WO2015198245A1 - Compositions and methods for visualization of the vitreous - Google Patents
Compositions and methods for visualization of the vitreous Download PDFInfo
- Publication number
- WO2015198245A1 WO2015198245A1 PCT/IB2015/054747 IB2015054747W WO2015198245A1 WO 2015198245 A1 WO2015198245 A1 WO 2015198245A1 IB 2015054747 W IB2015054747 W IB 2015054747W WO 2015198245 A1 WO2015198245 A1 WO 2015198245A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- composition
- vitreous
- agent
- eye
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0013—Luminescence
- A61K49/0017—Fluorescence in vivo
- A61K49/005—Fluorescence in vivo characterised by the carrier molecule carrying the fluorescent agent
- A61K49/0056—Peptides, proteins, polyamino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0013—Luminescence
- A61K49/0017—Fluorescence in vivo
- A61K49/0019—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules
- A61K49/0021—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules the fluorescent group being a small organic molecule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0013—Luminescence
- A61K49/0017—Fluorescence in vivo
- A61K49/0019—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules
- A61K49/0021—Fluorescence in vivo characterised by the fluorescent group, e.g. oligomeric, polymeric or dendritic molecules the fluorescent group being a small organic molecule
- A61K49/0041—Xanthene dyes, used in vivo, e.g. administered to a mice, e.g. rhodamines, rose Bengal
- A61K49/0043—Fluorescein, used in vivo
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0063—Preparation for luminescence or biological staining characterised by a special physical or galenical form, e.g. emulsions, microspheres
- A61K49/0069—Preparation for luminescence or biological staining characterised by a special physical or galenical form, e.g. emulsions, microspheres the agent being in a particular physical galenical form
- A61K49/0076—Preparation for luminescence or biological staining characterised by a special physical or galenical form, e.g. emulsions, microspheres the agent being in a particular physical galenical form dispersion, suspension, e.g. particles in a liquid, colloid, emulsion
- A61K49/0084—Preparation for luminescence or biological staining characterised by a special physical or galenical form, e.g. emulsions, microspheres the agent being in a particular physical galenical form dispersion, suspension, e.g. particles in a liquid, colloid, emulsion liposome, i.e. bilayered vesicular structure
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K49/00—Preparations for testing in vivo
- A61K49/001—Preparation for luminescence or biological staining
- A61K49/0063—Preparation for luminescence or biological staining characterised by a special physical or galenical form, e.g. emulsions, microspheres
- A61K49/0069—Preparation for luminescence or biological staining characterised by a special physical or galenical form, e.g. emulsions, microspheres the agent being in a particular physical galenical form
- A61K49/0089—Particulate, powder, adsorbate, bead, sphere
- A61K49/0091—Microparticle, microcapsule, microbubble, microsphere, microbead, i.e. having a size or diameter higher or equal to 1 micrometer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
- A61K9/0051—Ocular inserts or implants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P41/00—Drugs used in surgical methods, e.g. surgery adjuvants for preventing adhesion or for vitreum substitution
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4718—Cytokine-induced proteins
Definitions
- the invention relates to compositions, methods, and uses for protein-based, long-lasting agents for injection into the vitreous humor in mammalian eyes.
- the invention also relates to the use of such compositions during ophthalmic surgery, for example, during vitrectomy surgery, and their use as biosensors.
- vitreous body In the eye, the cavity between the lens and the retina is filled with a clear, jelly- like substance termed the vitreous body, vitreous humor, or vitreous, its volume is fixed and is relatively permanent.
- the vitreous humor is 99% water, with most of the remaining 1 % composed of salts (sodium, chloride, bicarbonate, etc.), collagen, and hyaluronan (hyaluronic acid).
- salts sodium, chloride, bicarbonate, etc.
- collagen hyaluronan
- hyaluronic acid hyaluronic acid
- the outer surface of the vitreous is normally weakly adherent to the retina and ciliary body, with a somewhat tighter attachment at the macula, at the far periphery of the retina near the ora serrata, and at the pars plana of the ciliary body.
- pathological conditions such as rhegmatogenous retinal detachment, macular hole, vitreomacular traction syndrome, and proliferative vitreoretinopathy, the attachment of the vitreous to the retina mediates or facilitates damage to the retina.
- the vitreous syneresis contracts (a process called vitreous syneresis), and the contraction can produce traction on the retina ultimately inducing a tear or hole in the retina and a consequent retinal detachment or macular hole.
- the attachment may serve as a scaffold for fibrous, fibre-vascular, or fibrogiial proliferation emanating from the retina, a process called proliferative vitreoretinopathy.
- the fibrous membranes in proliferative vitreoretinopathy can contract and cause retinal tears, retinal holes, and retinal detachments, ail of which can lead to blindness.
- Vitrectomy can also be step in the process of other types of retinal surgery. Examples include the vitrectomy that typically accompanies the removal of foreign bodies that may have entered the vitreous body traumatically or iatrogenically, or the vitrectomy that accompanies the injection of a gene therapy vector under the retina, or the vitrectomy performed in eyes with infectious endophthalmitis to remove microorganisms and make space for the injection of antibiotics.
- the surgical procedure of vitrectomy itself can produce complications.
- vitreous Many surgical procedures of the retina, such as the removal of epiretinai membranes, require complete dissection of the vitreous away from the retina to be optimally efficacious.
- the transparency of vitreous makes it challenging for the surgeon to visualize and hence completely remove the vitreous.
- a surgeon performing a vitrectomy may not be absolutely certain whether the posterior surface of the vitreous (called the posterior hyaloid) is completely separated from the retina and whether a complete vitrectomy has been achieved. While the surgeon attempts a complete removal of the vitreous near the retina, he or she may inadvertently cut into the retina and thereby create iatrogenic retinal defects or holes or possibly remove irreplaceable neural elements essential for vision.
- iatrogenic damage to the retina is still a recognized potential complication of vitrectomy.
- methods and agents to improve the visualization of the vitreous during a surgical procedure, and hence to ensure the accuracy of the procedure are desirable to achieve better functional and anatomical outcomes.
- the invention is directed to a method to alleviate a structural disorder of an eye.
- the method comprises injecting a vitreous-delineating composition into the eye in an effective amount to allow the vitreous to be visible to a surgeon while simuilaneousiy maintaining the view of intraocular structures such as the retina, thereby enabling the surgeon to alleviate the disorder in a safer and more efficacious manner.
- the composition may comprise a therapeutic agent, an inert agent, or an inert agent that contains a therapeutic agent, such as a microsphere or liposome containing a therapeutic agent.
- the composition may be in a formulation such as a solution, an emulsion, or a suspension .
- the invention is additionally directed to a composition for visualizing a vitreous cavity in a mammalian eye during surgery.
- the composition is a vitreous delineating agent that binds hyaluronan throughout the vitreous humor to render the vitreous gel visible to the surgeon.
- the formulation of the composition is preferably injectable, and may be translucent, fluorescent, phosphorescent, opaque, or semi-opaque.
