National Disease Research Interchange) were stained with the 568-labeled scFv235 using standard procedures.
  • scFv235 was chosen for in vivo imaging in mice.
  • Mice were housed in AAAL AC -approved facilities and received food and water ad libitum. The experiments were performed under an IACUC-approved protocol.
  • Three different transgenic tangle models were used: htau (Andorfer, C. et al. (2003) "Hyperphosphorylation And Aggregation Of Tau In Mice Expressing Normal Human Tau Isoforms " J. Neurochem. 86:582-590); htau/PSl (Boutajangout, A. et al. (2010) "Immunotherapy Targeting Pathological Tau Prevents Cognitive Decline In A New Tangle Mouse Model," J. Neurosci.
  • mice were anesthetized with 2% isoflurane and maintained with 1.5% isoflurane in 30% 02. After exposing the carotid sheath, left common carotid artery (CCA), external carotid artery (ECA), and internal carotid artery (ICA) were exposed via a midline incision.
  • CCA common carotid artery
  • ECA external carotid artery
  • ICA internal carotid artery
  • a silk suture was tied to the distal end of the ECA, and the left CCA, ICA, and pterygopalatine artery were temporarily tied.
  • a 30 gauge needle connected to PE-10 tubing (Becton Dickinson, San Diego, CA) was attached to a 1 ml syringe and 250 ⁇ g of labeled scFv235 in 400-500 ⁇ PBS was then administered into the common carotid artery over a period of 10- 15 min.
  • KRAZY® glue was applied to the site of injection to prevent postoperative bleeding.
  • mice were injected into the femoral vein using the same dose. The medial side of the right thigh was shaved and cleaned with Betadine solution and 70 % ethanol.
  • a small incision (0.5 cm) parallel to the vein was made on the skin of the internal side of the thigh. When the buttonhole of skin opens, the femoral vein is visible.
  • a 30 gauge needle connected to PE-10 tubing was attached to a 1 ml syringe, administered through the needle punctured upward into the femoral vein over a period of 3-5 min manually. Once the needle was removed, the site of the puncture was compressed with a cotton-tipped applicator, in order to avoid bleeding. As soon as the blood flow had ceased, the skin was sutured with 4/0 braided silk thread using single interrupted sutures.
  • mice For IVIS imaging, scFv235 or 6B2G12 was conjugated with VIVOTAG 680 XL FLUOROCHROMETM (Perkin Elmer). The mice were shaved on the head and body to avoid light diffraction caused by the fur. After injection, mice were subjected to imaging, at various intervals as detailed in Figures 3A-3D, in IVIS Lumina XR (Perkin Elmer) using an excitation filter of 675 nm and Cy5.5 emission filter.
  • mice were perfused transaortically with PBS, the brains removed and fixed in 2% PLP overnight, placed in 2% DMSO in 20% glycerol phosphate buffer overnight, then sectioned to detect 680XL-scFv235 signal and to determine scFv subcellular location by co- staining with marker of Tau protein and the endosomal/autophagosomal/lysosomal system.
  • Imaging studies using In vivo Imaging System revealed strong brain signals from transgenic (“tg”) tauopathy mice when near-infrared-dye-labeled-scFv235 was injected into the right carotid artery (250 ⁇ g/450-500 ⁇ ). The signal remained high and relatively stable for at least up to 250-300 min ( Figures 3A-3D).
  • XNPL3 mice Lewis, J. et al. (2000) "Neurofibrillary Tangles, Amyotrophy And Progressive Motor Disturbance In Mice Expressing Mutant (P301L) Tau Protein," Nat. Genet.
  • the scFv235 brain signal peaked at 37 minutes (1443% above pre -injection baseline signal), and remained strong at 65 and 176 minutes post-injection (1144% and 1093%), respectively).
  • the htau/PSl model had less signal than P301L mice, both in brain and periphery. Older mice within each genotype had stronger signal than younger mice which is as expected since those should have more advanced Tau pathology. Minimal signal was observed in wild-type (wt) mice injected with the same probe or in tangle mice that received only the fluorescent dye alone without the scFv.
  • TRE total radiant efficiency
  • mice injected with the scFv showed generally stronger signal than mice injected with the Tau antibody.
  • i.v. intravenous route
  • scFv235 was found to co-localize with pathological Tau within brain neurons following intracarotid injection in P301L (F6) and htau/PSl (A47) tangle mice (Figure 5). Brains were harvested after the last imaging session. Tau aggregates were detected with PHF-1 and Tau-5 antibodies, and show partial co-localization with scFv235. A nuclear- specific stain was used to identify the cell nuclei. Figure 5 also shows that control wild-type mice (Rl) did not have detectable brain uptake of scFv235 after intracarotid injection. Tau-5 stained mainly normal axonal Tau and pathological PHF1 staining was not observed.
  • IVIS Signal Maximum Total Radiant Efficiency
  • IVIS Signal Maximum Total Radiant Efficiency
  • VN142A 0 0 0 0 0 0 0
  • IVIS Signal Maximum Total Radiant Efficiency
  • scFv molecules of a monoclonal Tau antibody were generated using phage display technology. Following extensive characterization, scFv235 was assessed as a diagnostic imaging probe in live tauopathy mice. scFv235 consistently showed strong brain signal after peripheral injection in two tauopathy tangle mouse models but not in wild- type or ⁇ plaque mice. Administration of the parent antibody led to similar results, but at a lesser signal intensity. Both probes co-localized with intraneuronal Tau aggregates and markers of the endosome/autophagosome/lysosome pathways.
  • Tau antibodies and their derivatives administered peripherally can be used to image Tau brain lesions in live animals.
  • the brain signal intensity correlated very well with the extent of the Tau pathology with major implications for experimental and clinical use of this approach. It can be used in this form for non-invasive monitoring of Tau pathology and treatment efficacy in animal models of tauopathy, and such ligands have great potential as clinical PET ligands for the same purpose.
  • the scFv molecule or its parent antibody were detected primarily in neurons, co- localized with pathological Tau proteins in the endosome-autophagosome-lysosome system. This is consistent with the similar distribution of labeled Tau antibodies and their Fab fragments that is observed after the intracarotid injection or administration of such molecules to brain slice cultures derived from tauopathy mice (Gu, J. et al. (2013) "Two Novel Tau Antibodies Targeting The 396/404 Region Are Primarily Taken Up By Neurons And Reduce Tau Protein Pathology " J. Biol Chem. 288:33081-33095; Congdon, E. E. et al.
  • the antibody is about 6 times the size of the scFv (150 kDa vs. 25 kDa) which may result in less brain and neuronal uptake.
  • the injections are both of the same weight (250 ⁇ g), and thus contain 6 times fewer molecules of the antibody compared to the fragment.
  • This initial dose was chosen based on a previous study of brain uptake of tagged polyclonal anti-Tau mouse IgG (Asuni, A.A. et al. (2007) "Immunotherapy Targeting Pathological Tau Conformers In A Tangle Mouse Model Reduces Brain Pathology With Associated Functional Improvements " J. Neurosci. 27:9115-9129).
  • the higher affinity of the antibody for Tau, compared to the scFv may counteract these issues.
  • the weak IVIS brain signal in Tg mice with limited Tau pathology further supports the conclusion that the enhanced signal in the Tg mice is not a mere reflection of Tau overexpression but rather indicates the presence of Tau pathology.
  • JNPL3 (P301L) mice exhibit stronger brain and peripheral signal than htau/PSl mice. Within the brain, this fits with more severe Tau pathology.
  • the greater peripheral signal observed in P301L mice appears in part to be derived from the spinal cord which is known to have extensive Tau lesions in this model (Lewis, J. et al. "Neurofibrillary Tangles, Amyotrophy And Progressive Motor Disturbance In Mice Expressing Mutant (P301L) Tau Protein " Nat. Genet. 25, 402- 405).
  • the prion promoter of its mutated Tau transgene results in more global Tau expression than in the htau/PSl model. This may lead to Tau aggregation in various organs.
  • IVIS imaging is more cost-effective than positron emission tomography (PET) studies and involves a much simpler probe preparation; its labeling with a near infrared dye instead of more complicated radiolabeling procedure, which may require an on- site cyclotron.
  • PET positron emission tomography
  • IVIS imaging is ideal for probe development to select ligands for subsequent PET studies.
  • Such studies further indicate that it is an efficient way to monitor the development of Tau pathology and to screen for Tau therapy-mediated clearance of Tau aggregates, with each animal serving as its own control during longitudinal studies.
  • Tau s antibody-derived probes e.g., scFv235
  • This information is envisaged to be able to guide the treatment regimen, which may include active or passive Tau immunotherapy targeting the same Tau epitopes that were detected with imaging.
  • Such a tailored approach is likely to be more efficacious to slow the progression of the tauopathy that is being targeted (see, e.g., Gu, J. et al.
  • scFv single-chain variable antibody fragment
  • the intensity of the imaging signal correlated well with the degree of tau pathology and the co-localization of the probe with intraneuronal tau aggregates. Both attributes were associated with markers of endosomes, autophagosomes and lysosomes, indicating their interaction in these degradation pathways.
  • nM to pM affinity led to an approximately 2-3 fold stronger signal than: (1) the signal provided by a lower affinity (nM to ⁇ ), but more phospho-selective antibody that immunospecifically binds to the same p396,404 epitope; (2) the signal provided by a high affinity (nM) antibody that immunospecifically binds to an epitope that is distinct from the p396,404 epitope; or (3) the signal provided by a low affinity antibody that immunospecifically binds to a conformational tau epitope. These differences likely reflect both the relative prominence of these tau antibody epitopes in these animals and the affinities of the antibodies.
  • tau antibodies against different epitopes can be used to assess epitope prominence in vivo in mouse models.
  • Smaller antibody fragments of such imaging probes with even better brain penetration resulting in a stronger brain signal (such as scFv235) have great potential as clinical imaging ligands.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Molecular Biology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Cell Biology (AREA)
  • Food Science & Technology (AREA)
  • Genetics & Genomics (AREA)
  • Pathology (AREA)
  • General Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • Biophysics (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Psychology (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
PCT/US2015/039205 2014-07-08 2015-07-06 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy Ceased WO2016007414A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CN201580047108.9A CN107073297B (zh) 2014-07-08 2015-07-06 Tau显像配体和其在Tau蛋白病的诊断和治疗中的用途
JP2017500891A JP6913018B2 (ja) 2014-07-08 2015-07-06 タウイメージングリガンド、ならびにタウ異常症の診断および治療におけるそれらの使用
EP15818480.4A EP3166688B1 (en) 2014-07-08 2015-07-06 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy
US15/324,141 US10132818B2 (en) 2014-07-08 2015-07-06 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy
ES15818480T ES2985805T3 (es) 2014-07-08 2015-07-06 Ligandos de formación de imágenes de TAU y sus usos en el diagnóstico y el tratamiento de tauopatías
US16/151,555 US10859582B2 (en) 2014-07-08 2018-10-04 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy
US17/073,871 US11519920B2 (en) 2014-07-08 2020-10-19 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201462021897P 2014-07-08 2014-07-08
US62/021,897 2014-07-08