- the invention provides a surgical method to alleviate a disorder of an eye caused or mediated by the vitreous comprising : injecting into the eye a composition comprising a peptide that binds hyaluronan (HA) which is linked to an optically detectable moiety.
- HA hyaluronan
- the invention further provides a composition for visualizing the vitreous in a mammalian eye comprising an injectable formulation of a peptide that binds hyaluronan (HA) linked to an optically detectable moiety as a vitreous delineating agent in an effective amount that associates with HA in the vitreous to render it visible to a surgeon.
- a composition for visualizing the vitreous in a mammalian eye comprising an injectable formulation of a peptide that binds hyaluronan (HA) linked to an optically detectable moiety as a vitreous delineating agent in an effective amount that associates with HA in the vitreous to render it visible to a surgeon.
- HA hyaluronan
- the invention further provides an ophthalmic composition for visualizing the vitreous in a mammalian eye comprising a peptide that binds hyaluronan (HA) linked to an optically detectable moiety in an effective amount that associates with HA in the vitreous to render the vitreous visible when a signal is generated by the detectable moiety.
- HA hyaluronan
- the invention also provides a method of staining the vitreous in a mammalian eye comprising (a) injecting a composition comprising a peptide that binds hyaluronan (HA) linked to an optically detectable moiety into the mammalian eye and (b) applying an energy source (e.g. , a light or laser light) to the eye to generate a signal from the detectable moiety.
- a composition comprising a composition comprising a peptide that binds hyaluronan (HA) linked to an optically detectable moiety into the mammalian eye
- an energy source e.g. , a light or laser light
- the optically detectable moiety is luminescent, photoluminescent, electroluminescent, bioluminescent, chemiluminescent, fluorescent, or phosphorescent, or is a chromophore.
- the peptide comprises a sequence selected from the group consisting oi:
- SEQ ID NO: 2 SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8 and SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1 , SEQ ID NO: 12 and SEQ ID NO: 13; or
- a composition of the invention further includes a therapeutic agent that is, for example, an anti-infective agent, an immunosuppressant agent, an antiproliferative agent, an anti-angiogenesis agent, a wound healing agent, an anti-scarring agent, or combinations thereof.
- a therapeutic agent that is, for example, an anti-infective agent, an immunosuppressant agent, an antiproliferative agent, an anti-angiogenesis agent, a wound healing agent, an anti-scarring agent, or combinations thereof.
- a composition of the invention is injected prior to or during a vitrectomy.
- compositions may comprise a peptide that binds, or is capable of binding, hyaiuronan (HA), in certain aspects the HA peptide composition binds HA in the eye with a KD of less than or equal to 100 ⁇ , 90 ⁇ , 80 ⁇ , 70 ⁇ , 60 ⁇ , 50 ⁇ , 40 ⁇ , 30 ⁇ , 20 ⁇ , or 10 ⁇ . in certain preferred embodiemnts, a composition of the invention binds HA in the eye with a KD of less than or equal to 9.0 ⁇ .
- HA hyaiuronan
- the peptide can bind HA with a KD of less than or equal to, 8.5 ⁇ , 8.0 ⁇ , 7.5 ⁇ , 7.0 ⁇ , 8.5 ⁇ , 6.0 ⁇ , 5.5 ⁇ , 5.0u ⁇ , 4.5 ⁇ , 4.0 ⁇ , 3.5 ⁇ , 3.0 ⁇ , 2.5 ⁇ , 2.0 ⁇ , 1 .5 ⁇ , 1 .0 ⁇ or 0.5 ⁇ .
- the peptide binds HA with a KD of less than or equal to 8.0 ⁇ .
- the peptide binds HA with a KD of less than or equal to 7,2 ⁇ .
- the peptide binds HA with a KD of less than or equal to 5.5 ⁇ .
- the peptide may comprise a sequence of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13. It is also contemplated that the peptide tag is linked to a therapeutic agent, such as a protein or a nucleic acid.
- FIG. 3A is a photo of a rabbit eye before being injected with a composition of the invention.
- FIG. 3B is a photo of a rabbit eye using autofiuorescence wide angle imaging
- FIG. 4A is a photo of a rabbit eye using autofiuorescence wide angle imaging and 80% gain 16 hours after being injected with 2.5 ⁇ of a composition of the invention
- FIG. 4B is a photo of a rabbit, eye using autofiuorescence wide angle imaging and 80% gain 16 hours after being injected with 5 fig of a composition of the invention.
- FIG. 5A is a photo of a rabbit eye using autofiuorescence wide angle imaging and 80% gain 24 hours after being injected with a composition 2,5 , g of the invention.
- FIG. 5B is a photo of a rabbit eye using autofiuorescence wide angle imaging and 80% gain 24 hours after being injected with 5 fig of a composition of the invention
- FIG. 6A is a photo of a rabbit eye using autofiuorescence wide angle imaging and
- FIG. 6B is a photo of a rabbit eye using autofiuorescence wide angle imaging and 80% gain 48 hours after being injected with 5 ⁇ g of a composition of the invention.
- FIG. 7A is a photo of a rabbit eye using autofiuorescence wide angle imaging and 80% gain 72 hours after being injected with a composition 2.5 of the invention.
- FIG. 7B is a photo of a rabbit eye using autofiuorescence wide angle imaging and 80% gain 72 hours after being injected with 5 ⁇ g of a composition of the invention.
- compositions comprising a peptide that binds hyaiuronan (HA) linked to an optically detectable moiety are provided.
- a composition of the invention can be used, for example, as a vitreous delineating 5 composition (for example to facilitate ocular surgery), as a sensor composition (for example to monitor and assess the presence of a desired analyte in the vitreous), and as a intravitreal pH assessing composition.
- vitreous delineating compositions comprising a peptide that binds hyaiuronan (HA) linked to an optically detectable moiety to improveQ visualization of the vitreous during surgery to alleviate a structural disorder of an eye.
- Delineation of the vitreous assists the surgeon in separation of the posterior hyaloid and complete removal of vitreous during a procedure such as a pars plana vitrectomy.
- the composition is introduced into the vitreous and binds to hyaiuronan in the eye throughout the vitreous humor, increasing the visualization of the vitreous5 throughout.
- the visible vitreous delineating agent provided for example as a solution, suspension or emulsion, diffuses throughout the vitreous over the course of a few hours, in doing so, the vitreous is now in sharp contrast with the fundus and allows the surgeon to clearly distinguish the vitreous from the retina.
- the localization of the composition to the vitreous and not the retina is due to the composition's affinity for hyaiuronan and the0 much higher concentration of hyaiuronan in the vitreous compared to the retina or to any other ocular structures, in fact, the hyaluronic acid concentration in the vitreous (0.1 to Q.4 mg/ml) is higher than almost any other tissue of the human body.