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/324,141 A-371-Of-International US10132818B2 (en) 2014-07-08 2015-07-06 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy
US16/151,555 Continuation US10859582B2 (en) 2014-07-08 2018-10-04 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy

Publications (1)

Publication Number Publication Date
WO2016007414A1 true WO2016007414A1 (en) 2016-01-14

Family

ID=55064732

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/039205 Ceased WO2016007414A1 (en) 2014-07-08 2015-07-06 Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy

Country Status (6)

Country Link
US (3) US10132818B2 (https=)
EP (1) EP3166688B1 (https=)
JP (1) JP6913018B2 (https=)
CN (1) CN107073297B (https=)
ES (1) ES2985805T3 (https=)
WO (1) WO2016007414A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018049219A1 (en) * 2016-09-08 2018-03-15 Regenerative Research Foundation Bi-functional anti-tau polypeptides and use thereof
WO2018127519A1 (en) * 2017-01-04 2018-07-12 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau for the treatment of ocular diseases
EP3334761A4 (en) * 2015-08-13 2019-04-24 New York University ANTIBODY BASED FOR THE {P} SER404 EPITOP OF TAU SELECTIVE MOLECULES AND THEIR USES IN THE DIAGNOSIS AND TREATMENT OF TAUOPATHY
US10562962B2 (en) 2015-07-13 2020-02-18 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau and methods of use thereof
US11111290B2 (en) 2016-07-12 2021-09-07 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau and methods of use thereof
US11370832B2 (en) 2017-02-17 2022-06-28 Denali Therapeutics Inc. Anti-Tau antibodies and methods of use thereof

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3334453A4 (en) 2015-08-13 2019-02-06 New York University ANTIBODY-BASED SPECIFIC MOLECULES AND THEIR USES IN THE DIAGNOSIS AND TREATMENT OF TAUOPATHY, FOR TAU'S SPECIFIC ASP421 EPITOP
US10364286B2 (en) * 2016-12-22 2019-07-30 H. Lundbeck A/S Monoclonal anti-alpha-synuclein antibodies for preventing tau aggregation
AU2018308088B2 (en) 2017-07-25 2025-05-29 Truebinding, Inc. Treating cancer by blocking the interaction of TIM-3 and its ligand
CN109406469B (zh) * 2018-10-24 2021-04-09 中国医科大学 基于蛋白结合诱导dna双链变构的检测色氨酸的方法
WO2020123492A1 (en) * 2018-12-10 2020-06-18 New York University Monoclonal antibodies targeting c-terminal region of phosphorylated tau
AU2020214796A1 (en) 2019-01-30 2021-07-29 Truebinding, Inc. Anti-Gal3 antibodies and uses thereof
JP7702381B2 (ja) * 2019-07-08 2025-07-03 アルゼカ バイオサイエンシズ、エルエルシー タウ病理のためのターゲティングリガンド
CA3152239A1 (en) * 2019-09-23 2021-04-01 Lars Ittner Treatment of tauopathies
WO2021242776A2 (en) 2020-05-26 2021-12-02 Truebinding, Inc. Methods of treating inflammatory diseases by blocking galectin-3
US20240025959A1 (en) * 2020-08-24 2024-01-25 University Of Southern California Beclin 2 and uses thereof for treating cancer and neurodegenerative diseases

Citations (49)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4495285A (en) 1981-10-30 1985-01-22 Kimihiro Shimizu Plasminogen activator derivatives
US4609546A (en) 1982-06-24 1986-09-02 Japan Chemical Research Co., Ltd. Long-acting composition
US4681581A (en) 1983-12-05 1987-07-21 Coates Fredrica V Adjustable size diaper and folding method therefor
US4735210A (en) 1985-07-05 1988-04-05 Immunomedics, Inc. Lymphographic and organ imaging method and kit
US4766106A (en) 1985-06-26 1988-08-23 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polymer conjugation
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5101827A (en) 1985-07-05 1992-04-07 Immunomedics, Inc. Lymphographic and organ imaging method and kit
US5102990A (en) 1989-08-09 1992-04-07 Rhomed Incorporated Direct radiolabeling of antibodies and other proteins with technetium or rhenium
WO1992022645A1 (en) 1991-06-14 1992-12-23 Genpharm International, Inc. Transgenic immunodeficient non-human animals
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
WO1994025585A1 (en) 1993-04-26 1994-11-10 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5580717A (en) 1990-05-01 1996-12-03 Affymax Technologies N.V. Recombinant library screening methods
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5648471A (en) 1987-12-03 1997-07-15 Centocor, Inc. One vial method for labeling antibodies with Technetium-99m
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5697902A (en) 1985-07-05 1997-12-16 Immunomedics, Inc. Method for imaging and treating organs and tissues
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5741957A (en) 1989-12-01 1998-04-21 Pharming B.V. Transgenic bovine
US5750172A (en) 1987-06-23 1998-05-12 Pharming B.V. Transgenic non human mammal milk
US5756687A (en) 1993-03-09 1998-05-26 Genzyme Transgenics Corporation Isolation of components of interest from milk
WO1998024884A1 (en) 1996-12-02 1998-06-11 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5973972A (en) 1995-11-03 1999-10-26 Samsung Electronics, Co., Ltd. Precharge system for a semiconductor memory device
US6077835A (en) 1994-03-23 2000-06-20 Case Western Reserve University Delivery of compacted nucleic acid to cells
WO2000046147A2 (en) 1999-02-03 2000-08-10 Biosante Pharmaceuticals, Inc. Therapeutic calcium phosphate particles and methods of manufacture and use
WO2000070087A1 (en) 1999-05-14 2000-11-23 Copernicus Therapeutics, Inc. Automated nucleic acid compaction device
WO2001009187A2 (en) 1999-07-29 2001-02-08 Medarex, Inc. Human monoclonal antibodies to her2/neu
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
WO2002043478A2 (en) 2000-11-30 2002-06-06 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
US6881557B2 (en) 2001-07-12 2005-04-19 Arrowsmith Technologies Llp Super humanized antibodies
WO2007059782A1 (en) 2005-11-28 2007-05-31 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
US20080050383A1 (en) 2006-03-29 2008-02-28 New York University Immunotherapy for clearing pathological tau conformers
US20100316564A1 (en) 2009-06-10 2010-12-16 New York University Immunological targeting of pathological tau proteins

Family Cites Families (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4861581A (en) 1986-12-05 1989-08-29 Cancer Biologics, Inc. Detection of necrotic malignant tissue and associated therapy
US5434050A (en) 1991-08-13 1995-07-18 Regents Of The University Of Minnesota Labelled β-amyloid peptide and methods of screening for Alzheimer's disease
ATE398176T1 (de) 1991-12-06 2008-07-15 Max Planck Gesellschaft Phosphorylierungsepitope aus dem tau-protein zur diagnose und behandlung der alzheimer-krankheit
CA2124967C (en) 1991-12-17 2008-04-08 Nils Lonberg Transgenic non-human animals capable of producing heterologous antibodies
US6136548A (en) 1994-11-22 2000-10-24 Rutgers, The State University Of New Jersey Methods for identifying useful T-PA mutant derivatives for treatment of vascular hemorrhaging
US5670477A (en) 1995-04-20 1997-09-23 Joseph F. Poduslo Method to enhance permeability of the blood/brain blood/nerve bariers to therapeutic agents
DK0912738T3 (da) 1996-05-22 2008-11-17 Viventia Biotech Inc Antigen-bindende-fragmenter der specifikt detekterer cancerceller, nukleotider der koder fragmenterne og anvendelse deraf til profylakse og detektion af cancere
WO1998022120A1 (en) 1996-11-19 1998-05-28 The Wistar Institute Of Anatomy & Biology Diagnostic and therapeutic reagents for alzheimer's disease
CA2427014A1 (en) 2000-11-02 2002-08-22 Cornell Research Foundation, Inc. In vivo multiphoton diagnostic detection and imaging of a neurodegenerative disease
AT500379B8 (de) 2001-02-02 2009-08-15 Axon Neuroscience Tau-proteine
US6821504B2 (en) 2001-05-23 2004-11-23 New York University Detection of alzheimer's amyloid by magnetic resonance imaging
NZ562434A (en) 2005-05-05 2010-04-30 Merck & Co Inc Peptide conjugate compositions and methods for the prevention and treatment of alzheimer's disease
WO2008140639A2 (en) 2007-02-08 2008-11-20 Oligomerix, Inc. Biomarkers and assays for alzheimer's disease
SI2408807T1 (sl) 2009-03-18 2021-11-30 Ac Immune Sa Postopek za terapevtsko uporabo
UA107571C2 (xx) * 2009-04-03 2015-01-26 Фармацевтична композиція
NZ598356A (en) 2009-07-30 2014-06-27 Pfizer Vaccines Llc Antigenic tau peptides and uses thereof
RU2639537C2 (ru) * 2011-10-07 2017-12-21 Ац Иммуне С.А. Фосфоспецифичные антитела, распознающие тау

Patent Citations (53)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4495285A (en) 1981-10-30 1985-01-22 Kimihiro Shimizu Plasminogen activator derivatives
US4495285B1 (https=) 1981-10-30 1986-09-23 Nippon Chemiphar Co
US4609546A (en) 1982-06-24 1986-09-02 Japan Chemical Research Co., Ltd. Long-acting composition
US4681581A (en) 1983-12-05 1987-07-21 Coates Fredrica V Adjustable size diaper and folding method therefor
US4766106A (en) 1985-06-26 1988-08-23 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polymer conjugation
US4735210A (en) 1985-07-05 1988-04-05 Immunomedics, Inc. Lymphographic and organ imaging method and kit
US5101827A (en) 1985-07-05 1992-04-07 Immunomedics, Inc. Lymphographic and organ imaging method and kit
US5697902A (en) 1985-07-05 1997-12-16 Immunomedics, Inc. Method for imaging and treating organs and tissues
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US5750172A (en) 1987-06-23 1998-05-12 Pharming B.V. Transgenic non human mammal milk
US5648471A (en) 1987-12-03 1997-07-15 Centocor, Inc. One vial method for labeling antibodies with Technetium-99m
US5545807A (en) 1988-10-12 1996-08-13 The Babraham Institute Production of antibodies from transgenic animals
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5589466A (en) 1989-03-21 1996-12-31 Vical Incorporated Induction of a protective immune response in a mammal by injecting a DNA sequence
US5102990A (en) 1989-08-09 1992-04-07 Rhomed Incorporated Direct radiolabeling of antibodies and other proteins with technetium or rhenium
USRE35500E (en) 1989-08-09 1997-05-06 Aberlyn Capital Management Limited Partnership Direct radiolabeling of antibodies and other proteins with technetium or rhenium
US5741957A (en) 1989-12-01 1998-04-21 Pharming B.V. Transgenic bovine
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
US5580717A (en) 1990-05-01 1996-12-03 Affymax Technologies N.V. Recombinant library screening methods
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5789650A (en) 1990-08-29 1998-08-04 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5569825A (en) 1990-08-29 1996-10-29 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5814318A (en) 1990-08-29 1998-09-29 Genpharm International Inc. Transgenic non-human animals for producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
WO1992003918A1 (en) 1990-08-29 1992-03-19 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5770429A (en) 1990-08-29 1998-06-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US6407213B1 (en) 1991-06-14 2002-06-18 Genentech, Inc. Method for making humanized antibodies
WO1992022645A1 (en) 1991-06-14 1992-12-23 Genpharm International, Inc. Transgenic immunodeficient non-human animals
WO1993001227A1 (en) 1991-07-08 1993-01-21 University Of Massachusetts At Amherst Thermotropic liquid crystal segmented block copolymer
US5565332A (en) 1991-09-23 1996-10-15 Medical Research Council Production of chimeric antibodies - a combinatorial approach
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
US5756687A (en) 1993-03-09 1998-05-26 Genzyme Transgenics Corporation Isolation of components of interest from milk
WO1994025585A1 (en) 1993-04-26 1994-11-10 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5827690A (en) 1993-12-20 1998-10-27 Genzyme Transgenics Corporatiion Transgenic production of antibodies in milk
US6077835A (en) 1994-03-23 2000-06-20 Case Western Reserve University Delivery of compacted nucleic acid to cells
US6265150B1 (en) 1995-06-07 2001-07-24 Becton Dickinson & Company Phage antibodies
US5973972A (en) 1995-11-03 1999-10-26 Samsung Electronics, Co., Ltd. Precharge system for a semiconductor memory device
WO1998024884A1 (en) 1996-12-02 1998-06-11 Genpharm International Transgenic non-human animals capable of producing heterologous antibodies
WO2000046147A2 (en) 1999-02-03 2000-08-10 Biosante Pharmaceuticals, Inc. Therapeutic calcium phosphate particles and methods of manufacture and use
WO2000070087A1 (en) 1999-05-14 2000-11-23 Copernicus Therapeutics, Inc. Automated nucleic acid compaction device
WO2001009187A2 (en) 1999-07-29 2001-02-08 Medarex, Inc. Human monoclonal antibodies to her2/neu
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
WO2002043478A2 (en) 2000-11-30 2002-06-06 Medarex, Inc. Transgenic transchromosomal rodents for making human antibodies
US6881557B2 (en) 2001-07-12 2005-04-19 Arrowsmith Technologies Llp Super humanized antibodies
WO2007059782A1 (en) 2005-11-28 2007-05-31 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
US20080050383A1 (en) 2006-03-29 2008-02-28 New York University Immunotherapy for clearing pathological tau conformers
US20100316564A1 (en) 2009-06-10 2010-12-16 New York University Immunological targeting of pathological tau proteins

Non-Patent Citations (160)