- the delineating composition is preferably an inert agent, lacking pharmacologic activity thereby making it safe and not associated with toxicity or adverse reactions prior to or during a surgery.5
- the composition is preferably delivered into an eye by injection. It diffuses through the vitreous and forms reversible complexes with hyaiuronan in the vitreous. Because the composition can be colored or otherwise optically apparent (e.g., innately or detectable upon contact with an energy source), it delineates or demarcates the vitreous and in effect "lights up" the vitreous humor by a visible signal generated by the optically0 detectable moiety under the appropriate conditions. This improves visualization of the vitreous and its posterior hyaloid for the surgeon.
- a vitreous delineating composition of the invention can be visualized episodically or transiently at any time during surgery and at the will of the surgeon by the surgeon or surgical assistant applying an energy source such that the composition exhibits fluorescent5 properties.
- a vitreous delineating composition of ihe invention can be visualized continually, for example during the course of a surgery.
- a composition oi the invention can be rendered visible to the surgeon during surgery.
- an energy source such as a light
- Visualization may be with the naked eye or with the assistance of instrumentation such as an operating microscope depending on the moiety used in a composition of the invention.
- a suitable detectable substance as an optically detectable moiety based on the intended use of a composition of the invention.
- a composition comprising a fluorescent moiety may be preferred, thus enabling a surgeon to view the vitreous at will by turning on a light energy source with a particular wavelength and intensity to excite the substance for visualizing the vitreous at any time during a surgery, and turning off the light energy source so the composition is not visible when necessary during the surgical procedure.
- a surgeon removed vitreous as part of the procedure i.e. , during a vitrectomy
- the agent would disappear along with the vitreous. Regions of vitreous cavity with residual vitreous could be easily recognized and the surgeon could devote attention to those areas. Complete absence of the color or fluorescence in the vitreous would indicate thai the vitrectomy was complete.
- Vitreous concentrations of drugs correlate with their concentrations in blood , with the correlations dependent on physicochemicai properties of the drugs (e.g. , their solubility and lipophilicity).
- Forensic specialists sometimes measure the levels of drugs or toxins in the vitreous as a surrogate to measuring them in the blood (for example, see Knittel et a/. , 2009, J. Anal. Toxicol. 33:434-438).
- a sensor composition of the invention as described herein can be used to measure metabolic and pharmacologic changes in the eye and in the body once residing in the vitreous.
- composition of the invention can be used to assess and monitor in vivo drugs and/or metabolites in the vitreous, thus providing long-lasting "biosensors" in the vitreous that provide a visual signal correlating with a chemical compound of interest.
- Compositions of the invention can be used , for example, to allow in vivo, repeated measurements in animals thereby reducing the numbers of animals typically used for such studies and improving the accuracy of the measurements, since each eye can be followed longitudinally over time.
- the invention provides a composition comprising a peptide that binds hyaiuronan (HA) linked to an optically detectable moiety.
- HA hyaiuronan
- a composition of the invention can further comprise a therapeutic agent and/or an inert substance in addition to an HA-binding peptide with or without an optically detectable moiety.
- the term "therapeutic agent” refers to a compound, such as a protein, nucleic acid or small molecule, useful to treat, prevent or ameliorate a disease, condition or disorder.
- a therapeutic agent useful in a composition of the invention include an anti-infective agent, an immunosuppressant agent, an anti-proliferative agent, an anti-angiogenesis agent, a wound healing agent, and an anti-scarring agent. Combinations thereof can also be included in a composition of the invention.
- inert substance refers to a substance that is chemically and pharmacologically inactive in the eye, including but not limited to a blank microsphere or liposome.
- An inert substance useful in a composition of the invention is a substance that is visible or can be rendered visible during the surgical procedure.
- a combination of therapeutic agents and inert substances can be used (for example, a microsphere or liposome containing any of the above therapeutic agents).
- a composition of the invention can further comprise a diagnostic agent.
- the diagnostic agent can be used to detect, assess, and/or monitor progression of a disorder or disease of the eye.
- an "optically detectable moiety” is any substance that can be detected when exposed to certain conditions, and can be a contrasting agent.
- the optically detectable moiety is luminescent, photoluminescent, electroluminescent, bioiuminescent, chemiluminescent, fluorescent, or phosphorescent, or is a chromophore.
- a fluorescent moiety can be excited by exposure to an energy source (e.g., a light) having a specific wavelength and intensity, thereby enabling the composition of the invention to be seen, for example using a surgical microscope with particular filters as known in the art.
- a contrasting agent is a substance that is opaque, for example, to visible light, or is otherwise visibly distinguishable from the vitreous under certain conditions (e.g., in visible light).
- Detectable substances suitable for use in a composition of the invention include, but are not limited to, various enzymes, such as, but not limited to, horseradish peroxidase, alkaline phosphatase, beta-gaiactosidase, or acetylcholinesterase; prosthetic groups, such as, but not limited to, streptavidinlbiotin and avidin/biotin; fluorescent materials, such as, but not limited to, umbeiiiferone, fluorescein, fluorescein isothiocynate, rhodamine, dichlorotriazinylamine fluorescein, dansyi chloride or phycoerythrin; luminescent materials, such as, but not limited to, luminal; bioluminescent materials, such as but not limited to, luciferas
- a colored substance can be used in a composition of the invention as the optically detectable moiety.
- a "colored substance” preferably has no bioactivity, and is present in a sufficiently low dose so as to maintain visualization of the fundus when injected into the eye.
- colored substances that can be used in a composition of the invention include polylactic acid particles and polylactic acid.
- an HA-binding peptide is linked to an haiochromic moiecule, and is useful for determining the pH in a mammalian eye non-invasively and in vivo.
- Haiochromic molecules change color according to the pH of their environment.
- the haiochromic molecule can change color, and is therefore detectable, in the physiologic pH range of around 7.0 to 7.6.
- a single intravitreal injection of a composition of the invention can be used to repeatedly measure intraocular pH over the course of hours, days, and weeks by checking the color of the vitreous at desired time points.
- an HA-binding peptide is linked to a fluorescent chemosensing material.
- a fluorescent chemosensing material include, but are not limited to, fluorescent polymers, sol-gel materials, mesoporous materials, surfactant aggregates, silica and polymer-based nanoparticles, and quantum dots.
- a sensor composition of the invention can be designed to measure any desired compound, such as therapeutic drug and physiologic metabolites.
- Such sensors can be useful for monitoring and assessing the presence of certain molecules for days, weeks, and months after injection into the eye or after entering the eye from the blood or from pericoular tissues such as the conjunctiva or orbital tissues, provided that the sensor is linked to a peptide like HA10 that mediates a long residence time in the vitreous, as described herein.
- Standard optical techniques such as but not limited to a fluorophotometer instrument, can be used to monitor fluorescence of a sensor composition of the invention.
- Sensing the vitreous levels of desired sensed materials can be used to monitor and assess ocular processes as well as processes elsewhere in the body, such as the metabolic state of a patient or exposure to systemic drugs or locally administered drugs.
- a sensor composition of the invention can also be useful in personalized medicine for therapeutic drug monitoring as described, for example, in Griss et a/. , 2014, Nature Chemical Biology, published online June 8, 2014, DPI: 10.1038/NCHEMBIO.1554, the contents of which are incorporated by reference in its entirety.
- the compositions are also useful in research to monitor the status of an animal's physiologic state during experimental manipulations.
- the invention provides a method of monitoring analytes in the eye. Such methods are useful, for example, to facilitate pharmacokinetic studies of therapeutic drugs injected into the eye, applied topically to the eye, or reaching the eye through systemic administration.
- hyaluronan or "hyaluronic acid” or “HA” refers to a large polymeric glycosamine containing repeating disaccharide units of /V-acetyi glucosamine and glucuronic acid that occurs in extracellular matrix and on cell surfaces.
- Hyaluronan is further described in J. Necas, L. Bartosikova, P. Brauner, J. Kolar, Veterinarni Medicina, 53, 2008 (8): 397-41 1 .
- hyaladherin or "hyaluronan binding proteins” or “HA binding proteins” refers to a protein or a family of proteins that bind hyaluronan.
- putative HA binding proteins are known in the art (Day, et al. 2Q02 J Bio. Chem 277:7, 4585 and Yang, et al. 1994, EMBO J 13:2, 288-296) (e.g.: Link, CD44, RHA , Aggrecan, Versican, bacterial HA synthase, collagen VI, and TSG-6).
- HA binding proteins and peptide fragments, contain a common structural domain of -100 amino acids in length involved in HA binding; the struciural domain is referred to as a "LINK Domain” (Yang, et a/. 1994, EMBO J 13:2, 286-296 and ahoney, et aL 2001 , J Bio. Chem 276:25, 22764-22771 ).
- the LINK Domain of TSG-6 an HA binding protein, includes amino acid residues 36-128 of the human TSG-6 sequence.
- a composition of the invention comprises at least one hyaluronan (HA) binding peptide that specifically binds hyaluronan in the eye.
- HA hyaluronan
- Hyaluronan is present, in the body in various sizes in many organs in tissues.
- the human eye and synovial fluid contain the highest concentrations of hyaluronan with 0.14-0.338 mg/mi in the vitreous and 1 .42-3.6 mg/mi in joints, respectively, while other tissues and fluids contain much lower concentrations of hyaluronan such as serum in which hyaluronan concentrations are 0.00001 -0.0001 mg/ml (Laurent and Fraser, 1986 Ciba Found Symp. 1986;124:9-29).
- Non-ocular hyaluronan mainly consists of low molecular weight polymers that are rapidly degraded and turned over. In humans, hyaluronan has a half-life of 2.5-5 minutes in blood (Fraser JR, Laurent TC, Pertoft H, Baxter E. Biochem J. 1981 Nov 15;200(2):415-24.). In contrast, ocular hyaluronan mainly consists of high molecular weight polymers (>0.5 X 10 ⁇ 5 daltons) and has a slower turnover rate of days or weeks (Laurent and Fraser, Exp. Eye Res. 1983; 36, 493-504). Due to these differences in the size and turnover of hyaluronan in the eye, the hyaluronan in the eye would serve as a sustained release scaffold for intravitreal proteins and nucleic acids linked to an HA-binding peptide.
- hyaluronan binding proteins have been described in the art (J. Necas, L. Bartosikova, P. Brauner, J. Kolar. Veierinarni Medicina, 53, 2008 (8): 397-41 1); examples are tumor necrosis factor-inducible gene 6 protein (TSG6), hyaluronan mediated motility receptor (RHA M), CD44 antigen, hyaluronan and proteoglycan link protein 4, neurocan core protein, atabilin-2, and human glial hyaluronate-binding protein.
- TSG6 tumor necrosis factor-inducible gene 6 protein
- RHA M hyaluronan mediated motility receptor
- CD44 antigen hyaluronan and proteoglycan link protein 4
- neurocan core protein atabilin-2
- human glial hyaluronate-binding protein examples are tumor necrosis factor-inducible gene 6 protein (TSG6), hyaluronan mediated
- the present invention is based on the surprising discovery of peptides that effectively bind HA in the eye. This discovery prompted the secondary discovery that their use would delineate the vitreous when linked to a suitable optically detectable moiety, and thus would be suitable for facilitating ocular surgery where it is advantageous to visualize the vitreous, such as during a vitrectomy, or for use as long-lasting biosensors in the vitreous in the eye.
- the peptide tag binds HA in the eye with a KD of less than or equal to 100 ⁇ , 90 ⁇ , 80 ⁇ , 70 ⁇ , 60 ⁇ , 50 ⁇ , 40 ⁇ , 30 ⁇ , 20 ⁇ , or 10 ⁇ .
- a composition of the invention can bind HA in the eye with a KD of less than or equal to 9,0 ⁇ , iess than or equal to 8,5 ⁇ , less than or equal to 8.0 ⁇ , less than or equal to 7,5 ⁇ , less than or equal to 7.0 ⁇ , less than or equal to 6.5 ⁇ , less than or equal to 6,0 ⁇ , less than or equal to 5.5 ⁇ , less than or equal to 5.0 ⁇ , less than or equal to 4,5 ⁇ , less than or equal to 4.0 ⁇ , less than or equal to 3.5 ⁇ , less than or equal to 3,0 ⁇ , less than or equal to 2.5 ⁇ , less than or equal to 2.0 ⁇ , less than or equal to 1 ,5 ⁇ , less than or equal to 1 .0 ⁇ , less than or equal to 0.5 ⁇ , or less than or equal to 100 nM.
- the peptide binds HA in the eye with a KD of iess than or equal to 8.0 ⁇ , less than or equal to 7.2 ⁇ , less than or equal to 6.0 ⁇ , or iess than or equal to 5.5 ⁇ .
- the peptide that binds HA has a LINK domain
- the LINK domain is a TSG-6 LINK domain. Modified versions of the peptide that also resisi proteolytic cleavage and/or glycosyiation can be utilized, or thai facilitate manufacture of the pepiides.
- the invention may include a peptide thai binds, or is capable of binding, HA comprising a sequence of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13. It is contemplated that the peptide comprising a sequence of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13, binds, or is capable of binding, HA in the eye of a subject, it is contemplated that the peptide may be any one of the peptides listed in Table 1 .
- the peptide may be HA10, HA10.1 , HA1 Q.2, HA1 1 , HA1 1 .1 , HA 10.1 .1 , NVS-A, NVS-X, NVS-Y, NVS-AX, NVS-AY, HA 1 1 .APP (MBG100), or HA 1 1 . HIS (MBG103).
- HA-binding peptides useful in a composition of the invention are also described in U.S. Application Serial No. 14/109426, the entire contents of which are incorporated by reference.
- the HA-binding peptide is or comprises the underlined portion of sequences in SEQ ID NOs: 6, 12, or 13,
- SEQ ID NO: 6 Protein GGGGGGSGGGGVYHREAQSGKYYLTYAEA
- SEQ ID NO: 1 Protein ACGVYHREAISGKYYLTYAEAKAVCEFEGGH
- SEQ ID NO: 12 Protein GGGGGGSGGGACGVYHREAQSGKYYLTYA
- SEQ ID NO: 14 DNA of GGAGTCTATCACAGAGAGGCTAGATCAGG
- SEQ ID NO: 18 DNA of GGAGTCTATCACAGAGAGGCTGCTAGCGG
- SEQ ID NO: 17 DNA of GGCGCCTGTGGCGTGTATCACAGGGAGGC
- SEQ ID NO: 18 DNA of GGAGTGTATCACAGAGAGGCCCAGAGCGG
- the peptide can have a sequence comprising 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 91 , 92, 93, 94, 95, 96, 97 or 98 consecutive amino acids of SEQ ID NOs: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13.