* Cited by examiner, † Cited by third party
Title
"Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC.
"UniProt", Database accession no. P10636
ADAMS, G.P. ET AL.: "Prolonged in vivo Tumour Retention Of A Human Diabody Targeting The Extracellular Domain Of Human HER2/neu", BRIT. J. CANCER, vol. 77, no. 9, 1998, pages 1405 - 1412, XP009037431
AHMAD, Z.A. ET AL.: "scFv Antibody: Principles And Clinical Application", CLIN. DEV. IMMUNOL., vol. 2012, 2012, pages 980250
ALT, M. ET AL.: "Novel Tetravalent And Bispecific IgG-like Antibody Molecules Combining Single-Chain Diabodies With The Immunoglobulin Gammal Fc or CH3 Region", FEBS LETT., vol. 454, 1999, pages 90 - 94
ALTSCHUL, S.F.: "Amino Acid Substitution Matrices From An Information Theoretic Perspective", J. MOL. BIOL., vol. 219, 1991, pages 555 - 565, XP024010245, DOI: 10.1016/0022-2836(91)90193-A
ANDORFER, C. ET AL.: "Hyperphosphorylation And Aggregation Of Tau In Mice Expressing Normal Human Tau Isoforms", J. NEUROCHEM., vol. 86, 2003, pages 582 - 590
ASUNI, A.A. ET AL.: "Immunotherapy Targeting Pathological Tau Conformers In A Tangle Mouse Model Reduces Brain Pathology With Associated Functional Improvements", J. NEUROSCI., vol. 27, 2007, pages 9115 - 9129, XP002606710, DOI: 10.1523/JNEUROSCI.2361-07.2007
BARBAS, C. F., III ET AL.: "Phage Display: A Laboratory Manual", 2001, COLD SPRING HARBOR PRESS
BARDERAS, R. ET AL.: "Affinity Maturation Of Antibodies Assisted By In Silico Modeling", PROC. NATL. ACAD. SCI. (USA, vol. 105, no. 26, 2008, pages 9029 - 9034, XP002592575, DOI: 10.1073/PNAS.0801221105
BEKRIS, L.M. ET AL.: "Genetics of Alzheimer Disease", J. GERIATR. PSYCHIATRY NEUROL., vol. 23, no. 4, 2010, pages 213 - 227
BENVENISTYRESHEF, PNAS USA, vol. 83, 1986, pages 9551 - 55
BHASKAR, S. ET AL.: "Multifunctional Nanocarriers For Diagnostics, Drug Delivery And Targeted Treatment Across Blood-Brain Barrier: Perspectives On Tracking And Neuroimaging", PART. FIBRE. TOXICOL., vol. 7, no. 3, 2010, pages 1 - 25
BI, A. ET AL.: "Tau-Targeted Immunization Impedes Progression of Neurofibrillary Histopathology in Aged P301L Tau Transgenic Mice", PLOS. ONE, vol. 6, 2011, pages e26860, XP055451637, DOI: 10.1371/journal.pone.0026860
BICKEL, U. ET AL.: "Delivery Of Peptides And Proteins Through The Blood-Brain Barrier", ADV. DRUG DELIV. REV., vol. 46, 2001, pages 247 - 279, XP002984398, DOI: 10.1016/S0169-409X(00)00139-3
BIRD, R.E. ET AL.: "Single-Chain Antigen-Binding Proteins", SCIENCE, vol. 242, 1988, pages 423 - 426, XP000575094, DOI: 10.1126/science.3140379
BLENNOW ET AL.: "Cerebrospinal Fluid And Plasma Biomarkers In Alzheimer Disease", NAT. REV. NEUROL., vol. 6, 2010, pages 131 - 144, XP009136259
BOADO, R.J. ET AL.: "IgG-Single Chain Fv Fusion Protein Therapeutic For Alzheimer's Disease: Expression In CHO cells And Pharmacokinetics And Brain Delivery In The Rhesus Monkey", BIOTECHNOL. BIOENG., vol. 105, 2010, pages 627 - 635, XP002622927, DOI: 10.1002/bit.22576
BOIMEL, M. ET AL.: "Efficacy And Safety Of Immunization With Phosphorylated Tau Against Neurofibrillary Tangles In Mice", EXP. NEUROL., vol. 224, 2010, pages 472 - 485, XP027141093
BOSTROM, J. ET AL.: "Improving Antibody Binding Affinity And Specificity For Therapeutic Development", METHODS MOL. BIOL., vol. 525, 2009, pages 353 - 376
BOUTAJANGOUT, A. ET AL.: "Immunotherapy Targeting Pathological Tau Prevents Cognitive Decline In A New Tangle Mouse Model", J. NEUROSCI., vol. 30, 2010, pages 16559 - 16566, XP055203597, DOI: 10.1523/JNEUROSCI.4363-10.2010
BOUTAJANGOUT, A. ET AL.: "Immunotherapy Targeting Pathological Tau Prevents Cognitive Decline In A New Tangle MouseModel", J. NEUROSCI., vol. 30, 2010, pages 16559 - 16566, XP055203597, DOI: 10.1523/JNEUROSCI.4363-10.2010
BOUTAJANGOUT, A. ET AL.: "Passive Immunization Targeting Pathological Phospho-Tau Protein In A Mouse Model Reduces Functional Decline And Clears Tau Aggregates From The Brain", J. NEUROCHEM., vol. 118, 2011, pages 658 - 667, XP055081677, DOI: 10.1111/j.1471-4159.2011.07337.x
BUDSON, A.E. ET AL.: "New Criteria For Alzheimer Disease And Mild Cognitive Impairment: Implications For The Practicing Clinician", NEUROLOGIST, vol. 18, no. 6, 2012, pages 356 - 363
CARRILLO, M.C. ET AL.: "Revisiting The Framework Of The National Institute On Aging-Alzheimer's Association Diagnostic Criteria", ALZHEIMERS DEMENT., vol. 9, no. 5, 2013, pages 594 - 601
CARTER, P. ET AL.: "Humanization Of An Anti-pl85her2 Antibody For Human Cancer Therapy", PROC. NATL. ACAD. SCI. (U.S.A., vol. 89, 1992, pages 4285 - 4289, XP000275844, DOI: 10.1073/pnas.89.10.4285
CASTILLO-CARRANZA, D.L. ET AL.: "Passive Immunization with Tau Oligomer Monoclonal Antibody Reverses Tauopathy Phenotypes without Affecting Hyperphosphorylated Neurofibrillary Tangles", J. NEUROSCI., vol. 34, 2014, pages 4260 - 4272, XP055250997, DOI: 10.1523/JNEUROSCI.3192-13.2014
CASTILLO-CARRANZA, D.L. ET AL.: "Specific Targeting Of Tau Oligomers In Htau Mice Prevents Cognitive Impairment And Tau Toxicity Following Injection With Brain-Derived Tau Oligomeric Seeds", J. ALZHEIMERS. DIS., vol. 40, 2014, pages S97 - S111, XP055364789, DOI: 10.3233/JAD-132477
CHAI, X. ET AL.: "Passive Immunization With Anti-Tau Antibodies In Two Transgenic Models: Reduction Of Tau Pathology And Delay Of Disease Progression", J. BIOL CHEM., vol. 286, 2011, pages 34457 - 34467, XP055087176, DOI: 10.1074/jbc.M111.229633
CHEN ET AL., EMBO J., vol. 12, 1993, pages 811 - 820
CHEN, J. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 - 656
CHIEN, D.T. ET AL.: "Early Clinical PET Imaging Results With The Novel PHF-Tau Radioligand [F-18]-T807", J. ALZHEIMERS. DIS., vol. 34, 2013, pages 457 - 468, XP008174041
CHIEN, D.T.: "Early Clinical PET Imaging Results With The Novel PHF-Tau Radioligand [F18]-T808", J. ALZHEIMERS. DIS., vol. 38, 2014, pages 171 - 184
CHOTHIA, C. ET AL.: "Canonical Structures For The Hypervariable Regions Of Immunoglobulins", J. MOL. BIOL., vol. 196, 1987, pages 901 - 917, XP024010426, DOI: 10.1016/0022-2836(87)90412-8
CO, M. S. ET AL.: "Humanized Antibodies For Antiviral Therapy", PROC. NATL. ACAD. SCI. (U.S.A., vol. 88, 1991, pages 2869 - 2873, XP000200583, DOI: 10.1073/pnas.88.7.2869
CO, M.S. ET AL.: "Chimeric And Humanized Antibodies With Specificity For The CD33 Antigen", J. IMMUNOL., vol. 148, 1992, pages 1149 - 1154, XP000368716
CONGDON, E. E. ET AL.: "Antibody Uptake into Neurons Occurs Primarily via Clathrin-dependent Fcgamma Receptor Endocytosis and Is a Prerequisite for Acute Tau Protein Clearance", J. BIOL CHEM., vol. 288, 2013, pages 3 5452 - 35465
CONGDON, E.E. ET AL.: "Antibody Uptake into Neurons Occurs Primarily via Clathrin-dependent Fcgamma Receptor Endocytosis and Is a Prerequisite for Acute Tau Protein Clearance", J. BIOL. CHEM., vol. 288, no. 46, 2013, pages 35452 - 35465, XP055364767, DOI: 10.1074/jbc.M113.491001
CONGDON. E.E. ET AL.: "Harnessing The Immune System For Treatment And Detection Of Tau Pathology", J. ALZHEIMERS. DIS., vol. 40, 2014, pages S113 - S121
CORAROPEARSON, SOMATIC CELL GENETICS, vol. 2, 1981, pages 603
CREIGHTON: "Proteins: Structure and Molecular Properties", 1984, W. H. FREEMAN AND COMPANY
D'ABRAMO, C. ET AL.: "Tau Passive Immunotherapy in Mutant P301L Mice: Antibody Affinity versus Specificity", PLOS ONE, vol. 8, 2013, pages e62402, XP055199896, DOI: 10.1371/journal.pone.0062402
DAVIS, J. ET AL.: "Early-Onset And Robust Cerebral Microvascular Accumulation Of Amyloid Beta-Protein In Transgenic Mice Expressing Low Levels Of A Vasculotropic Dutch/Iowa Mutant Form Of Amyloid Beta-Protein Precursor", J. BIOL. CHEM., vol. 279, 2004, pages 20296 - 20306
DAVIS, J. ET AL.: "Early-Onset And Robust Cerebral Microvascular Accumulation Of Amyloid Beta-Protein In Transgenic Mice Expressing Low Levels Of A Vasculotropic Dutch/low a Mutant Form Of Amyloid Beta-Protein Precursor", J. BIOL. CHEM., vol. 279, 2004, pages 20296 - 20306
DINCQ, S. ET AL.: "Expression And Purification Of Monospecific And Bispecific Recombinant Antibody Fragments Derived From Antibodies That Block The CD80/CD86-CD28 Costimulatory Pathway", PROTEIN EXPRESS. PURIFICAT., vol. 22, no. 1, 2001, pages 11 - 24
EDDY, S.R.: "Where Did The BLOSUM62 Alignment Score Matrix Come From?", NATURE BIOTECH., vol. 22, no. 8, 2004, pages 1035 - 1036
EVANS ET AL., J. IMMUNOL. METH., vol. 184, 1995, pages 123 - 38
FINLAY, W.J. ET AL.: "Affinity Maturation Of A Humanized Rat Antibody For Anti-RAGE Therapy: Comprehensive Mutagenesis Reveals A High Level Of Mutational Plasticity Both Inside And Outside The Complementarity-Determining Regions", J. MOL. BIOL., vol. 388, no. 3, 2009, pages 541 - 558, XP026046499, DOI: 10.1016/j.jmb.2009.03.019
FISHER, A. ET AL.: "Efficient Isolation Of Soluble Intracellular Single-Chain Antibodies Using The Twin-Arginine TranslocationMachinery", J. NOL. BIOL., vol. 385, no. 1, 2009, pages 299 - 311, XP025846140, DOI: 10.1016/j.jmb.2008.10.051
FISHWILD, D. ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 - 851