- a peptide is a truncated variant of a peptide comprising a sequence of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13.
- Amino acids may be cleaved from the N-ierminus, C-terminus or both of the peptide comprising a sequence of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13 to produce a truncated variant of the peptides HA10, HA10.1 , HA10.2, HA1 1 , HA1 1 .1 , NVS-A, NVS-X, NVS-Y, NVS-AX, NVS-AY, HA 1 1 .APP (MBG100), or HA 1 1 .HIS (MBG103). It. is further contemplated that.
- the sequence may be cleaved from the N-terminus of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13 up to and (but. not including) the first. N-ferminai cysteine. It is further contemplated that the sequence may be cleaved from the C-terminus of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13 up to and (but not including) the first C-terminai cysteine.
- sequence may be cleaved from both the N- terminus and the C-terminus of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13 up to (but not including) the first N-terminal cysteine and (but not including) the first C- terminal cysteine.
- SEQ ID NO: 1 one of skill in the art could remove up to 22 amino acids from the N-terminai end (bold) and/or up to six amino acids from the C-ierminal end (underline):
- GVYH EA SG YKLTYAEA AVCEFEGGHLATYKQLEAARKiGFHVCAAGWIVI AKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAK SEQ ID NO: 1.
- a single peptide is linked to an optically detectable moiety.
- two, three, four or more peptide tags maybe linked to the optically detectable moiety.
- two, three, four, or more optically detectable moieties may be linked to one HA-binding peptide.
- the HA-binding peptide can be linked to an optically detectable moiety using conventional methods known to those skilled in the art.
- an HA-binding peptide can be expressed by transient transfection of mammalian expression vector in HEK293 cells and purified using standard affinity resins and conjugated with a fluorophore as described herein below.
- the present invention provides peptides that can be recombinantiy fused (i.e., linked) or chemically conjugated (including both covended and non-covalent conjugations) to other molecules such as fluorophores, chromophores, protein biosensors, other proteins, or nucleic acids.
- the peptide binds HA.
- the peptide binds HA and comprises a LINK Domain.
- the peptide binds HA and comprises a TSG-6 LINK Domain.
- the peptide may be HA10 (SEQ ID NO: 1 ), HA10.1 (SEQ ID NO: 2), HA10.2 (SEQ ID NO: 3), HA1 1 (SEQ ID NO: 4) or HA1 1 .1 (SEQ ID NO: 5), HA 10.1 .1 (SEQ ID NO: 6), NVS-A (SEQ ID NO: 7), NVS-X (SEQ ID NO: 8), NVS-Y (SEQ ID NO: 9), NVS-AX (SEQ ID NO: 10), NVS-AY (SEQ ID NO: 1 1), HA 1 1 .APP ( BG100) (SEQ ID NO: 12), or HA 1 1 . HIS (MBG103) (SEQ ID NO: 13),
- the peptide can also be a peptide described in U.S. Application Serial No. 14/109426, the entire contents of which are hereby incorporated by reference.
- Standard molecular biology techniques can be used to prepare and express an HA-binding peptide or peptide sequences to be used in a composition of the invention.
- the HA-binding peptides can be fused to small peptide sequences to facilitate manufacture and purification.
- the marker amino acid sequence is a hexa-histidine peptide, such as the marker provided in a pQE vector (QIAGEN®, Inc., 9259 Eton Avenue, Chatsworth, CA, 9131 1 ), among others, many of which are commercially available.
- a pQE vector QIAGEN®, Inc., 9259 Eton Avenue, Chatsworth, CA, 9131 1
- hexa-histidine provides for convenient purification of the fusion protein.
- hemagglutininin tag which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., 1984, Gell 37:767), and the "flag" tag.
- compositions comprising a peptide of the invention, for example a peptide that binds HA in the eye with a KD of less than or equal to 100 ⁇ , 90 ⁇ , 80 ⁇ , 70 ⁇ , 60 ⁇ , 50 ⁇ , 40 ⁇ , 30 ⁇ , 20 ⁇ , 10 ⁇ , 9.0 ⁇ , 8.5 ⁇ , 8.0 ⁇ , 7.5 ⁇ , 7.0 ⁇ , 6,5 ⁇ , 6.0 ⁇ , 5.5 ⁇ , 5.0 ⁇ , 4,5 ⁇ , 4.0 ⁇ , 3.5 ⁇ , 3.0 ⁇ , 2.5 ⁇ , 2.0 ⁇ , 1 .5 ⁇ , 1 .0 ⁇ , or 0.5 ⁇ .
- the peptide may comprise the sequence of SEQ ID NO: 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, or 13, formulated together, or separately, with a pharmaceutically acceptable excipient, diluent or carrier.
- the invention also provides compositions comprising HA tagged optically detectable moiety molecules (e.g., a peptide linked to an optically detectable moiety), formulated together, or separately, with a pharmaceutically acceptable excipient, diluent or carrier.
- compositions of the invention comprise a peptide that binds HA in the eye as described above.
- the compositions can additionally contain one or more therapeutic agents that are suitable for treating or preventing, for example, conditions or disorders associated with retinal vascular disease or useful in surgery, such as anti-inflammatory, anti-scarring, and wound healing agents.
- Pharmaceutically acceptable carriers enhance or stabilize the composition, or can be used to facilitate preparation of the composition.
- Pharmaceutically acceptable carriers include solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the pharmaceutically acceptable excipient, diluent or carrier should be suitable for administration to the eye (e.g.
- the invention also provides for methods of producing a composition for ocular delivery wherein the method includes the step of linking a peptide that binds HA in the eye with a KD of less than or equal to 100 ⁇ , 90 ⁇ , 80 ⁇ , 70 ⁇ , 60 ⁇ , 50 ⁇ , 40 ⁇ , 30 ⁇ , 20 ⁇ , 10 ⁇ , 9.0 ⁇ , 8.5 ⁇ , 8.0 ⁇ , 7.5 ⁇ , 7.0 ⁇ , 6.5 ⁇ , 6.0 ⁇ , 5.5 ⁇ , 5.0 ⁇ , 4.5 ⁇ , 4.0 ⁇ , 3.5 ⁇ , 3.0 ⁇ , 2.5 ⁇ , 2.0 ⁇ , 1 .5 ⁇ , 1 .0 ⁇ , or 0.5 ⁇ to an optically detectable moiety (e.g., a fluorophore or chromophore), and is useful for visualizing the vitreous
- an optically detectable moiety e.g., a fluorophore or
- compositions of the invention can be incorporated into vesicles which provide a suitable ophthalmic injectable.