FODERO-TAVOLETTI, M. T. ET AL.: "18F-THK523: A Novel In Vivo Tau Imaging Ligand For Alzheimer's Disease", BRAIN, vol. 134, 2011, pages 1089 - 1100
FODERO-TAVOLETTI, M. T. ET AL.: "Assessing THK523 Selectivity For Tau Deposits In Alzheimer's Disease And Non-Alzheimer's Disease Tauopathies", ALZHEIMERS. RES. THER., vol. 6, 2014, pages 11, XP021180155, DOI: 10.1186/alzrt240
FRASER, K.J. ET AL.: "Specific Cleavage Between Variable And Constant Domains Of Rabbit Antibody Light Chains By Dilute Acid Hydrolysis", BIOCHEMISTRY, vol. 11, no. 26, 1972, pages 4974 - 4977
GLASER ET AL., J. IMMUNOLOGY, vol. 149, 1992, pages 3903
GONZALES, N.R. ET AL.: "SDR Grafting Of A Murine Antibody Using Multiple Human Germline Templates To Minimize Its Immunogenicity", MOL. IMMUNOL., vol. 41, 2004, pages 863 - 872, XP002402422, DOI: 10.1016/j.molimm.2004.03.041
GORMAN, S. D. ET AL.: "Reshaping A Therapeutic CD4 Antibody", PROC. NATL. ACAD. SCI. (U.S.A., vol. 88, 1991, pages 4181 - 4185, XP000368701, DOI: 10.1073/pnas.88.10.4181
GRANT ET AL., METHODS IN ENZYMOL, vol. 153, 1987, pages 516 - 544
GU ET AL.: "Two Novel Tau Antibodies Targeting the 396/404 Region Are Primarily Taken Up by Neurons and Reduce Tau Protein Pathology.", J BIOL. CHEM, vol. 288, no. 46, 15 November 2013 (2013-11-15), pages 33081 - 33095, XP055251913, ISSN: 0021-9258 *
GU, J. ET AL.: "Two Novel Tau Antibodies Targeting The 396/404 Region Are Primarily Taken Up By Neurons And Reduce Tau Protein Pathology", J. BIOL CHEM., vol. 288, 2013, pages 33081 - 33095, XP055251913, DOI: 10.1074/jbc.M113.494922
GU, J. ET AL.: "Two Novel Tau Antibodies Targeting The 396/404 Region Are Primarily Taken Up By Neurons And Reduce Tau Protein Pathology", J. BIOL. CHEM., vol. 288, no. 46, 2013, pages 33081 - 33095, XP055251913, DOI: 10.1074/jbc.M113.494922
GUSTCHINA, E. ET AL.: "Affinity Maturation By Targeted Diversification Of The CDR-H2 Loop Of A Monoclonal Fab Derived From A Synthetic Naive Human Antibody Library And Directed Against The Internal Trimeric Coiled-Coil Of Gp41 Yields A Set Of Fabs With Improved HIV-1 Neutralization Potency And Breadth", VIROLOGY, vol. 393, no. 1, 2009, pages 112 - 119, XP026641691, DOI: 10.1016/j.virol.2009.07.019
HACKEL, B.J. ET AL.: "Stability And CDR Composition Biases Enrich Binder Functionality Landscapes", J. MOL. BIOL., vol. 401, no. 1, 2010, pages 84 - 96, XP027143129, DOI: 10.1016/j.jmb.2010.06.004
HALES, C.M. ET AL.: "From Frontotemporal Lobar Degeneration Pathology To Frontotemporal Lobar Degeneration Biomarkers", INT. REV. PSYCHIATRY, vol. 25, 2013, pages 210 - 220
HANES ET AL., ADVANCED DRUG DELIVERY REVIEWS, vol. 28, 1997, pages 97 - 119
HARADA, R. ET AL.: "Comparison Of The Binding Characteristics Of [18F]THK-523 And Other Amyloid Imaging Tracers To Alzheimer's Disease Pathology", EUR. J. NUCL. MED. MOL. IMAGING, vol. 40, 2013, pages 125 - 132
HARDING, F.LONBERG, N., ANN. N. Y. ACAD. SCI, vol. 764, 1995, pages 536 - 546
HENIKOFF, J.G.: "Amino acid substitution matrices from protein blocks", PROC. NATL. ACAD. SCI. (USA, vol. 89, 1992, pages 10915 - 10919, XP002599751, DOI: 10.1073/pnas.89.22.10915
HERVE, F. ET AL.: "CNS Delivery Via Adsorptive Transcytosis", AAPS J., vol. 10, no. 3, 2008, pages 455 - 472, XP055070661, DOI: 10.1208/s12248-008-9055-2
HOLLINGER, P. ET AL.: "''Diabodies'': Small Bivalent And Bispecific Antibody Fragments", PROC. NATL. ACAD. SCI. (U.S.A., vol. 90, no. 14, 1993, pages 6444 - 6448
HOLT ET AL., TRENDS BIOTECHNOL., vol. 2i, no. ll, November 2003 (2003-11-01), pages 484 - 90
HUANG, L. ET AL.: "Single-Chain Fragment Variable Passive Immunotherapies For Neurodegenerative Diseases", INT. J. MOL. SCI., vol. 14, no. 9, 2013, pages 19109 - 19127
HUHALOV, A. ET AL.: "Engineered Single Chain Antibody Fragments For Radioimmunotherapy", Q. J. NUCL. MED. MOL. IMAGING, vol. 48, no. 4, 2004, pages 279 - 288
HUSAIN, M.M.: "Clinical Diagnosis And Management Of Alzheimer's Disease", NEUROIMAGING CLIN. N. AMER., vol. 15, no. 4, 2005, pages 767 - 777
HUSSEIN, A.H. ET AL.: "Construction and Characterization of Single-Chain Variable Fragment Antibodies Directed against the Bordetella pertussis Surface Adhesins Filamentous Hemagglutinin and Pertactin", INFECT. IMMUN., vol. 75, no. 11, 2007, pages 5476 - 5482
HUSTON ET AL., PNAS USA, vol. 85, 1988, pages 5879 - 5883
HUSTON, J.S. ET AL.: "Protein Engineering Of Antibody Binding Sites: Recovery Of Specific Activity In An Anti-Digoxin Single-Chain Fv Analogue Produced In Escherichia coli", PROC. NATL. ACAD. SCI. (U.S.A., vol. 85, 1988, pages 5879 - 5883, XP000872837, DOI: 10.1073/pnas.85.16.5879
JEVSEVAR, S. ET AL.: "PEGylation Of Therapeutic Proteins", BIOTECHNOL. J., vol. 5, 2010, pages 113 - 228
JONES, A.R. ET AL.: "Blood-Brain Barrier Transport Of Therapeutics Via Receptor-Mediation", PHARM. RES., vol. 24, no. 9, 2007, pages 1759 - 1771, XP019532601, DOI: 10.1007/s11095-007-9379-0
JUNGHANS ET AL.: "Cancer Chemotherapy and Biotherapy", 1996, LIPPINCOTT RAVEN, pages: 655 - 686
KANDIMALLA, K.K. ET AL.: "Physiological And Biophysical Factors That Influence Alzheimer's Disease Amyloid Plaque Targeting Of Native And Putrescine Modified Human Amyloid Beta40", J. PHARMACOL. EXP. THER., vol. 318, 2006, pages 17 - 25
KARLIN, S. ET AL.: "Methods For Assessing The Statistical Significance Of Molecular Sequence Features By Using General Scoring Schemes", PROC. NATL. ACAD. SCI. (USA, vol. 87, 1990, pages 2264 - 2268, XP001030853, DOI: 10.1073/pnas.87.6.2264
KAUR, S. ET AL.: "Recent Trends In Antibody-Based Oncologic Imaging", CANCER LETT., vol. 315, 2012, pages 97 - 111, XP028352223, DOI: 10.1016/j.canlet.2011.10.017
KETTLEBOROUGH, C. A. ET AL.: "Humanization Of A Mouse Monoclonal Antibody By CDR-Grafting: The Importance Of Framework Residues On Loop Conformation", PROTEIN ENGINEERING, vol. 4, 1991, pages 773 - 3783
KFOURY, N. ET AL.: "Trans-cellular Propagation of Tau Aggregation by Fibrillar Species", J. BIOL. CHEM., vol. 287, 2012, pages 19440 - 19451, XP055087124, DOI: 10.1074/jbc.M112.346072
KRAUSE, J.C. ET AL.: "An Insertion Mutation That Distorts Antibody Binding Site Architecture Enhances Function Of A Human Antibody", MBIO, vol. 2, no. 1, 2011, pages e00345 - 10, XP055448443, DOI: 10.1128/mBio.00345-10
KRISHNAMURTHY, P.K. ET AL.: "Mechanistic Studies Of Antibody-Mediated Clearance Of Tau Aggregates Using An Ex Vivo Brain Slice Model", FRONT. PSYCHIATRY, vol. 2, 2011, pages 59
KRISHNASWAMY ET AL., ALZHEIMER'S & DEMENTIA, vol. 10, no. 4, 2014, pages 252
KRISHNASWAMY S. ET AL.: "Antibody-Derived in vivo Imaging of Tau Pathology", J. NEUROSCI., vol. 34, 2014, pages 16835 - 16850, XP055418613, DOI: 10.1523/JNEUROSCI.2755-14.2014
KRISHNASWAMY, S. ET AL.: "Cloning Antifungal Single Chain Fragment Variable Antibodies By Phage Display And Competitive Panning Elution", ANAL. BIOCHEM., vol. 395, 2009, pages 16 - 24, XP026626767, DOI: 10.1016/j.ab.2009.08.003
KRISHNASWAMY, S. ET AL.: "Isolation And Characterization Of Recombinant Single Chain Fragment Variable Anti-Idiotypic Antibody Specific To Aspergillus fumigatus Membrane Protein", J. IMMUNOL. METHODS, vol. 366, 2011, pages 60 - 68
KUAN, C.T. ET AL.: "Affinity-Matured Anti-Glycoprotein NMB Recombinant Immunotoxins Targeting Malignant Gliomas And Melanomas", INT. J. CANCER, 2010
KUFER, P. ET AL.: "A Revival Of Bispecific Antibodies", TRENDS IN BIOTECHNOLOGY, vol. 22, no. 5, 2004, pages 238 - 24, XP004504363, DOI: 10.1016/j.tibtech.2004.03.006
KURTH, M. ET AL.: "Site-Specific Conjugation Of A Radioiodinated Phenethylamine Derivative To A Monoclonal Antibody Results In Increased Radioactivity Localization In Tumor", J. MED. CHEM., vol. 36, no. 9, 1993, pages 1255 - 1261, XP055032229, DOI: 10.1021/jm00061a017
LAJOIE, J.M. ET AL.: "Targeting Receptor-Mediated Transport For Delivery Of Biologics Across The Blood-Brain Barrier", ANNU. REV. PHARMACOL. TOXICOL., vol. 55, 2015, pages 613 - 631, XP055538938, DOI: 10.1146/annurev-pharmtox-010814-124852
LANGER ET AL., SCIENCE, vol. 249, 1990, pages 1527
LE GALL, F. ET AL.: "Di-, Tri- And Tetrameric Single Chain Fv Antibody Fragments Against Human CD19: Effect Of Valency On Cell Binding", FEBS LETTERS, vol. 453, no. 1, 1999, pages 164 - 168, XP004259822, DOI: 10.1016/S0014-5793(99)00713-9
LEMERE, C.A. ET AL.: "Can Alzheimer Disease Be Prevented By Amyloid-Beta Immunotherapy?", NAT. REV. NEUROL., vol. 6, 2010, pages 108 - 119, XP009145550, DOI: 10.1038/nrneurol.2009.219
LEWIS, J. ET AL.: "Neurofibrillary Tangles, Amyotrophy And Progressive Motor Disturbance In Mice Expressing Mutant (P301L) Tau Protein", NAT. GENET., vol. 25, 2000, pages 402 - 405, XP001097257, DOI: 10.1038/78078
LINDEGREN, S. ET AL.: "Chloramine-T In High-Specific-Activity Radioiodination Of Antibodies Using N-Succinimidyl-3-(Trimethylstannyl)Benzoate As An Intermediate", NUCL. MED. BIOL., vol. 25, no. 7, 1998, pages 659 - 665, XP004149436, DOI: 10.1016/S0969-8051(98)00033-X
LOBUGLIO, A.F. ET AL.: "Mouse/Human Chimeric Monoclonal Antibody In Man: Kinetics And Immune Response", PROC. NATL. ACAD. SCI. (U.S.A., vol. 86, 1989, pages 4220 - 4224, XP002100301, DOI: 10.1073/pnas.86.11.4220