- vesicles include liposomes or microspheres, for example, poly(glycoiic) or poly(lactic) acid microspheres. Incorporation of compositions into liposomes or microspheres can be performed by routine procedures as known to one skilled in the art.
- composition of the present invention can be administered by a variety of methods known in the art.
- the route and/or mode of administration vary depending upon the desired results. It is preferred that the composition be suitable for administration to the eye, more specifically, the composition may be suitable for intravitreal administration.
- a formulation comprising a composition of the invention should be sterile and fluid. Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants. In many cases, it is preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitoi or sorbitol, and sodium chloride in the composition. Long-term absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate or gelatin.
- compositions of the invention for administration to the eye can be prepared in accordance with methods well known and routinely practiced in the art. See, e.g. , Remington: The Science and Practice of Pharmacy, Mack Publishing Co., 20th ed., 2000. Pharmaceutical compositions are preferably manufactured under GMP conditions. in certain embodiments, a composition of the invention is injected into a mammalian eye in an aqueous solution of about 150 ⁇ or less, and the solution comprises at least about 0.Q01 pg of the composition.
- the solution is formulated to deliver about 0.001 pg, 0.01 pg, 0.1 pg, 1 .0 pg, 10 pg, 20 pg, 30, pg, 40 pg, 50 pg, 60 pg, 70 pg, 80 pg, 90 pg, 100 pg, 200 pg, 300 pg, 400 pg, 500 pg, 600 pg, 700 pg, 800 pg, 900 pg, 1 .0 mg, 2.0 mg, 3.0 mg, 4.0 mg, or about 5.0 mg of a composition of the invention per injection, in certain embodiments, the solution is formulated to deliver less than about 1 .0 mg of a composition of the invention per injection. In certain embodiments, the volume of the aqueous solution is about 1 .0 pi to about 150 pi, preferably about 20 pi to about 100 pi.
- a FITC linked HA-binding protein was generated as follows,
- HA-binding peptide (Protein 6 in Table 1 ) was transiently expressed in HEK293F cells using polyethylenimine (PEI) as transfeciion agent with ratio of 1 :3 of plasmid DNA to PEI and grown for five days at 37°C with 5% C0 2 .
- the culture was harvested and the supernatant filtered.
- the conditioned medium was loaded onto nickel resin column, washed with 50 m phosphate buffer containing 20 mM immidazole, 500 m sodium chloride, pH 8 to remove unbound proteins, and gradient eluted with 50 mM phosphate buffer containing 500 mM imidazole, 500 mM sodium chloride, pH 8.
- the purified Protein 8 was site-specifically labeled with fluorescein isothiocyanate on the N-terminus using Sortase-A mediated reaction (see Mao et a!. , 2004, J Am Chem Soc, Mar 10;126(9):2670-1).
- the fluorophore (fluorescein isothiocyanate) - conjugated HA-binding peptide was purified to apparent homogeneity using standard mixed mode and ion exchange resins. Specifically, Protein 6 was buffer exchanged into Sortase labeling buffer (50 mM Tris-HCI, 150 mM sodium chloride, 10 mM CaCI2, pH7.5).
- Reaction mix in the Sortase labeling buffer contained 50 u of Protein 6, 2 mM of FITC- LPETGGG (synthesized by GeneScript) and - 150 uM of Sortase A immobilized on agarose in the sortase labeling buffer.
- the reaction mix was incubated at 23°C for 24 hours with shaking.
- the immobilized Sortase A was separated using 0.2 ⁇ filter.
- the pH of the flowthrough containing labeled and unlabeled Protein 6 was increased to pH 9 with 1 M Tris-HCI, pH 9.5.
- the sample was then loaded over a 5 ml_ CaptoAdhere column, washed with PBS, pH 7.4, and eluted with gradient of 100mM citrate buffer, pH 3. Eluted fractions were neutralized with 1 /10 volume 1 Tris-HCI, pH 9.5.
- the fractions were run on SDS-PAGE gel and imaged under fluorescence mode.
- the final labeled protein
- the animals used in this example were male Rabbit/New Zealand White x New Zealand Red.
- the treatment regimen used is shown in the following Table 2.
- Spectralis® from Heidelberg Engineering, Inc. was used to obtain wide angle photographs of vitreous chamber/retina.
- a wide angle contact lens (Staurenghi 150° contact lens) with a methylcellulose transmission gel placed in contact with the cornea was used to aid visualization of the posterior segment of the eye. The eyelid was retracted; the contact lens was placed on the cornea and positioned in front of the camera by a trained technician,
- Fluorophotometry measures the concentration of a fluorescent compound, typically fluorescein, along the optical axis of the eye from the tear film to the retina. The eyelids were retracted and the animal was piaced in front of the Fluorotron Master by a trained technician. Fluorescein content was then quantified by the fluorophotometer without making contact with the eye. Two to three scans were performed for each eye at each time point. The average from these repeated scans of each individual eye at each time point was used for further analysis. Iniravitreai Injection
- An operating microscope was used to visualize the posterior segment of the eye during the procedure.
- the eyelid was retracted with a wire speculum.
- the globe was immobilized using ocular forceps.
- the target location of the injection was the superior-temporal region.
- test article was observed in the vitreous of the animals by microscopic visualization immediately post-injection at both doses (2 and 5 ug). The color was apparent under standard illumination from the operating microscope without the need for excitation or emission filters. Microscopic visualization at other time-points was not conducted.
- Fiuorophotometry The fluorophotometer measures the fluorescence of the ocular tissue on a linear scan along the optical axis of the eye. A vitreous injection of fluorescein cannot be detected until the fluorescein enters the optical axis of the eye.
- fluorescence of the test article was first observed 16 h after injection in the vitreous cavity (FIG. 4A and FIG. 1). The relative fluorescence in the vitreous was also highest at this time point. The relative fluorescence in the vitreous was similar at the 24 hour time point (FIG. 5A and FIG. 1) with decreases observed at 48 hours (FIG. 6A and FIG. 1) and again at 72 hours (FIG. 7A and FIG. 1 ). No obvious change was noted in the fluorescence level in the anterior segment of the eye (from cornea to lens).
- Chromophore conjugated hyaluronan-binding protein FITC- Protein 6, a glycosylated protein
- FITC- Protein 6 a glycosylated protein
- the high dose 5 pg group demonstrated higher fluorescence in the vitreous than the lower 2.5
- EXAMPLE 2 Ocular Surgery
- the composition of the invention is placed in a formulation suitable for intravitreai injection (i.e. , with the appropriate pH, osmolarity, low endotoxin level, etc. , that is customarily achievable by those skilled in the art of formulating drugs for intravitreai injection and demonstrated in the previously mentioned pilot research studies in rabbit eyes.)
- a formulation suitable for intravitreai injection i.e. , with the appropriate pH, osmolarity, low endotoxin level, etc. , that is customarily achievable by those skilled in the art of formulating drugs for intravitreai injection and demonstrated in the previously mentioned pilot research studies in rabbit eyes.
- a few hours prior to surgery or even one to three days prior to surgery the formulation containing the composition is injected into the vitreous.
- the volume of the dose would be in the range of 1 microliter to 100 microliters.
- the injection site is a few mm posterior to the limbus so that the needle enters the eye at the
- the composition diffuses throughout the vitreous within hours so that by 16 hours (and perhaps much sooner in eyes from older humans with vitreous syneresis) there is relatively uniform concentration of the composition across the entire vitreous cavity. As shown in Example 1 , this diffusion and dispersion of the composition throughout the vitreous does not require any special manipulation of the eye; it is expected that it will occur in the course of the normal activities of a patient and the normal motion of a patient's eye. Once the vitreous gel is colored or fluorescent, the eye is ready for a surgical procedure.
- the vitreous is rendered visible by the chromophore itself in the white light of the operating microscope, or, alternatively, it would become fluorescent whenever the surgeon activates a standard light or laser light with the appropriate wavelength (hue) to generate a detectable signal from the composition.
- the composition sticks to hyaluronic acid , it will not wash away during the rinsing of the vitreous with fluid as normally occurs during vitrectomy surgery. Instead, the composition will maintain its binding to hyaluronan , an essential component of vitreous. As the surgeon removes vitreous with surgical instruments as standard in such procedures, the regions of vitreous not yet removed are easily apparent by the color or fluorescence of a composition of the invention, which can be observed constantly or whenever the appropriate light is transiently switched on during the procedure.
- the vitreous delineating composition of the invention clearly delineates the vitreoretinal interface and thus allows the surgeon to approach the retina with vitrectomy instruments only when necessary to remove the last remnants of vitreous.
- the composition also facilitates recognition of a posterior vitreous detachment because of the clear fluid between the vitreous and the retina having a low hyaluronan content.
- the vitreous delineating composition of the invention binds to hyaluronan present in the posterior cortical vitreous, thus clearly distinguishing a boundary between the cortical vitreous and the fluid-filled posterior hyaloid space.
- the limit of the hyaloid is thus visibly demarcated by the vitreous delineating composition bound to the vitreous. This allows the surgeon to accurately visualize the posterior hyaloid and vitreous during the procedure, and to completely and easily remove the posterior hyaloid and formed vitreous.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Ophthalmology & Optometry (AREA)
- Immunology (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Surgery (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Transplantation (AREA)
- Dermatology (AREA)
- Dispersion Chemistry (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Peptides Or Proteins (AREA)
- Materials For Medical Uses (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2015278744A AU2015278744B2 (en) | 2014-06-25 | 2015-06-24 | Compositions and methods for visualization of the vitreous |
| CA2953682A CA2953682A1 (en) | 2014-06-25 | 2015-06-24 | Compositions and methods for visualization of the vitreous |
| JP2016574918A JP6296581B2 (ja) | 2014-06-25 | 2015-06-24 | 硝子体の視覚化のための組成物および方法 |
| ES15736046T ES2730398T3 (es) | 2014-06-25 | 2015-06-24 | Composiciones y procedimientos de visualización del vítreo |
| CN201580045678.4A CN107206107A (zh) | 2014-06-25 | 2015-06-24 | 用于玻璃体可视化的组合物和方法 |
| EP15736046.2A EP3160512B1 (en) | 2014-06-25 | 2015-06-24 | Compositions and methods for visualization of the vitreous |
| US15/321,025 US10537648B2 (en) | 2014-06-25 | 2015-06-24 | Compositions and methods for visualization of the vitreous |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462016731P | 2014-06-25 | 2014-06-25 | |
| US62/016,731 | 2014-06-25 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015198245A1 true WO2015198245A1 (en) | 2015-12-30 |
Family
ID=53539753
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2015/054747 Ceased WO2015198245A1 (en) | 2014-06-25 | 2015-06-24 | Compositions and methods for visualization of the vitreous |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US10537648B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3160512B1 (cg-RX-API-DMAC7.html) |
| JP (2) | JP6296581B2 (cg-RX-API-DMAC7.html) |
| CN (1) | CN107206107A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2015278744B2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2953682A1 (cg-RX-API-DMAC7.html) |
| ES (1) | ES2730398T3 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2015198245A1 (cg-RX-API-DMAC7.html) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025242919A1 (en) * | 2024-05-24 | 2025-11-27 | Navigo Proteins Gmbh | Novel binding proteins for hyaluronic acid |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006133903A2 (en) * | 2005-06-17 | 2006-12-21 | Ludwig-Maximilians-Universität München | Method, dye and medicament for staining the internal limiting memebrane, the vitreous and/or the capsule of an eye |
| WO2010074325A1 (en) * | 2008-12-25 | 2010-07-01 | Canon Kabushiki Kaisha | Labeling composition for intraocular tissue, labeling method of intraocular tissue, and screening method |
| WO2012135432A2 (en) * | 2011-03-29 | 2012-10-04 | Kemin Industries, Inc. | Dyes for membranes and biological structures |
| WO2013063155A2 (en) * | 2011-10-24 | 2013-05-02 | Halozyme, Inc. | Companion diagnostic for anti-hyaluronan agent therapy and methods of use thereof |
| US20130143814A1 (en) * | 2010-05-03 | 2013-06-06 | Robert Rosa | Protein Therapy for Treatment of Eye Diseases |
| WO2014011813A1 (en) * | 2012-07-11 | 2014-01-16 | Tissuetech, Inc. | Compositions containing hc-ha/ptx3 complexes and methods of use thereof |
| WO2014099997A1 (en) * | 2012-12-18 | 2014-06-26 | Novartis Ag | Compositions and methods that utilize a peptide tag that binds to hyaluronan |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP4936508B2 (ja) * | 2006-01-23 | 2012-05-23 | 独立行政法人国立国際医療研究センター | 蛍光ナノ粒子を含む眼の硝子体染色剤及び染色方法 |
| HUE026001T2 (en) * | 2007-02-05 | 2016-04-28 | Apellis Pharmaceuticals Inc | Compstatin analogues for use in the treatment of the inflammatory condition of the respiratory system |
| GB201400994D0 (en) * | 2014-01-21 | 2014-03-05 | Ucl Business Plc | Drug delivery system |