LONBERG, N. ET AL., NATURE, vol. 368, 1994, pages 856 - 859
LONBERG, N.HUSZAR, D., INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93
MAEDA, H. ET AL.: "Construction Of Reshaped Human Antibodies With HIV-Neutralizing Activity", HUMAN ANTIBODIES HYBRIDOMA, vol. 2, 1991, pages 124 - 134
MARUYAMA, M.H. ET AL.: "Imaging Of Tau Pathology In A Tauopathy Mouse Model And In Alzheimer Patients Compared To Normal Controls", NEURON, vol. 79, 2013, pages 1094 - 1108, XP028720119, DOI: 10.1016/j.neuron.2013.07.037
MASON, N.S. ET AL.: "Positron Emission Tomography Radioligands For In Vivo Imaging Of ABeta Plaques", J. LABELLED COMP. RADIOPHARM., vol. 56, 2013, pages 89 - 95
MATHUPALA, S.P. ET AL.: "Delivery OfSmall-InterferingRNA (siRNA) To The Brain", EXPERT OPIN. THER. PAT., vol. 19, no. 2, 2009, pages 137 - 140
MONTGOMERY, D.L. ET AL.: "Affinity Maturation And Characterization Of A Human Monoclonal Antibody Against HIV-1 gp4l", MABS, vol. 1, no. 5, 2009, pages 462 - 474, XP055568716, DOI: 10.4161/mabs.1.5.9214
MOOSMANN, A. ET AL.: "Purification Of PEGylated Proteins, With The Example Of PEGylated Lysozyme and PEGylated scFv", METHODS MOL. BIOL., vol. 1129, 2014, pages 527 - 538
MULLER, M.R. ET AL.: "Improving The Pharmacokinetic Properties Of Biologies By Fusion To An Anti-HSA Shark VNAR Domain", MABS, vol. 4, no. 6, 2012, pages 673 - 685, XP002700030, DOI: 10.4161/mabs.22242
OKAMURA, N. ET AL.: "Non-Invasive Assessment Of Alzheimer's Disease Neurofibrillary Pathology Using 18F-THK5105 PET", BRAIN, vol. 137, 2014, pages 1762 - 1771
OKAMURA, N. ET AL.: "Quinoline And Benzimidazole Derivatives: Candidate Probes For In Vivo Imaging Of Tau Pathology In Alzheimer's Disease", J. NEUROSCI., vol. 25, 2005, pages 10857 - 10862, XP003015011, DOI: 10.1523/JNEUROSCI.1738-05.2005
OLAFSEN, T. ET AL.: "Antibody Vectors For Imaging", SEMIN. NUCL. MED., vol. 40, 2010, pages 167 - 181
ONO, M. ET AL.: "Rhodanine And Thiohydantoin Derivatives For Detecting Tau Pathology In Alzheimer's Brains", ACS CHEM. NEUROSCI., vol. 2, 2011, pages 269 - 275, XP055042243, DOI: 10.1021/cn200002t
OTVOS ET AL., J. NEUROSCI. RES., vol. 39, 1994, pages 669 - 673
PARDRIDGE, W.M.: "Drug Transport Across The Blood-Brain Barrier", J. CEREB. BLOOD FLOW METAB., vol. 32, no. 11, pages 1959 - 1972, XP055118945, DOI: 10.1038/jcbfm.2012.126
PEDERSEN, J.T. ET AL.: "Tau Immunotherapy For Alzheimer's Disease", TRENDS MOL. MED., 3 April 2015 (2015-04-03), pages 1 - 9
PETERS T. ET AL.: "Serum Albumin", ADV. PROTEIN CHEM., vol. 37, 1985, pages 161 - 245
PISZKIEWICZ, D. ET AL.: "Anomalous Cleavage Of Aspartyl-Proline Peptide Bonds During Amino Acid Sequence Determinations", BIOCHEM. BIOPHYS. RES. COMMUN., vol. 40, no. 5, 1970, pages 1173 - 1178, XP024847889, DOI: 10.1016/0006-291X(70)90918-6
PNAS USA, vol. 90, no. 14, 1993, pages 6444 - 8
POULSEN, K. ET AL.: "An Active Derivative Of Rabbit Antibody Light Chain Composed Of The Constant And The Variable Domains Held Together Only By A Native Disulfide Bond", PROC. NATL. ACAD. SCI. (U.S.A., vol. 69, no. 9, 1972, pages 2495 - 2499
RAO, K.S. ET AL.: "Targeting Anti-HIVDrugs To The CNS", EXPERT OPIN. DRUG DELIV., vol. 6, no. 8, 2009, pages 771 - 784
REA, D.W. ET AL.: "Site-specifically radioiodinated antibody for targeting tumors", CANCER RES., vol. 50, no. 3, 1990, pages 857s - 861s
REVETS ET AL., EXPERT OPIN BIOL THER., vol. 5, no. l, January 2005 (2005-01-01), pages 111 - 24
RICHARD, J.P. ET AL.: "Cell-Penetrating Peptides. A Reevaluation Of The Mechanism Of Cellular Uptake", J. BIOL. CHEM., vol. 278, 2003, pages 585 - 590, XP002314498, DOI: 10.1074/jbc.M209548200
RIECHMANN, L. ET AL.: "Reshaping Human Antibodies for Therapy", NATURE, vol. 332, 1988, pages 323 - 327, XP002007067, DOI: 10.1038/332323a0
RUDIKOFF, S.: "Single Amino Acid Substitution Altering Antigen-Binding Specificity", PROC. NATL. ACAD. SCI. (USA, vol. 79, no. 6, 1982, pages 1979 - 1983, XP002986051, DOI: 10.1073/pnas.79.6.1979
SARAZIN, M. ET AL.: "Clinical And Research Diagnostic Criteria For Alzheimer's Disease", NEUROIMAGING CLIN. N. AMER., vol. 22, no. 1, 2012, pages 23 - 32
SATO, K. ET AL., CANCER RES, vol. 53, 1993, pages 851 - 856
SCHAKOWSKI ET AL., MOL THER, vol. 3, 2001, pages 793 - 800
SCHIER ET AL., J. MOL. BIO., vol. 263, 1996, pages 551
See also references of EP3166688A4
SMALL, G.W. ET AL.: "Diagnosis And Treatment Of Alzheimer Disease And Related Disorders. Consensus Statement Of The American Association For Geriatric Psychiatry, The Alzheimer's Association, And The American Geriatrics Society", JAMA, vol. 278, no. 16, 1997, pages 1363 - 1371
STEIDL, S. ET AL.: "In Vitro Affinity Maturation Of Human GM-CSF Antibodies By Targeted CDR-Diversification", MOL. IMMUNOL., vol. 46, no. 1, 2008, pages 135 - 144, XP025472134, DOI: 10.1016/j.molimm.2008.07.013
STORK, R. ET AL.: "N-Glycosylation As Novel Strategy To Improve Pharmacokinetic Properties Of Bispecific Single-Chain Diabodies", J. BIOL. CHEM., vol. 283, 2008, pages 7804 - 7812, XP002537135, DOI: 10.1074/JBC.M709179200
SYKESJOHNSTON, NAT BIOTECH, vol. 12, 1997, pages 355 - 59
TAYLOR, L. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 - 591
TAYLOR, L. ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 - 6295
TEMPEST, P.R. ET AL.: "Reshaping A Human Monoclonal Antibody To Inhibit Human Respiratory Syncytial Virus Infection in vivo", BIO/TECHNOLOGY, vol. 9, 1991, pages 266 - 271, XP000986147, DOI: 10.1038/nbt0391-266
TEMSAMANI, J. ET AL.: "The Use Of Cell-Penetrating Peptides For Drug Delivery", DRUG DISCOV. TODAY, vol. 9, 2004, pages 1012 - 1019, XP004660985, DOI: 10.1016/S1359-6446(04)03279-9
THEUNIS, C. ET AL.: "Efficacy And Safety Of A Liposome-Based Vaccine Against Protein Tau, Assessed In Tau.P301L Mice That Model Tauopathy", PLOS. ONE, vol. 8, 2013, pages e72301, XP055531427, DOI: 10.1371/journal.pone.0072301
TROQUIER, L. ET AL.: "Targeting Phospho-Ser422 By Active Tau Immunotherapy In The THY-Tau22 Mouse Model: A Suitable Therapeutic Approach", CURR. ALZHEIMER RES., vol. 9, 2012, pages 397 - 405, XP008160263, DOI: 10.2174/156720512800492503
TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 - 2920
TUMA, P.L. ET AL.: "Transcytosis: Crossing Cellular Barriers", PHYSIOL. REV., vol. 83, 2003, pages 871 - 932, XP002582831
VAN HEEKESCHUSTER, J BIOL CHEM, vol. 264, 1989, pages 5503 - 5509
VERGHESE, P.B. ET AL.: "Apolipoprotein E In Alzheimer's Disease And Other Neurological Disorders", LANCET NEUROL., vol. 10, no. 3, 2011, pages 241 - 252, XP055291491, DOI: 10.1016/S1474-4422(10)70325-2
VERHOEYEN, M. ET AL.: "Reshaping Human Antibodies: Grafting An Antilysozyme Activity", SCIENCE, vol. 239, 1988, pages 1534 - 1536, XP002949269, DOI: 10.1126/science.2451287
VILLEMAGNE, V.L. ET AL.: "In Vivo Evaluation Of A Novel Tau Imaging Tracer For Alzheimer's Disease", EUR. J. NUCL. MED. MOL. IMAGING, vol. 41, 2014, pages 816 - 826
WADIA, J.S. ET AL.: "Transducible TAT-HA Fusogenic Peptide Enhances Escape Of TAT-Fusion Proteins After Lipid Raft Macropinocytosis", NAT. MED., vol. 10, 2004, pages 310 - 315, XP002477563, DOI: 10.1038/nm996
WANG, Y.Y. ET AL.: "Receptor-Mediated Therapeutic Transport Across The Blood-Brain Barrier", IMMUNOTHERAPY, vol. 1, no. 6, 2009, pages 983 - 993, XP008135116, DOI: 10.2217/imt.09.75
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546
WEINER, M.W. ET AL.: "The Alzheimer's Disease Neuroimaging Initiative: A Review Of Papers Published Since Its Inception", ALZHEIMERS. DEMENT., vol. 9, 2013, pages e111 - e194
WHITLOW, M. ET AL.: "An Improved Linker For Single-Chain Fv With Reduced Aggregation And Enhanced Proteolytic Stability", PROTEIN ENG., vol. 6, 1993, pages 989 - 995, XP055671247, DOI: 10.1093/protein/6.8.989
WIGLER ET AL., CELL, vol. 14, 1978, pages 725
WINTER, G. ET AL.: "Making Antibodies By Phage Display Technology", ANNU. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455, XP000564245, DOI: 10.1146/annurev.iy.12.040194.002245
WU ET AL., PROC. NATL. ACAD. SCI. (U.S.A., vol. 95, 1998, pages 6037
XIA, C.F. ET AL.: "[(18)F]T807, A Novel Tau Positron Emission Tomography Imaging Agent For Alzheimer's Disease", ALZHEIMERS. DEMENT., vol. 9, 2013, pages 666 - 676, XP002731790, DOI: 10.1016/j.jalz.2012.11.008
XIONG, C.-Y. ET AL.: "Development Of Tumor Targeting Anti-MUC-1 Multimer: Effects Of di-scFv Unpaired Cysteine Location On PEGylation And Tumor Binding", PROTEIN ENGINEERING DESIGN AND SELECTION, vol. 19, no. 8, 2006, pages 359 - 367, XP009147927, DOI: 10.1093/protein/gzl020
YANAMANDRA, K. ET AL.: "Anti-Tau Antibodies That Block Tau Aggregate Seeding In Vitro Markedly Decrease Pathology And Improve Cognition in vivo", NEURON, vol. 80, 2013, pages 402 - 414, XP002720174, DOI: 10.1016/j.neuron.2013.07.046
YELTON ET AL., J. IMMUNOLOGY, vol. 155, 1995, pages 1994
ZHANG, W. ET AL.: "A Highly Selective And Specific PET Tracer For Imaging Of Tau Pathologies", J. ALZHEIMERS. DIS., vol. 31, 2012, pages 601 - 612, XP009178428