-
2015
- 2015-06-24 AU AU2015278744A patent/AU2015278744B2/en not_active Ceased
- 2015-06-24 WO PCT/IB2015/054747 patent/WO2015198245A1/en not_active Ceased
- 2015-06-24 JP JP2016574918A patent/JP6296581B2/ja active Active
- 2015-06-24 EP EP15736046.2A patent/EP3160512B1/en active Active
- 2015-06-24 CA CA2953682A patent/CA2953682A1/en not_active Abandoned
- 2015-06-24 CN CN201580045678.4A patent/CN107206107A/zh active Pending
- 2015-06-24 ES ES15736046T patent/ES2730398T3/es active Active
- 2015-06-24 US US15/321,025 patent/US10537648B2/en active Active
-
2017
- 2017-12-14 JP JP2017239403A patent/JP2018039847A/ja not_active Withdrawn
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006133903A2 (en) * | 2005-06-17 | 2006-12-21 | Ludwig-Maximilians-Universität München | Method, dye and medicament for staining the internal limiting memebrane, the vitreous and/or the capsule of an eye |
| WO2010074325A1 (en) * | 2008-12-25 | 2010-07-01 | Canon Kabushiki Kaisha | Labeling composition for intraocular tissue, labeling method of intraocular tissue, and screening method |
| US20130143814A1 (en) * | 2010-05-03 | 2013-06-06 | Robert Rosa | Protein Therapy for Treatment of Eye Diseases |
| WO2012135432A2 (en) * | 2011-03-29 | 2012-10-04 | Kemin Industries, Inc. | Dyes for membranes and biological structures |
| WO2013063155A2 (en) * | 2011-10-24 | 2013-05-02 | Halozyme, Inc. | Companion diagnostic for anti-hyaluronan agent therapy and methods of use thereof |
| WO2014011813A1 (en) * | 2012-07-11 | 2014-01-16 | Tissuetech, Inc. | Compositions containing hc-ha/ptx3 complexes and methods of use thereof |
| WO2014099997A1 (en) * | 2012-12-18 | 2014-06-26 | Novartis Ag | Compositions and methods that utilize a peptide tag that binds to hyaluronan |
Non-Patent Citations (15)
| Title |
|---|
| "Remington: The Science and Practice of Pharmacy, 20th ed.", 2000, MACK PUBLISHING CO. |
| BASABE-DESMONTS ET AL., CHEMICAL SOCIETY REVIEWS, vol. 36, 2007, pages 993 - 1017 |
| DAY ET AL., J BIO.CHEM, vol. 277, no. 7, 2002, pages 4585 |
| FRASER JR; LAURENT TC; PERTOFT H; BAXTER E, BIOCHEM J., vol. 200, no. 2, 15 November 1981 (1981-11-15), pages 415 - 24 |
| GENTZ ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 821 - 824 |
| GRISS, NATURE CHEMICAL BIOLOGY, 8 June 2014 (2014-06-08) |
| J. NECAS; L. BARTOSIKOVA; P. BRAUNER; J. KOLAR, VETERINAMI EDIEINA, vol. 53, no. 8, 2008, pages 397 - 411 |
| J. NECAS; L. BARTOSIKOVA; P. BRAUNER; J. KOLAR, VETERINARNI MEDICINA, vol. 53, no. 8, 2008, pages 397 - 411 |
| KNITTEL ET AL., J. ANAL. TOXICOL., vol. 33, 2009, pages 434 - 438 |
| LAURENT; FRASER, 1986 CIBA FOUND SYMP., vol. 124, 1986, pages 9 - 29 |
| LAURENT; FRASER, EXP. EYE RES., vol. 36, 1983, pages 493 - 504 |
| MAHONEY ET AL., J BIO.CHEM, vol. 276, no. 25, 2001, pages 22764 - 22771 |
| MAO ET AL., J AM CHEM SOC., vol. 126, no. 9, 10 March 2004 (2004-03-10), pages 2670 - 1 |
| WILSON ET AL., CELL, vol. 37, 1984, pages 767 |
| YANG ET AL., EMBO J, vol. 13, no. 2, 1994, pages 286 - 296 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025242919A1 (en) * | 2024-05-24 | 2025-11-27 | Navigo Proteins Gmbh | Novel binding proteins for hyaluronic acid |
Also Published As
| Publication number | Publication date |
|---|---|
| US20170202981A1 (en) | 2017-07-20 |
| CA2953682A1 (en) | 2015-12-30 |
| US10537648B2 (en) | 2020-01-21 |
| JP2017524679A (ja) | 2017-08-31 |
| EP3160512A1 (en) | 2017-05-03 |
| ES2730398T3 (es) | 2019-11-11 |
| CN107206107A (zh) | 2017-09-26 |
| AU2015278744A1 (en) | 2017-01-12 |
| JP2018039847A (ja) | 2018-03-15 |
| JP6296581B2 (ja) | 2018-03-20 |
| EP3160512B1 (en) | 2019-05-22 |
| AU2015278744B2 (en) | 2018-09-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Olsen et al. | Cannulation of the suprachoroidal space: a novel drug delivery methodology to the posterior segment | |
| Farah et al. | The use of vital dyes during vitreoretinal surgery-chromovitrectomy | |
| Sreekumar et al. | Intra-vitreal αB crystallin fused to elastin-like polypeptide provides neuroprotection in a mouse model of age-related macular degeneration | |
| US20130224302A1 (en) | Porous photonic crystals for drug delivery to the eye | |
| Fernández-Colino et al. | Self-assembling elastin-like hydrogels for timolol delivery: development of an ophthalmic formulation against glaucoma | |
| US12440443B2 (en) | Nano-emulsion of CBFβ-RUNX1 inhibitor for ocular drug deliver | |
| RU2561585C2 (ru) | Местный глазной пептидный состав | |
| JP2009501727A (ja) | 巨大分子集合体の存在に関連した状態、特に眼科障害の治療 | |
| CA3095073A1 (en) | Sap and peptidomimetics for treatment of eye disease | |
| Cai et al. | Injectable self-assembling peptide hydrogel as a promising vitreous substitute | |
| Lee et al. | Tower microneedle minimizes vitreal reflux in intravitreal injection | |
| Xu et al. | Thermoresponsive gel for sustained release of BMP4 to inhibit corneal neovascularization | |
| AU2015278744B2 (en) | Compositions and methods for visualization of the vitreous | |
| CN109640973A (zh) | 近视的治疗 | |
| Yamamoto et al. | Visualizing vitreous using quantum dots as imaging agents | |
| Li et al. | Sustaining intravitreal residence with L-arginine peptide-conjugated nanocarriers | |
| US11160881B2 (en) | Dendrimer compositions for use in angiography | |
| Talreja et al. | G-quartet oligonucleotide mediated delivery of functional X-linked inhibitor of apoptosis protein into retinal cells following intravitreal injection | |
| Sarfare et al. | Biocompatibility of a synthetic biopolymer for the treatment of rhegmatogenous retinal detachment | |
| Junnuthula et al. | Intravitreal polymeric nanocarriers with long ocular retention and targeted delivery to the retina and optic nerve head region. Pharmaceutics. 2021; 13 (4): 445 | |
| CN102083411B (zh) | 载体 | |
| CN119192407B (zh) | 一种多肽-地塞米松偶联物及其制备方法与应用 | |
| ES2991634T3 (es) | Vasodilatadores para su uso en el tratamiento de un trastorno isquémico de la retina | |
| Chaw | Fundamental study of nanoliposomes for ocular therapy | |
| CN115869416A (zh) | 用于眼部靶向递药的细胞膜、药物载体、组合物及其制备方法和用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15736046 Country of ref document: EP Kind code of ref document: A1 |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015736046 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015736046 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15321025 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2016574918 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2953682 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2015278744 Country of ref document: AU Date of ref document: 20150624 Kind code of ref document: A |