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10562962B2 (en) 2015-07-13 2020-02-18 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau and methods of use thereof
US10934348B2 (en) 2015-07-13 2021-03-02 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau and methods of use thereof
US11739140B2 (en) 2015-07-13 2023-08-29 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau and methods of use thereof
EP3334761A4 (en) * 2015-08-13 2019-04-24 New York University ANTIBODY BASED FOR THE {P} SER404 EPITOP OF TAU SELECTIVE MOLECULES AND THEIR USES IN THE DIAGNOSIS AND TREATMENT OF TAUOPATHY
US10358503B2 (en) 2015-08-13 2019-07-23 New York University Antibody-based molecules selective for the {P}Ser404 epitope of Tau and their uses in the diagnosis and treatment of tauopathy
US11111290B2 (en) 2016-07-12 2021-09-07 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau and methods of use thereof
US12129289B2 (en) 2016-07-12 2024-10-29 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau and methods of use thereof
WO2018049219A1 (en) * 2016-09-08 2018-03-15 Regenerative Research Foundation Bi-functional anti-tau polypeptides and use thereof
US11827683B2 (en) 2016-09-08 2023-11-28 Regenerative Research Foundation Bi-functional anti-tau polypeptides and use thereof
EP3509622A4 (en) * 2016-09-08 2020-06-17 Regenerative Research Foundation BIFUNCTIONAL ANTI-TAU POLYPEPTIDES AND USE THEREOF
US11072639B2 (en) 2016-09-08 2021-07-27 Regenerative Research Foundation Bi-functional anti-tau polypeptides and use thereof
CN110267985A (zh) * 2017-01-04 2019-09-20 H.隆德贝克有限公司 用于治疗眼科疾病的特异性针对过度磷酸化τ蛋白的抗体
JP7217710B2 (ja) 2017-01-04 2023-02-03 ハー・ルンドベック・アクチエゼルスカベット 眼疾患の治療のための過リン酸化タウに特異的な抗体
CN110267985B (zh) * 2017-01-04 2023-05-23 H.隆德贝克有限公司 用于治疗眼科疾病的特异性针对过度磷酸化τ蛋白的抗体
US10995137B2 (en) 2017-01-04 2021-05-04 H. Lundbeck A/S Antibodies specific for hyperphosphorlated tau for the treatment of ocular diseases
JP2020506954A (ja) * 2017-01-04 2020-03-05 ハー・ルンドベック・アクチエゼルスカベット 眼疾患の治療のための過リン酸化タウに特異的な抗体
WO2018127519A1 (en) * 2017-01-04 2018-07-12 H. Lundbeck A/S Antibodies specific for hyperphosphorylated tau for the treatment of ocular diseases
US11370832B2 (en) 2017-02-17 2022-06-28 Denali Therapeutics Inc. Anti-Tau antibodies and methods of use thereof

Also Published As

Publication number Publication date
US20190025331A1 (en) 2019-01-24
EP3166688B1 (en) 2024-08-21
US11519920B2 (en) 2022-12-06
US20170212131A1 (en) 2017-07-27
US20210055309A1 (en) 2021-02-25
US10859582B2 (en) 2020-12-08
JP6913018B2 (ja) 2021-08-04
ES2985805T3 (es) 2024-11-07
US10132818B2 (en) 2018-11-20
EP3166688C0 (en) 2024-08-21
CN107073297A (zh) 2017-08-18
CN107073297B (zh) 2021-09-14
EP3166688A1 (en) 2017-05-17
EP3166688A4 (en) 2017-12-20
JP2017532288A (ja) 2017-11-02

Similar Documents

Publication Publication Date Title
US11519920B2 (en) Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy
US11739140B2 (en) Antibodies specific for hyperphosphorylated tau and methods of use thereof
US11958898B2 (en) Antibody-based molecules specific for the truncated ASP421 epitope of Tau and their uses in the diagnosis and treatment of tauopathy
EP3334761B1 (en) Antibody-based molecules selective for the {p}ser404 epitope of tau and their uses in the diagnosis and treatment of tauopathy
JP2020506954A (ja) 眼疾患の治療のための過リン酸化タウに特異的な抗体
US12365724B2 (en) Antibodies binding to phospho-tau comprising phosphorylated Ser396 and Ser404 and methods of detecting thereof
HK1235022A1 (en) Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy
HK1235022B (en) Tau imaging ligands and their uses in the diagnosis and treatment of tauopathy
HK1250659B (en) Antibody-based molecules specific for the truncated asp421 epitope of tau and their uses in the diagnosis and treatment of tauopathy
HK1250659A1 (en) Antibody-based molecules specific for the truncated asp421 epitope of tau and their uses in the diagnosis and treatment of tauopathy

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15818480

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 15324141

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2017500891

Country of ref document: JP

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015818480

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015818480

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE