WO2015164789A1 - Aav-based gene therapy for multiple sclerosis - Google Patents

Aav-based gene therapy for multiple sclerosis Download PDF

Info

Publication number
WO2015164789A1
WO2015164789A1 PCT/US2015/027598 US2015027598W WO2015164789A1 WO 2015164789 A1 WO2015164789 A1 WO 2015164789A1 US 2015027598 W US2015027598 W US 2015027598W WO 2015164789 A1 WO2015164789 A1 WO 2015164789A1
Authority
WO
WIPO (PCT)
Prior art keywords
nucleic acid
raav
protein
vector
mog
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/027598
Other languages
English (en)
French (fr)
Inventor
Brad E. HOFFMAN
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Florida
University of Florida Research Foundation Inc
Original Assignee
University of Florida
University of Florida Research Foundation Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to PL15782332.9T priority Critical patent/PL3133923T3/pl
Priority to HRP20201342TT priority patent/HRP20201342T1/hr
Priority to LTEP15782332.9T priority patent/LT3133923T/lt
Priority to ES15782332T priority patent/ES2814280T3/es
Priority to RS20201008A priority patent/RS60816B1/sr
Priority to AU2015249328A priority patent/AU2015249328B2/en
Priority to SM20200453T priority patent/SMT202000453T1/it
Priority to US15/306,163 priority patent/US20170043036A1/en
Priority to DK15782332.9T priority patent/DK3133923T3/da
Priority to SI201531336T priority patent/SI3133923T1/sl
Priority to CA2945984A priority patent/CA2945984C/en
Application filed by University of Florida, University of Florida Research Foundation Inc filed Critical University of Florida
Priority to EP20167323.3A priority patent/EP3744177A1/en
Priority to EP15782332.9A priority patent/EP3133923B1/en
Priority to JP2016564019A priority patent/JP6646282B2/ja
Publication of WO2015164789A1 publication Critical patent/WO2015164789A1/en
Anticipated expiration legal-status Critical
Priority to AU2019202958A priority patent/AU2019202958B2/en
Priority to US16/679,102 priority patent/US20200138978A1/en
Priority to CY20201100820T priority patent/CY1123312T1/el
Priority to US18/191,790 priority patent/US20230381342A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • A61K48/0058Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0008Antigens related to auto-immune diseases; Preparations to induce self-tolerance
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/577Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 tolerising response
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the present invention relates generally to the fields of molecular biology and virology, and in particular, to the development of gene therapy vectors and methods for treatment of autoimmune diseases, such as multiple sclerosis (MS).
  • MS multiple sclerosis
  • MS Multiple Sclerosis
  • MS is a multifocal demyelinating disease with progressive neurodegeneration caused by an autoimmune response to self-antigens in a genetically susceptible individual. Depending on where in the CNS the damage occurs, symptoms may include problems with muscle control, balance, vision, or speech. 250,000 to 350,000 people in the US.
  • MS is an autoimmune disease that develops (in part) from a failure of central and peripheral tolerance mechanisms (particularly Tregs) to maintain self-tolerance and control potentially pathogenic autoreactive lymphocytes. 2 ' 3 It is characterized by chronic lymphocyte infiltration and inflammation of the CNS resulting in demyelination.
  • AAV adeno-associated virus
  • AAV DNA is packaged into the viral capsid as a single- stranded molecule about 4600 nucleotides (nt) in length.
  • the molecular machinery of the cell converts the single- stranded DNA into a double- stranded form. Only this double- stranded DNA form can be transcribed by cellular enzymes into RNA, which is then translated into polypeptides by additional cellular pathways.
  • the present invention overcomes these and other limitations inherent in the prior art by providing, in part, novel AAV nucleic acid vectors that are capable of, and optimized for, liver-directed expression of full-length proteins such as neuroproteins (including, without limitation, MOG, PLP, and MBP) or functional fragments thereof, thus abrogating the need for identifying HLA-MHC-specific epitopes required for inducing antigen- specific Tregs.
  • the invention permits each patient undergoing treatment to generate his/her own unique antigen- specific Tregs, which makes the treatment more universally applicable and more clinically feasible than existing technologies.
  • Schilder's disease is a rare progressive demyelinating disorder that usually begins in childhood. While there is currently no cure for MS, there are various MS treatment options which have shown a decrease in the severity and frequency of relapses and a delay in disease progression in numerous studies. Therapies with predominantly immunomodulating properties include e.g., Beta-interferons and Glatiramer acetate. Therapies with
  • MS are associated with restored Treg homeostasis. 2 ' 4 ' 5
  • AAV gene therapy has been proven to be a powerful new tool for the treatment of a broad spectrum of diseases, including restoration of vision in patients with Leber's congenital amaurosis by retinal gene transfer, and hemophilia B by hepatic gene therapy. 6 ' 7
  • hepatic gene therapy transfer with AAV vectors can reliably induce a robust antigen-specific immune tolerance in experimental animals to a variety of proteins even when the antigen is subsequently expressed in a highly immunogenic manner in other organs.
  • liver directed gene therapy can abrogate potential cytotoxic CD8 + T cell responses.
  • this protocol can even eliminate pre-existing antibodies.
  • Hepatocyte-restricted transgene expression from an optimized AAV vector can reliably induce immune tolerance to various therapeutic proteins (e.g., mediated by Ag- specific CD4 + CD25 + FoxP3 + Tregs).
  • the process suppresses antibody formation and cytotoxic CD8 + T cell responses against the transgene product.
  • Hepatic transgene expression is maintained even when the antigen was subsequently expressed in a highly immunogenic manner in other organs.
  • the process efficiently and rapidly reverses pre-existing high antibody titers, and provided long-term correction of haemostasis in a murine hemophilia B model.
  • the method does not require protein to be secreted to be functional.
  • novel rAAV nucleic acid vectors, express constructs, and infectious virions and viral particles comprising them as disclosed herein preferably have an improved efficiency in transducing one or more mammlalian liver cells to provide persistent expression of one or more genes of interest.
  • the improved rAAV nucleic acid vectors provided hererin preferably transduce mammalian cells with sufficient transduction efficiency to suppress the immune response associated with MS in patients, and thus abrogate CNS inflammation, and immune-mediated damage that occurs in MS patients. Unlike current therapies, this gene-therapy based approach represents a persistent, long-term treatment that reduces the clinical disability experienced by MS patients.
  • the invention provides improved rAAV particles including those derived from one or more serotypes as known in the art (including, for example, those selected from the group consisting of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, and AAV 12).
  • the present invention also concerns rAAV nucleic acid vectors, wherein the nucleic acid segment further comprises a promoter, an enhancer, a post-transcriptional regulatory sequence, a polyadenylation signal, or any combination thereof, operably linked to the nucleic acid segment that encodes the selected polynucleotide of interest.
  • the nucleic acid segments cloned into the novel rAAV expression vectors described herein will express or encode one or more polypeptides, peptides, ribozymes, peptide nucleic acids, siRNA's, RNAi's, antisense oligonucleotides, antisense polynucleotides, antibodies, antigen binding fragments, or any combination thereof.
  • the therapeutic agents useful in the invention may include one or more agonists, antagonists, anti-apoptosis factors, inhibitors, receptors, cytokines, cytotoxins, erythropoietic agents, glycoproteins, growth factors, growth factor receptors, hormones, hormone receptors, interferons, interleukins, interleukin receptors, nerve growth factors, neuroactive peptides, neuroactive peptide receptors, proteases, protease inhibitors, protein decarboxylases, protein kinases, protein kinase inhibitors, enzymes, receptor binding proteins, transport proteins or one or more inhibitors thereof, serotonin receptors, or one or more uptake inhibitors thereof, serpins, serpin receptors, tumor suppressors, diagnostic molecules, chemotherapeutic agents, cytotoxins, or any combination thereof.
  • the rAAV nucleic acid vectors of the present invention may be comprised within a virion or viral particle having a serotype that is selected from the group consisting of AAV serotype 1 (AAV1), AAV serotype 2 (AAV2), AAV serotype 3 (AAV3), AAV serotype 4 (AAV4), AAV serotype 5 (AAV5), AAV serotype 6 (AAV6), AAV serotype 7 (AAV7), AAV serotype 8 (AAV8), AAV serotype 9 (AAV9), AAV serotype 10 (AAV10), AAV serotype 11 (AAV11), or AAV serotype 12 (AAV12), or any other serotype as known to one of ordinary skill in the viral arts.
  • AAV serotype 1 AAV1
  • AAV2 AAV serotype 2
  • AAV3 AAV-3
  • AAV serotype 4 AAV4
  • AAV serotype 5 AAV5
  • AAV serotype 6 A
  • the invention further provides populations and pluralities of rAAV nucleic acid vectors, virions, infectious viral particles, or host cells that include one or more nucleic acid segments that encode an autoimmune disease therapeutic agent.
  • the invention further provides compositions and formulations that include one or more of the proteins, nucleic acid segments, viral vectors, host cells, or viral particles of the present invention together with one or more pharmaceutically-acceptable buffers, diluents, or excipients.
  • Such compositions may be included in one or more diagnostic or therapeutic kits, for diagnosing, preventing, treating or ameliorating one or more symptoms of a mammalian inflammatory disease, such as autoimmune disease, and in particular, for delivery of a therapeutic agent for the treatment of MS in a human.
  • the invention further includes a method for providing a mammal in need thereof with a diagnostically- or therapeutically-effective amount of a selected therapeutic agent, the method comprising administering to a cell, tissue or organ of a mammal in need thereof, an amount of one or more of the disclosed rAAV nucleic acid vectors; and for a time effective to provide the mammal with a diagnostically- or a therapeutically-effective amount of the selected therapeutic agent.
  • the invention further provides a method for diagnosing, preventing, treating, or ameliorating at least one or more symptoms of a disease, a disorder, a dysfunction, an injury, an abnormal condition, or trauma in a mammal.
  • the method includes at least the step of administering to a mammal in need thereof one or more of the disclosed rAAV nucleic acid vectors, in an amount and for a time sufficient to diagnose, prevent, treat or ameliorate the one or more symptoms of the disease, disorder, dysfunction, injury, abnormal condition, or trauma in the mammal.
  • the invention also provides a method of transducing a population of mammalian cells.
  • the method includes at least the step of introducing into one or more cells of the population, a composition that comprises an effective amount of one or more of the rAAV nucleic acid vectors disclosed herein.
  • the invention also provides isolated nucleic acid segments that encode one or more of the rAAV vector-based gene therapy constructs as described herein, and provides recombinant vectors, virus particles, infectious virions, and isolated host cells that comprise one or more of the rAAV nucleic acid vectors described herein.
  • compositions as well as therapeutic and/or diagnostic kits that include one or more of the disclosed AAV nucleic acid vector or AAV particle compositions, formulated with one or more additional ingredients, or prepared with one or more instructions for their use.
  • the invention provides compositions comprising recombinant adeno- associated viral (AAV) nucleic acid vectors, virions, viral particles, and pharmaceutical formulations thereof, useful in methods for delivering genetic material encoding one or more beneficial or therapeutic product(s) to mammalian cells and tissues.
  • AAV adeno-associated viral
  • the compositions and methods of the invention provide a significant advancement in the art through their use in the treatment, prevention, and/or amelioration of symptoms of one or more mammalian inflammatory diseases, including autoimmune diseases such as MS and the like.
  • the invention provides rAAV-based expression constructs that encode one or more mammalian therapeutic agent(s) (including, but not limited to, for example, protein(s), polypeptide(s), peptide(s), enzyme(s), antibodies, antigen binding fragments, as well as variants, and/or active fragments thereof), for use in the treatment, prophylaxis, and/or amelioration of one or more symptoms of a mammalian disease, dysfunction, injury, and/or disorder.
  • mammalian therapeutic agent(s) including, but not limited to, for example, protein(s), polypeptide(s), peptide(s), enzyme(s), antibodies, antigen binding fragments, as well as variants, and/or active fragments thereof.
  • the improved nucleic acid vectors and expression systems of the present invention may also optionally further include a polynucleotide that comprises, consists essentially of, or consists of, one or more polylinkers, restriction sites, and/or multiple cloning region(s) to facilitate insertion (cloning) of one or more selected genetic elements, genes of interest, or therapeutic or diagnostic constructs into the rAAV vector at a selected site within the vector.
  • a polynucleotide that comprises, consists essentially of, or consists of, one or more polylinkers, restriction sites, and/or multiple cloning region(s) to facilitate insertion (cloning) of one or more selected genetic elements, genes of interest, or therapeutic or diagnostic constructs into the rAAV vector at a selected site within the vector.
  • the exogenous polynucleotide(s) that may be delivered into suitable host cells by the rAAV nucleic acid vectors disclosed herein are preferably of mammalian origin, with polynucleotides encoding one or more polypeptides or peptides of human, non-human primate, porcine, bovine, ovine, feline, canine, equine, epine, caprine, or lupine origin being particularly preferred.
  • the exogenous polynucleotide(s) that may be delivered into host cells by the disclosed viral nucleic acid vectors may, in certain embodiments, encode one or more proteins, one or more polypeptides, one or more peptides, one or more enzymes, or one or more antibodies (or antigen-binding fragments thereof), or alternatively, may express one or more siRNAs, ribozymes, antisense oligonucleotides, PNA molecules, or any combination thereof.
  • two or more different molecules may be produced from a single rAAV expression system, or alternatively, a selected host cell may be transfected with two or more unique rAAV expression systems, each of which may comprise one or more distinct polynucleotides that encode a therapeutic agent.
  • the invention also provides rAAV nucleic acid vectors that are comprised within an infectious adeno-associated viral particle or a virion, as well as pluralities of such virions or infectious particles.
  • Such vectors, particles, and virions may be comprised within one or more diluents, buffers, physiological solutions or pharmaceutical vehicles, or formulated for administration to a mammal in one or more diagnostic, therapeutic, and/or prophylactic regimens.
  • the vectors, virus particles, virions, and pluralities thereof of the present invention may also be provided in excipient formulations that are acceptable for veterinary administration to selected livestock, exotics, domesticated animals, and companion animals (including pets and such like), as well as to non-human primates, zoological or otherwise captive specimens, and such like.
  • the invention also concerns host cells that comprise at least one of the disclosed rAAV nucleic acid expression vectors, or one or more virus particles or virions that comprise such an expression vector.
  • host cells are particularly mammalian host cells, with human liver cells being particularly highly preferred, and may be either isolated, in cell or tissue culture. In the case of genetically modified animal models, the transformed host cells may even be comprised within the body of a non-human animal itself.
  • compositions comprising one or more of the disclosed rAAV nucleic acid vectors, expression systems, infectious rAAV particles, or host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in therapy, and for use in the manufacture of medicaments for the treatment of one or more mammalian inflammatory diseases, disorders, dysfunctions, or trauma.
  • Such pharmaceutical compositions may optionally further comprise one or more diluents, buffers, liposomes, a lipid, a lipid complex.
  • the rAAV nucleic acid vectors or rAAV particles of the present invention may be comprised within a plurality of microspheres, nanoparticles, liposomes, or any combination thereof.
  • Kits comprising one or more of the disclosed rAAV nucleic acid vectors (as well as one or more virions, viral particles, transformed host cells or pharmaceutical compositions comprising such vectors, virons, particle, or host cells); and instructions for using such kits in one or more therapeutic, diagnostic, and/or prophylactic clinical embodiments are also provided by the present invention.
  • kits may further comprise one or more reagents, restriction enzymes, peptides, therapeutics, pharmaceutical compounds, or means for delivery of the composition(s) to host cells, or to an animal (e.g., syringes, injectables, and the like).
  • kits include those for treating, preventing, or ameliorating the symptoms of a disease, deficiency, dysfunction, and/or injury, or may include components for the large-scale production of the viral vectors themselves, such as for commercial sale, or for use by others, including e.g., virologists, medical professionals, and the like.
  • Another important aspect of the present invention concerns methods of use of the disclosed rAAV nucleic acid vectors, virions, expression systems, compositions, and host cells described herein in the preparation of medicaments for diagnosing, preventing, treating or ameliorating at least one or more symptoms of a disease, a dysfunction, a disorder, an abnormal condition, a deficiency, injury, or trauma in an animal, and in particular, one or more autoimmune diseases in humans.
  • compositions comprising one or more of the disclosed rAAV nucleic acid vectors, expression systems, infectious rAAV particles, and host cells also form part of the present invention, and particularly those compositions that further comprise at least a first pharmaceutically-acceptable excipient for use in the manufacture of medicaments and methods involving therapeutic administration of such rAAV nucleic vectors, rAAV particles, and host cells.
  • Another important aspect of the present invention concerns methods of use of the disclosed nucleic acid vectors, virions, expression systems, compositions, and host cells described herein in the preparation of medicaments for treating or ameliorating the symptoms of various autoimmune diseases, such as MS, in a mammal, and in particular one or more such diseases in a human.
  • various autoimmune diseases such as MS, in a mammal, and in particular one or more such diseases in a human.
  • the method further comprises administering an mTOR inhibitor, e.g., rapamycin.
  • an mTOR inhibitor e.g., rapamycin.
  • FIG. 1 describes aspects of an experimental autoimmune encephalomyelitis murine model employed in the present study as an animal model for MS;
  • FIG. 2A and FIG. 2B show a mouse model and mean clinical score criteria for the EAE study
  • FIG. 3 shows a comparison of exemplary methods of the present invention as contrasted with the cell-based delivery methods of the prior art
  • FIG. 4A and FIG. 4B show the AAV8 expression of MOG.
  • FIG. 4A shows the Western blot analysis from protein extracted from liver, while FIG. 4B shows the analysis of transcriptional levels using real-time RT-PCR;
  • FIG. 5A shows the mean clinical score of EAE mice. Five female mice were injected s.c. with Ag/CFA emulsion. Mean clinical score ( ⁇ SEM) was recorded starting at day 12; [0045] FIG. 5B shows the mean clinical score of EAE mice. Five female C57BL/6 mice were injected s.c. with MOG/CFA emulsion. Mean clinical score (+SEM) was recorded;
  • FIG. 6A, FIG. 6B, and FIG. 6C show AAV8-MOG prevented development of EAE in C57BL/6 mice.
  • FIG. 6A Mean clinical score
  • FIG. 6B anti-MOG IgGl
  • FIG. 6C anti-MOG IgG2c;
  • FIG. 7A, FIG. 7B, and FIG. 7C show that AAV8-vectored gene therapy prevents the onset of EAE in the animal model of MS;
  • FIG. 8 shows that AAV8-MOG ameliorated the disease in the animal model of MS
  • FIG. 9 shows a PLP induced EAE naive control group to demonstrate disease progression
  • FIG. 10 shows effective suppression of pre-existing disease using the AAV8-vectored MOG treatment
  • FIG. 11 shows hepatic transgene expression of MOG.
  • FIG. 12 shows Luxol Fast Blue (LFB) staining of spinal cords from mice that received AAV8-GFP and had EAE induced (A) or not (B);
  • LLB Luxol Fast Blue
  • FIG. 13A shows mean clinical score (MCS) in EAE-induced C57BL/6 mice that received AAV8-MOG or control vector after the mice reached a MCS of about 0.3. Bar graphs show statistical significance between final scores and peak- to-final scores;
  • FIG. 13B shows mean clinical score (MCS) in EAE-induced C57BL/6 mice that received AAV8-MOG or control vector after the mice reached a MCS of about 0.8. Bar graphs show statistical significance between final scores and peak- to-final scores;
  • FIG. 13C shows mean clinical score (MCS) in EAE-induced C57BL/6 mice that received AAV8-MOG or control vector after the mice reached a MCS of about 1.3. Bar graphs show statistical significance between final scores and peak- to-final scores;
  • FIG. 14A is a hematoxylin and eosin stain showing areas of high inflammatory infiltration.
  • FIG. 14B is a Luxol fast blue stain showing areas of demyelination. Circled areas highlight the co-localization of inflammation and loss of myelin;
  • FIG. 15A and 15B shows serial sections of spinal cord from an EAE induced female mouse -35 days after receiving AAV-MOG vector.
  • MCS 1.25
  • FIG. 15A is a hematoxylin and eosin stain showing diminished infiltration.
  • FIG. 15B is a Luxol fast blue stain which appears to show that the section has less areas of demyelination as a result of the suppression of the inflammation;
  • FIG. 16A and 16B show that Tregs isolated from spleens of AAV-MOG treated mice are functionally suppressive
  • FIG. 17A, 17B, 17C and 17D show that AAV-MOG vector induces antigen specific Tregs.
  • Splenocytes from mice injected with AAV-MOG vector 8 wks prior showed an increase in frequencies of I-Ab MOG 35 -55 Tetramer positive CD4+ (FIG. 17A) and Treg+ (FIG. 17C) compared to control tetramer positive CD+ (FIG. 17B) and Treg+ (FIG. 17D).
  • FIG. 18 shows that AAV8-PLP reduces clinical severity in mice with PLP induced relapsing-remitting EAE
  • FIG. 19A shows aWestern blot analysis from protein extracted from liver of mice injected with AAV-MBP.
  • FIG. 19B shows analysis of transcriptional levels of RNA obtained from the liver of mice treated with AAV-MBP or control by real-time RT-PCR.
  • AAV vectors have been used successfully for in vivo gene transfer in numerous pre-clinical animal models of human disease, and have been used successfully for long-term expression of a wide variety of therapeutic genes (Daya and Berns, 2008; Niemeyer et ah, 2009; Owen et ah, 2002; Keen-Rhinehart et ah, 2005; Scallan et ah, 2003; Song et ah, 2004).
  • AAV vectors have also generated long-term clinical benefit in humans when targeted to immune-privileged sites, e.g., ocular delivery for Leber's congenital amaurosis (Bainbridge et ah, 2008; Maguire et ah, 2008; Cideciyan et ah, 2008).
  • a major advantage of this vector is its comparatively low immune profile, eliciting only limited inflammatory responses and, in some cases, even directing immune tolerance to transgene products (LoDuca et ah, 2009).
  • a rAAV nucleic acid vector described herein comprises inverted terminal repeat sequences (ITRs), such as those derived from a wild-type AAV genome, such as the AAV2 genome.
  • the rAAV nucleic acid vector further comprises nucleic acid segment that includes a transgene (also referred to as a heterologous nucleic acid molecule) operably linked to a promoter and optionally, other regulatory elements, wherein the ITRs flank the nucleic acid segment.
  • the promoter is a mammalian cell-specific or a mammalian tissue-specific promoter.
  • the promoter is a promoter that is capable of expressing the nucleic acid segment in one or more cells of a mammalian liver, such as hepatocyte cells.
  • hepatocyte specific promoters and enhancer elements include, e.g., albumin, human a 1 -antitrypsin (hAAT), transthyretin (TTR), and apolipoprotein E (apoE) promoters or enhancer elements.
  • the transgene encodes an autoimmune disease therapeutic molecule of interest, such as a mammalian myelin basis protein (MBP), proteolipid protein (PLP), or myelin oligodendrocyte glycoprotein (MOG).
  • an autoimmune therapeutic molecule includes any antigen (such as a protein, fragment thereof, or a peptide) that contributes to initiation and/or progression of an autoimmune disease.
  • Exemplary autoimmune therapeutic molecules include myelin basis protein (MBP, e.g., for multiple sclerosis), proteolipid protein (PLP, e.g., for multiple sclerosis), myelin oligodendrocyte glycoprotein (MOG, e.g., for multiple sclerosis), myelin-associated glycoprotein (MAG, e.g., for Anti-MAG Peripheral Neuropathy), insulin (e.g., for type 1 diabetes), islet-specific glucose-6-phosphatase catalytic subunit-related protein (IGRP, e.g., for type 1 diabetes), Preproinsulin (e.g., for type 1 diabetes), Glutamic decarboxylase (GAD, e.g., for type 1 diabetes), tyrosine phosphatase like autoantigen (e.g., for type 1 diabetes), insulinoma antigen- 2 (e.g., for type 1 diabetes), Islet cell antigen (e.g., for type 1 diabetes); thyroid stimulating hormone (
  • the autoimmune disease therapeutic molecule of interest is a human protein, such as human myelin basis protein (MBP), a human proteolipid protein (PLP), or a human myelin oligodendrocyte glycoprotein (MOG).
  • MBP human myelin basis protein
  • PGP human proteolipid protein
  • MOG human myelin oligodendrocyte glycoprotein
  • transgene sequences e.g., cDNA sequences
  • protein sequences that may be encoded by the transgene are provided below.
  • the transgene comprises a sequence that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to any one of the cDNA sequences provided below (SEQ ID NOs: 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, or 34).
  • the transgene comprises a sequence that is any one of the cDNA sequences provided below (SEQ ID NOs: 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, or 34).
  • the transgene is codon-optimized for expression in human cells.
  • the transgene contains a nucleotide sequence that encodes at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240 or more contiguous amino acids of any one of the protein sequences provided herein (e.g., any one of SEQ ID NOs: 1, 2, 3, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, or 35).
  • the transgene contains a nucleotide sequence that encodes a protein that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to any one of the protein sequences provided herein (e.g., any one of SEQ ID NOs: 1, 2, 3, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, or 35).
  • the transgene contains a nucleotide sequence that encodes any one of the protein sequences provided herein (e.g., any one of SEQ ID NOs: 1, 2, 3, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, or 35).
  • MBP Mus musculus myelin basic protein
  • Exemplary Homo sapiens proteolipid protein 1 (PLPl), transcript variant 1, cDNA
  • PGPl Homo sapiens proteolipid protein 1 (PLPl), transcript variant 1, protein
  • Exemplary Homo sapiens proteolipid protein 1 (PLPl), transcript variant 2, cDNA
  • Exemplary Homo sapiens proteolipid protein 1 (PLPl), transcript variant 2, protein
  • PGP1 Homo sapiens proteolipid protein 1 (PLP1), transcript variant 3, protein
  • PGP1 Homo sapiens proteolipid protein 1
  • transcript variant 4 cDNA
  • PGP1 Homo sapiens proteolipid protein 1 (PLP1), transcript variant 4, protein
  • the rAAV nucleic acid vector is encapsidated by a rAAV particle as described herein.
  • the rAAV particle may be of any AAV serotype (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10), including any derivative (including non-naturally occurring variants of a serotype) or pseudotype.
  • the rAAV particle is an AAV8 particle, which may be pseudotyped with AAV2 ITRs.
  • Non-limiting examples of derivatives and pseudotypes include AAV2-AAV3 hybrid, AAVrh.
  • the rAAV particle is a pseudotyped rAAV particle, which comprises (a) a nucleic acid vector comprising ITRs from one serotype (e.g., AAV2) and (b) a capsid comprised of capsid proteins derived from another serotype (e.g., AAV1, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, or AAV10).
  • a pseudotyped rAAV particle which comprises (a) a nucleic acid vector comprising ITRs from one serotype (e.g., AAV2) and (b) a capsid comprised of capsid proteins derived from another serotype (e.g., AAV1, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, or AAV10).
  • Exemplary rAAV nucleic acid vectors useful according to the disclosure include single- stranded (ss) or self-complementary (sc) AAV nucleic acid vectors, such as single- stranded or self-complementary recombinant viral genomes.
  • Methods of producing rAAV particles and nucleic acid vectors are also known in the art and commercially available (see, e.g., Zolotukhin et al. Production and purification of serotype 1, 2, and 5 recombinant adeno-associated viral vectors. Methods 28 (2002) 158-167; and U.S. Patent Publication Numbers US20070015238 and US20120322861, which are incorporated herein by reference; and plasmids and kits available from ATCC and Cell Biolabs, Inc.).
  • a plasmid containing the nucleic acid vector sequence may be combined with one or more helper plasmids, e.g., that contain a rep gene (e.g., encoding Rep78, Rep68, Rep52 and Rep40) and a cap gene (encoding VPl, VP2, and VP3, including a modified VP3 region as described herein), and transfected into a producer cell line such that the rAAV particle can be packaged and subsequently purified.
  • helper plasmids e.g., that contain a rep gene (e.g., encoding Rep78, Rep68, Rep52 and Rep40) and a cap gene (encoding VPl, VP2, and VP3, including a modified VP3 region as described herein)
  • the one or more helper plasmids includes a first helper plasmid comprising a rep gene and a cap gene and a second helper plasmid comprising a El a gene, a Elb gene, a E4 gene, a E2a gene, and a VA gene.
  • the rep gene is a rep gene derived from AAV2 and the cap gene is derived from AAV2 and includes modifications to the gene in order to produce a modified capsid protein described herein.
  • Helper plasmids, and methods of making such plasmids are known in the art and
  • helper plasmids are produced or obtained, which comprise rep and cap ORFs for the desired AAV serotype and the adenoviral VA, E2A (DBP), and E4 genes under the transcriptional control of their native promoters.
  • the cap ORF may also comprise one or more modifications to produce a modified capsid protein as described herein.
  • HEK293 cells available from ATCC® are transfected via CaP04-mediated transfection, lipids or polymeric molecules such as Polyethylenimine (PEI) with the helper plasmid(s) and a plasmid containing a nucleic acid vector described herein.
  • PEI Polyethylenimine
  • HEK293 cells are then incubated for at least 60 hours to allow for rAAV particle production.
  • Sf9-based producer stable cell lines are infected with a single recombinant baculovirus containing the nucleic acid vector.
  • HEK293 or BHK cell lines are infected with a HSV containing the nucleic acid vector and optionally one or more helper HSVs containing rep and cap ORFs as described herein and the adenoviral VA, E2A (DBP), and E4 genes under the transcriptional control of their native promoters.
  • the HEK293, BHK, or Sf9 cells are then incubated for at least 60 hours to allow for rAAV particle production.
  • the rAAV particles can then be purified using any method known the art or described herein, e.g., by iodixanol step gradient, CsCl gradient,
  • engineered and recombinant cells are intended to refer to a cell into which an exogenous polynucleotide segment (such as DNA segment that leads to the transcription of a biologically active molecule) has been introduced. Therefore, engineered cells are distinguishable from naturally occurring cells, which do not contain a recombinantly introduced exogenous DNA segment. Engineered cells are, therefore, cells that comprise at least one or more heterologous polynucleotide segments introduced through the hand of man.
  • a tyrosine capsid-modified rAAV particle containing an expression vector that comprises a therapeutic agent-encoding nucleic acid segment under the control of one or more promoters.
  • an expression vector that comprises a therapeutic agent-encoding nucleic acid segment under the control of one or more promoters.
  • To bring a sequence "under the control of a promoter one positions the 5' end of the transcription initiation site of the transcriptional reading frame generally between about 1 and about 50 nucleotides "downstream" of (i.e., 3' of) the chosen promoter.
  • the "upstream" promoter stimulates transcription of the DNA and promotes expression of the encoded polypeptide. This is the meaning of "recombinant expression" in this context.
  • nucleic acid vector constructs are those that comprise an rAAV nucleic acid vector that contains a therapeutic gene of interest operably linked to one or more promoters that is capable of expressing the gene in one or more selected mammalian cells.
  • Such nucleic acid vectors are described in detail herein.
  • the genetic constructs of the present invention may be prepared in a variety of compositions, and may also be formulated in appropriate pharmaceutical vehicles for administration to human or animal subjects.
  • the rAAV molecules of the present invention and compositions comprising them provide new and useful therapeutics for the treatment, control, and amelioration of symptoms of a variety of disorders, diseases, injury, and/or dysfunctions of the mammalian nervous system, and in particular, in the treatment or amelioration of MS.
  • the number of rAAV particles administered to a subject may be on the order ranging from 10 6 to 10 14 particles/ml or 10 3 to 10 15 particles/ml, or any values therebetween for either range, such as for example, about 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , 10 12 , 10 13 , or 10 14 particles/ml.
  • rAAV particles of higher than 10 particles/ml may be administered.
  • the number of rAAV particles administered to a subject may be on the order ranging from 10 6 to 10 14 vector
  • rAAV particles of higher than 10 13 vgs/ml are administered.
  • the rAAV particles can be
  • 0.0001 ml to 10 mis e.g., 0.001ml, 0.01ml, 0.1ml, 1 ml, 2ml, 5ml or 10 ml, are delivered to a subject.
  • the number of rAAV particles administered to a subject may be on the order ranging from 10 6 -10 14 vg/kg, or any values therebetween, such as for example, about 10 6 , 10 7 , 10 8 , 10 9 , 10 10 , 10 11 , 10 12 , 10 13 , or 10 14 vgs/mg.
  • the disclosure provides formulations of one or more viral- based compositions disclosed herein in pharmaceutically acceptable solutions for
  • rAAV particles described herein may be administered in combination with other agents as well, such as, e.g., proteins or polypeptides or various pharmaceutically- active agents, including one or more systemic or topical administrations of therapeutic polypeptides, biologically active fragments, or variants thereof.
  • agents such as, e.g., proteins or polypeptides or various pharmaceutically- active agents, including one or more systemic or topical administrations of therapeutic polypeptides, biologically active fragments, or variants thereof.
  • agents e.g., proteins or polypeptides or various pharmaceutically- active agents, including one or more systemic or topical administrations of therapeutic polypeptides, biologically active fragments, or variants thereof.
  • additional agents do not cause a significant adverse effect upon contact with the target cells or host tissues.
  • the rAAV particles may thus be delivered along with various other agents as required in the particular instance.
  • Such compositions may be purified from host cells or other biological sources, or alternatively may be chemically synthesized as described here
  • Formulation of pharmaceutically- acceptable excipients and carrier solutions is well-known to those of skill in the art, as is the development of suitable dosing and treatment regimens for using the particular compositions described herein in a variety of treatment regimens, including e.g., oral, parenteral, intravitreal, intraocular, intravenous, intranasal, intra- articular, and intramuscular administration and formulation.
  • these formulations may contain at least about 0.1% of the therapeutic agent (e.g., rAAV particle) or more, although the percentage of the active ingredient(s) may, of course, be varied and may conveniently be between about 1 or 2% and about 70% or 80% or more of the weight or volume of the total formulation.
  • the amount of therapeutic agent(s) in each therapeutically-useful composition may be prepared is such a way that a suitable dosage will be obtained in any given unit dose of the compound.
  • compositions suitable for injectable use include sterile aqueous solutions or dispersions.
  • the form is sterile and fluid to the extent that easy syringability exists.
  • the form is stable under the conditions of manufacture and storage and is preserved against the contaminating action of microorganisms, such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, saline, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and/or vegetable oils.
  • a solvent or dispersion medium containing, for example, water, saline, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and/or vegetable oils.
  • polyol e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
  • suitable mixtures thereof e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
  • vegetable oils e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
  • carrier refers to a diluent, adjuvant, excipient, or vehicle with which the rAAV particle is administered.
  • Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum oil such as mineral oil, vegetable oil such as peanut oil, soybean oil, and sesame oil, animal oil, or oil of synthetic origin. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers.
  • exemplary carriers include phosphate buffered saline, HEPES -buffered saline, and water for injection, any of which may be optionally combined with one or more of calcium chloride dihydrate, disodium phosphate anhydrous, magnesium chloride hexahydrate, potassium chloride, potassium dihydrogen phosphate, sodium chloride, or sucrose.
  • compositions of the present disclosure can be administered to the subject being treated by standard routes including, but not limited to, pulmonary, intranasal, oral, inhalation, parenteral such as intravenous, topical, transdermal, intradermal, transmucosal, intraperitoneal, intramuscular, intracapsular, intraorbital, intravitreal, intracardiac, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection.
  • the composition is administered intravenously, by hepatic artery infusion, portal vein injection, or intrasplenic injection.
  • the composition comprises a AAV8 rAAV particle comprising a rAAV nucleic acid vector as described herein, and the composition is administered intravenously.
  • the solution may be suitably buffered, if necessary, and the liquid diluent first rendered isotonic with sufficient saline or glucose.
  • aqueous solutions are especially suitable for intravenous, intramuscular, intravitreal, subcutaneous and intraperitoneal administration.
  • a sterile aqueous medium that can be employed will be known to those of skill in the art in light of the present disclosure.
  • one dosage may be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion, (see for example, "Remington's Pharmaceutical Sciences” 15th Edition, pages 1035-1038 and 1570-1580). Some variation in dosage may occur depending on the condition of the subject being treated. The person responsible for administration will, in any event, determine the appropriate dose for the individual subject. Moreover, for human administration, preparations should meet sterility, pyrogenicity, and the general safety and purity standards as required by, e.g., FDA Office of Biologies standards.
  • Sterile injectable solutions may be prepared by incorporating the rAAV particles in the required amount in the appropriate solvent with several of the other ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • exemplary methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • compositions and time of administration of such compositions will be within the purview of the skilled artisan having benefit of the present teachings. It is likely, however, that the administration of therapeutically-effective amounts of the disclosed compositions may be achieved by a single administration, such as for example, a single injection of sufficient numbers of viral particles to provide therapeutic benefit to the patient undergoing such treatment. Alternatively, in some circumstances, it may be desirable to provide multiple, or successive administrations of the compositions, either over a relatively short, or a relatively prolonged period of time, as may be determined by the medical practitioner overseeing the administration of such compositions.
  • composition may include rAAV particles or nucleic acid vectors either alone, or in combination with one or more additional active ingredients, which may be obtained from natural or recombinant sources or chemically synthesized.
  • polynucleotides, nucleic acid segments, nucleic acid sequences, and the like include, but are not limited to, DNAs (including and not limited to genomic or extragenomic DNAs), genes, peptide nucleic acids (PNAs), RNAs (including, but not limited to, rRNAs, mRNAs and tRNAs), nucleosides, and suitable nucleic acid segments either obtained from natural sources, chemically synthesized, modified, or otherwise prepared or synthesized in whole or in part by the hand of man.
  • DNAs including and not limited to genomic or extragenomic DNAs
  • genes include peptide nucleic acids (PNAs), RNAs (including, but not limited to, rRNAs, mRNAs and tRNAs), nucleosides, and suitable nucleic acid segments either obtained from natural sources, chemically synthesized, modified, or otherwise prepared or synthesized in whole or in part by the hand of man.
  • PNAs peptide nucleic acids
  • subject describes an organism, including mammals such as primates, to which treatment with the compositions according to the present invention can be provided.
  • Mammalian species that can benefit from the disclosed methods of treatment include, but are not limited to, humans; apes; chimpanzees; orangutans; monkeys; domesticated animals such as dogs and cats; livestock such as horses, cattle, pigs, sheep, goats, and chickens; and other animals such as mice, rats, guinea pigs, and hamsters.
  • the subject has, is suspected of having, is at risk for developing, or has been diagnosed with an autoimmune disease or disorder, such as multiple sclerosis, disseminated sclerosis, or encephalomyelitis disseminata.
  • an autoimmune disease or disorder such as multiple sclerosis, disseminated sclerosis, or encephalomyelitis disseminata.
  • Other exemplary autoimmune diseases include type 1 diabetes, Grave' s disease, arthritis (e.g., rheumatoid arthritis or PGIA), autoimmune uveitis, Peripheral Neuropathy, Myasthenia gravis, Lupus, and Crohn' s disease.
  • an autoimmune disease or disorder is associated with an infection (e.g., a microbial or viral infection).
  • an infection e.g., a microbial or viral infection.
  • treatment includes but is not limited to, alleviating a symptom of a disease or condition; and/or reducing, suppressing, inhibiting, lessening, ameliorating or affecting the progression, severity, and/or scope of a disease or condition.
  • the term "effective amount,” as used herein, refers to an amount that is capable of treating or ameliorating a disease or condition or otherwise capable of producing an intended therapeutic effect.
  • promoter refers to a region or regions of a nucleic acid sequence that regulates transcription.
  • regulatory element refers to a region or regions of a nucleic acid sequence that regulates transcription.
  • exemplary regulatory elements include, but are not limited to, enhancers, post-transcriptional elements, transcriptional control sequences, and such like.
  • the tern "vector,” as used herein, refers to a nucleic acid molecule (typically comprised of DNA) capable of replication in a host cell and/or to which another nucleic acid segment can be operatively linked so as to bring about replication of the attached segment.
  • a plasmid, cosmid, or a virus is an exemplary vector.
  • substantially identical denote a characteristic of a nucleic acid or an amino acid sequence, wherein a selected nucleic acid or amino acid sequence has at least about 70 or about 75 percent sequence identity as compared to a selected reference nucleic acid or amino acid sequence. More typically, the selected sequence and the reference sequence will have at least about 76, 77, 78, 79, 80, 81, 82, 83, 84 or even 85 percent sequence identity, and more preferably, at least about 86, 87, 88, 89, 90, 91, 92, 93, 94, or 95 percent sequence identity. More preferably still, highly homologous sequences often share greater than at least about 96, 97, 98, or 99 percent sequence identity between the selected sequence and the reference sequence to which it was compared.
  • the percentage of sequence identity may be calculated over the entire length of the sequences to be compared, or may be calculated by excluding small deletions or additions which total less than about 25 percent or so of the chosen reference sequence.
  • the reference sequence may be a subset of a larger sequence, such as a portion of a gene or flanking sequence, or a repetitive portion of a chromosome.
  • the reference sequence will typically comprise at least about 18-25 nucleotides, more typically at least about 26 to 35 nucleotides, and even more typically at least about 40, 50, 60, 70, 80, 90, or even 100 or so nucleotides.
  • the extent of percent identity between the two sequences will be at least about 80%, preferably at least about 85%, and more preferably about 90% or 95% or higher, as readily determined by one or more of the sequence comparison algorithms well-known to those of skill in the art, such as e.g., the FASTA program analysis described by Pearson and Lipman (1988).
  • operably linked refers to that the nucleic acid sequences being linked are typically contiguous, or substantially contiguous, and, where necessary to join two protein coding regions, contiguous and in reading frame. However, since enhancers generally function when separated from the promoter by several kilobases and intronic sequences may be of variable lengths, some polynucleotide elements may be operably linked but not contiguous.
  • biologically active refers to a variant nucleic acid or protein sequence that has substantially the same activity, such as reduction of clinical severity of EAE in a mouse model or induction of T regulatory cells as described in Example 1, Example 2, Example 3, or Example 4 below, as a nucleic acid or protein as described herein (e.g., has substantially the same or the same activity as a MOG, PLP, or MBP nucleic acid or protein described herein).
  • hepatocyte-restricted expression of an AAV- delivered neuroantigen establishes persistent immunological tolerance mediated by antigen- specific Tregs capable of preventing and reversing EAE in mice.
  • This example describes the development of a protocol that persistently induces Tregs in vivo and prevents disease development in a murine model of MS. The example also determines if tolerance can induce remission of pre-existing EAE disease and substantially reduce clinical and tissue-associated pathology.
  • Neurodegenerative disease such as Multiple sclerosis (MS) is characterized by chronic infiltration of the CNS by pathogenic autoreactive lymphocytes that recognize neuroantigens.
  • Functional defects in the endogenous regulatory T cells (Tregs) leading to a failure of central and/or peripheral mechanisms required for maintaining immunological tolerance combined with T cells recognizing myelin protein peptides are implicated in the pathogenesis of the disease.
  • EAE experimental autoimmune encephalomyelitis
  • MOG myelin oligodendrocyte glycoprotein
  • Hepatic gene transfer with AAV vectors containing liver specific promoters can produce stable transgene expression and induce a robust antigen- specific immune tolerance to a variety of therapeutic proteins. It has been reported that induced Tregs not only suppress cellular immune responses against the transgene product but can also suppress humoral responses. Importantly, it has been shown that immune tolerance established by antigen expression in the liver is maintained even when the antigen was subsequently expressed in a highly immunogenic manner in other organs, such as skeletal muscle or intravenously.
  • mice receiving AAV8-MOG were injected with either AAV8-MOG or -GFP vector. 2 weeks later EAE was induced and the mice were monitored and scored according to the classic scale for clinical signs of EAE. Plasma was obtained at 0, 7 and 14 days post EAE or at 0, 11, 19, 26, and 35 days post EAE. The results revealed that mice receiving AAV8-MOG were clearly protected from developing EAE. Furthermore, these mice also did not produce any anti-MOG IgGl or IgG2c autoantibodies. In contrast, those mice receiving the control vector developed severe EAE with elevated antibody titers (FIGs. 7 and 8).
  • liver directed gene transfer using an AAV vector expressing a neuro-antigen is capable of suppressing inflammation in the CNS and preventing EAE.
  • using AAV to express a full-length neuro-protein will enable greater applicability across MS-associated HLA haplotypes.
  • Ongoing plans are to evaluate reversal of pre-existing EAE and functional analysis of the interplay of effector (Thl/Thl7) cells and Tregs.
  • MBP sequence in vector MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDT AVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDP TAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDS IGRFFSGDRGAPKR GSGKVSSEP* (SEQ ID NO : 1 )
  • C57BL MOG35-55 MEVGWYRSPFSRVVHLYRNGK (SEQ ID NO:6)
  • SJL MOG92-106 DEGGYTCFFRDHSYQ (SEQ ID NO:7)
  • AAV8 vectors can stably express a neuro-protein in hepatocytes.
  • AAV8-MOG can prevent the development of EAE, and AAV8-MOG can abrogate clinical symptoms of established EAE.
  • This example describes the development of a (pre)clinically relevant therapy using viral gene transfer that will result in the induction and expansion of antigen- specific T cells, re-establishing immunological tolerance as a treatment for multiple sclerosis.
  • the approach has broad application as it uses full length myelin oligodendrocyte glycoprotein (MOG) protein and thus abrogates the needs for identifying HLA/MHC specific epitopes for inducing antigen specific Tregs.
  • MOG myelin oligodendrocyte glycoprotein
  • the present invention provides a novel therapy that not only focuses on reducing CD4 + T cells, but that can also target the effect of CD8 + T cells, B cells, and B cell derived components of the immune system.
  • Previous data suggests that the presentation of neuro-antigens within liver delivered by AAV should have significant clinical relevance as a therapeutic intervention for MS and other autoimmune diseases.
  • This application of gene therapy represents a new and innovative treatment option for MS.
  • mice will be randomly selected to receive hepatic gene transfer using AAV8-MOG or control vector. A detailed clinical assessment will be recorded daily. At various time points, blood/serum will be collected and analyzed as above. Upon sacrificing, liver and CNS tissue will be harvested and preserved for pathological and histochemical analysis.
  • GFP + Tregs isolated by FACS from transgenic mice ("Foxp3 EGFP " 6.Cg-Foxp3 tm2Tch /J) that received vector 4 wks earlier will be co-cultured with allogeneic splenocytes obtained from 2D2-TCR mice (MOG specific TCR) in the presence of MOG peptide. Cells and culture supernatant will be analyzed for activation, apoptosis, Thl/Th2/Thl7 cytokines, or CTL activity via specific assays.
  • Tregs In vivo adoptive transfer of Tregs: To test whether the immunosuppressive function of Tg-specific Tregs are able to attenuate disease progression, GFP + Tregs isolated as above, will be adoptively transferred into (a), naive mice that will subjected to EAE induction 24hrs later AND (b). mice that have undergone MOG induced EAE. These conditions will mirror the events from Aim 1.1 prevention and 1.2 reversal. At various time points, blood/serum will be collected; and liver and CNS tissue will be harvested and analyzed as above.
  • the overall theme of the present invention is the development of a gene therapy based method for in vivo induction of endogenous antigen (Ag)- specific regulatory T-cells (Tregs) using liver-directed Adeno-associated virus (AAV) gene therapy, as a novel treatment strategy for autoimmune diseases, e.g., multiple sclerosis (MS).
  • Ag endogenous antigen
  • Regs specific regulatory T-cells
  • AAV liver-directed Adeno-associated virus
  • MS is an autoimmune neurodegenerative disease of the central nervous system (CNS) in which the etiology is not well understood.
  • CNS central nervous system
  • CD4 + T cells play a central role
  • the breakdown of immune tolerance mechanisms that permits activation of naive myelin- specific T cells is considered an initial step in the pathogenesis of MS.
  • a number of pivotal studies in rodent models have substantiated that Ag-specific Tregs have a significant role in modulating autoimmune CNS disease and can be highly effective at treating MS. 1"5
  • successful therapeutic use of Tregs has been limited by the lack of safe and effective Ag- specific protocols for isolation and expansion that are suitable for translation.
  • hepatocyte-restricted transgene expression from an optimized AAV vector can reliably induce immune tolerance to various therapeutic proteins, including coagulation factor IX (F.IX), a- 1 -antitrypsin, erythropoietin, and lysosomal storage enzymes, among others.
  • F.IX coagulation factor IX
  • erythropoietin erythropoietin
  • lysosomal storage enzymes among others.
  • AAV induced tolerance is mediated by Ag-specific CD4 + CD25 + FoxP3 + Tregs, which is critically dependent on achieving and maintaining adequate hepatocyte-restricted transgene expression. 7- " 9 It has also been demonstrated that AAV induced Tregs can actively suppress antibody formation and cytotoxic CD8 + T cell responses against the transgene product. 7 ' 10 ' 11 Tolerized animals fail to form antibodies to the transgene even after subsequent attempts to immunize with protein formulated in adjuvant.
  • MS is the most common cause of neurologic disability in young adults between 18 and 45 years of age. This demographic represents the majority of the adult workforce in the United States; therefore, the direct and indirect costs of health care for this population currently are estimated at $12 billion annually. 38
  • MS Multiple sclerosis
  • CNS inflammation a protracted, immune-mediated disease of the CNS.
  • MS is a neuroinflammatory autoimmune disease in which T cell driven inflammation leads to demyelination and damage of axons.
  • myelin-specific CD4 + T cells play a central role in initiating and orchestrating CNS inflammation.
  • lymphocytes is thought to be a key event in the development and pathogenesis of MS. 4 ' 39-41 Several studies using in vitro suppression assays have documented functional impairments of Tregs from MS patients. 42 ' 43 Experiments in mice using adoptive transfer of myelin- specific Tregs or Treg depletion have also provided evidence that Tregs can control the development and severity of experimental autoimmune encephalomyelitis (EAE) and accumulate within the CNS during the recovery. 44 It has also been shown that transgenic mice expressing myelin basic protein (MBP) could prevent the onset of EAE disease in mice in a Treg dependent process. 45 ' 46 In fact, the mechanism-of-action for several of the currently approved immune- modulators used in the treatment of MS are associated with restoring Treg homeostasis. 39 ' 41 '
  • Treg cells influence the susceptibility and progression of disease.
  • Recent advances have led to the recognition that Ag-specific Tregs represents an ideal form of cell therapy for MS.
  • Tregs are still among the least understood T cell subsets, and consequently the most difficult to use for therapeutic applications.
  • AAV vectors specifically have had great successes with in vivo gene transfer to a variety of target tissues. 12 For example, AAV gene transfer to retinal epithelial cells restores vision in children with Leber's Congenital Amaurosis (LCA) and with
  • AAV vector for treatment of lipoprotein lipase is the first gene therapy drug approved in the Western world ("Glybera").
  • Gene therapy by hepatic AAV administration has resulted in sustained expression of factor IX (F.IX) at levels of >5 of normal in hemophilia B patients, changing their bleeding phenotype from severe to mild.
  • F.IX factor IX
  • Hepatic AAV gene transfer promotes tolerance via induction of transgene product- specific Treg, a phenomenon that can be exploited for the treatment of MS. 6 ' 21 ' 34 ' 35 ' 49 ' 53
  • oligodendrocyte glycoprotein MOG
  • PGP proteolipid proteins
  • AAV8 liver gene transfer of a neural protein induces activation of Ag-specific Tregs, sufficient to re-establish immune tolerance and abrogate disease progression in the CNS of a murine model for MS.
  • Immune tolerance induction by hepatic AAV gene transfer does not require protein to be secreted. Although hepatic expression is crucial for tolerance induction, secretion from hepatocytes for systemic delivery of the transgene product is not required. Expression of a cytoplasmic a neo-antigen in as few as 3% of the hepatocytes is sufficient to induce Tregs and provide long-term suppression of inflammatory responses. 57
  • EAE is a widely accepted experimental mouse model of multiple sclerosis that is induced in susceptible animals by immunization with central nervous system antigens.
  • EAE is an autoimmune disease that is mediated by CD4 + T helper 1 (T R I) cells and interleukin-17 producing T H 17 cells that are reactive to components of the myelin sheath.
  • T R I T helper 1
  • T H 17 cells T H 17 cells that are reactive to components of the myelin sheath.
  • the cells infiltrate the nervous parenchyma, release pro-inflammatory cytokines and chemokines, promote leukocyte infiltration and contribute to demyelination.
  • EAE can be induced in various strains of mice using different neuro-proteins emulsified in complete Freud's adjuvant (CFA). Disease progression and pathology manifests differently with each combination.
  • CFA Freud's adjuvant
  • MOG produces encephalitogenic T-cells and demyelinating autoantibodies in C57BL/6 mice.
  • the resulting disease is a chronic-progressive disease characterized by axonal demyelination and white matter lesions in the spinal cord and is generally considered to be a relevant model for human immune-mediated demyelinating disease.
  • 60 EAE can also be induced in SJL (H-2s) mice using the major encephalitogenic (ii) PLP peptide (PLP ⁇ g. ⁇ ).
  • PLP ⁇ g. ⁇ major encephalitogenic mice
  • the disease is characterized by a relapsing-remitting course of paralysis, which allows assessment of the efficacy of various immune regulatory strategies in a re-occurring disease setting.
  • Novel AAV8 vectors transduce mouse hepatocytes efficiently and express the delivered neural protein:
  • AAV is a non-pathogenic single stranded DNA parvovirus with a genome size of approximately 4.7kb.
  • Serotypes with distinct tissue tropisms have been isolated from multiple vertebrate species, including humans.
  • Viral vectors derived from AAV are devoid of viral genes and instead contain an expression cassette for the gene of interest, which is limited to ⁇ 5kb in length.
  • an AAV8 serotype vector was chosen because it has strong natural tropism for hepatocytes after peripheral vein administration, avoiding the need for an invasive procedure. Additionally, it fails to transduce professional antigen presenting cells (APCs).
  • the engineered vector constructs include a strong and highly hepatocyte-specific promoter. 10
  • the newly synthesized vectors were evaluated for transduction efficiency. To demonstrate efficacy, the inventors assessed whether mouse hepatocytes could be transduced and express the neuro-protein transgene following tail vein injection. A group of mice was injected with 1 x 10 11 vector particles of AAV8-ApoE/hAAT-MOG. Two weeks later, using liver lysates evidence of hepatic expression of MOG was probed by both western blot and qPCR analysis. The results clearly demonstrate the ability this novel vector to stably produce hepatic expression of the neuro-antigen after liver gene transfer (FIG. 4A and FIG. 4B).
  • AAV8-MOG produces hepatic transgene expression that can prevent the establishment ofEAE: Previously others have shown that ectopic expression of a myelin- associated protein using various transient methodologies promoted resistance to EAE. 18 ' 28 ' 45 ' 61 Unfortunately, these prior approaches have not developed into practical therapies for human autoimmune disease. Prior to this invention, the ability of AAV liver gene transfer to induce antigen specific suppression of autoimmune disease went untested in the scientific community.
  • mice were intravenously injected with 10 11 vector particles via the tail vein with either AAV8-MOG or AAV8-GFP (control) vector.
  • AAV8-MOG AAV8-GFP
  • AAV8-GFP control vector
  • Plasma samples were obtained at 0, 7 and 14 days post EAE induction or at 0, 11, 19, 26, and 35 days post EAE induction.
  • the mice that received AAV8-MOG were essentially protected from developing EAE (FIG. 6A, FIG. 6B, and FIG. 6C).
  • those mice receiving the control vector developed severe EAE with elevated antibody titers. This data indicates that the vectors described herein not only express in the liver, but also had an immune modulatory effect.
  • Active suppression by Tregs plays a key role in the control of auto-reactive T cells and the induction of peripheral tolerance in vivo.
  • the significance of Ag-specific Tregs in conferring resistance to organ-specific autoimmunity and in limiting autoimmune tissue damage has been documented in many disease models, including MS. 44
  • a safe and clinically feasible method for sustained expansion of endogenous Tregs has yet been identified.
  • 41 ' 44 ' 60 ' 63 a treatment protocol based on liver-directed AAV gene therapy can durably induce Ag-specific tolerance, thus having the potential of blocking the pathogenic autoimmune response present in MS and inhibiting disease activity; while avoiding the severe side effects associated with many of the currently used immunotherapies.
  • AAV8-liver gene transfer can restore immunological tolerance against myelin-sheath antigens, such as MOG and PLP, by inducing Ag-specific Tregs in vivo.
  • Humoral immune responses may be determined via antigen specific ELISA.
  • Tissues blood, liver, spleen, and CNS (brain/spinal cord)
  • Hepatic transgene expression levels may be determined at the mRNA level using real-time quantitative PCR. Absolute and relative hepatic protein levels of the transgene will also be determined via western blot using liver lysates.
  • the remainder of the mice may be processed similarly to establish sustained transgene expression. Additionally, some mice may be subjected to EAE induction at various time points after vector administration and evaluated for prevention of disease, as described in preliminary data. Aliquots of the collected tissue samples may be archived as a reference material.
  • Splenic Tregs may be magnetically sorted from mice that received (i) AAV8-MOG or (ii) AAV8-PLP or AAV8-GFP (control) vector and co- cultured with graded numbers of CFSE labeled cells obtained from 2D2-TCR mice (this C57B1/6 mouse line expresses a TCR which recognize MOG 35 55 in the context of H-2 IA b ) or splenocytes harvested and labeled from SJL mice that have been previously immunized with PLP/adjuvant in the presence of anti-CD3/CD28 coated beads (provides APC independent/non-specific activation of Teff).
  • Treg mediated suppression of proliferating effector cells may be determined by flow cytometry.
  • Cell-culture supernatants may be analyzed for Thl/Th2/Thl7 cytokines via specific assays. Results may be compared with data from naive and EAE induced mice (in which many CD4 + CD25 + cells should represent activated effector rather than Treg). In combination, these studies will demonstrate Ag- specific functional suppression from the vector induced Tregs compared to controls.
  • ALT/AST liver enzymes
  • Tregs are potent suppressors of EAE and are the driving force to switch from disease progression to remission
  • very few studies in the past have addressed how to generate such Ag-specific Tregs that is both safe and effective.
  • Bluestone' s group in a type-1 diabetes model provided initial proof of principle for this approach.
  • others have further shown that using expanded Tregs from myelin- specific transgenic TCR mice is more effective.
  • the second approach is to administer a suitable treatment that promotes the expansion of Treg numbers and/or function in vivo.
  • Recent reports have described the use of various compounds (e.g. nano- particles/small molecules) to enhance Treg function in EAE, while others try to augment antigen presentation in order to generate Tregs.
  • 64 ' 66 In the end, a reliable and translatable method for induction of the disease relevant Ag-specific Tregs is still lacking— until now.
  • This proposal presents a methodology that will provide a durable method for the continued in vivo induction of endogenous Ag-specific Tregs.
  • hepatic gene transfer using AAV8 vectors expressing full-length MOG or PLP should induce Ag-specific Tregs across multiple endogenous myelin epitopes in a manner that has been shown to be safe, feasible, and long-lasting.
  • mice will first under go active induction of EAE using either (i) MOG or (ii) PLP.
  • MOG MOG induced chronic-progressive mice, or at the peak of disease, in PLP induced relapsing-remitting mice
  • AAV8-MOG or AAV8-PLP vector (respectively) or AAV8-GFP for control mice may be given.
  • Mice may be clinically scored by weight and neurological deficit 2x daily.
  • Blood may be collected and analyzed for humoral (IgG) responses as before.
  • IgG humoral
  • each cohort mice may be perfused and randomly subdivided into 2 groups.
  • Group 1 will have brain, spinal cord, and liver tissues harvested and preserved for
  • Infiltrating lymphocytes may be isolated from the brain and spinal cords from mice in Group 2 (as previously described 67 ).
  • the frequency of various T cell populations may be analyzed using standard markers of T cells (including, but not limited to, CD4, CD8, FoxP3, CD25, CD62L, CD44, CTLA-4, CD103).
  • Liver tissue may be subjected to transcriptional and protein analysis as shown. Results may be compared to control mice and reference material. Portions of the tissue may also be archived for future studies.
  • mice that receive MOG for EAE induction begin showing neurological impairments after -12 days that progressively escalate.
  • some level of inflammation will still be present, although; the phenotypic analysis of the T cells populations show that absolute numbers of T cells infiltrating the CNS to be lower with a greater Treg:Teff ratio.
  • Rapamycin readily crosses the BBB thus exerting direct effects within the CNS. Blocking the activation of the mTOR pathway, rapamycin prevents activation of T cells by inhibiting their response to IL-2 thus preventing Ag-induced proliferation of Teff, while selectively allowing expansion of functional CD4 + CD25 + FoxP3 + Tregs. In EAE, rapamycin is effective in preventing the onset of disease, however; suppression of established disease is only maintained with continued use. 69 In a further series of experiments, vector treated mice are transiently
  • mice are then injected with AAV8-MOG, -PLP, -GFP or PBS at specific time-points that correspond to either initial onset or peak of disease.
  • Concurrently mice receive intraperitoneal rapamycin (1 mg/kg), or PBS (sham control) daily for 14 consecutive days.
  • tissues and lymphocytes may be harvested from the CNS and spleen from randomly selected mice. Histopathological changes within the tissues can then be identified. Isolated cells are then phenotyped and the frequency of Tregs and Teff from the different compartments may be determined and compared to control groups to validate the efficacy of rapamycin co-treatment.
  • rapamycin treatment has a synergistic effect that results in an increase in vector induced Ag-specific FoxP3 + Tregs (since they are less sensitive to mTOR signaling inhibition) with a corresponding decrease in effector T cells. 70 The shift to tolerance is further potentiated by the fact Tregs have been shown to mediate selective inhibition of antigen- specific Thl cells in the CNS of EAE. 71
  • the therapeutic regimen presented here addresses an unmet need by providing an effective treatment for diseases such as MS using a gene therapy approach.
  • Using the AAV vector platform disclosed herein to deliver full-length proteins offers a superior HLA independent approach for Ag-specific Treg induction compared to other ex vivo or epitope restricted Treg mediated therapies.
  • AAV gene transfer results in continuous Treg generation because of the long-term hepatocyte expression of transgene.
  • Faust SM Bell P, Zhu Y, Sanmiguel J, Wilson JM.
  • Molecular therapy the journal of the American Society of Gene Therapy. 2013;21(12):2227-35.
  • Markusic DM Hoffman BE, Perrin GQ, Nayak S, Wang X, LoDuca PA, High KA, Herzog RW. Effective gene therapy for haemophilic mice with pathogenic factor IX antibodies.
  • Annoni A Brown BD, Cantore A, Sergi LS, Naldini L, Roncarolo MG.
  • Mingozzi F Hasbrouck NC, Basner-Tschakarjan E, Edmonson SA, Hui DJ, Sabatino DE, Zhou S, Wright JF, Jiang H, Pierce GF, Arruda VR, High KA. Modulation of tolerance to the transgene product in a nonhuman primate model of AAV-mediated gene transfer to liver. Blood. 2007;110(7):2334-41. Sun B, Kulis MD, Young SP, Hobeika AC, Li S, Bird A, Zhang H, Li Y, Clay TM, Burks W, Kishnani PS, Koeberl DD. Immunomodulatory gene therapy prevents antibody formation and lethal hypersensitivity reactions in murine pompe disease. Molecular therapy : the journal of the American Society of Gene Therapy.
  • a microRNA-regulated and GP64- pseudotyped lentiviral vector mediates stable expression of FVIII in a murine model of Hemophilia A. Molecular therapy: the journal of the American Society of Gene Therapy. 2011;19(4):723-30. Matsui H, Shibata M, Brown B, Labelle A, Hegadorn C, Andrews C, Chuah M, VandenDriessche T, Miao CH, Hough C, Lillicrap D. A murine model for induction of long-term immunologic tolerance to factor VIII does not require persistent detectable levels of plasma factor VIII and involves contributions from Foxp3+ T regulatory cells. Blood. 2009;114(3):677-85. McEachern KA, Nietupski JB, Chuang WL, Armentano D, Johnson J, Hutto E, Grabowski GA, Cheng SH, Marshall J. AAV8-mediated expression of
  • glucocerebrosidase ameliorates the storage pathology in the visceral organs of a mouse model of Gaucher disease. Journal of Gene Medicine, 2006;8(6):719-29. Nietupski JB, Hurlbut GD, Ziegler RJ, Chu Q, Hodges BL, Ashe KM, Bree M, Cheng SH, Gregory RJ, Marshall J, Scheule RK. Systemic administration of AAV8-alpha- galactosidase A induces humoral tolerance in nonhuman primates despite low hepatic expression. Molecular therapy : the journal of the American Society of Gene Therapy. 2011;19(11): 1999-2011.
  • AAV2 vector harboring a liver-restricted promoter facilitates sustained expression of therapeutic levels of alpha-galactosidase A and the induction of immune tolerance in Fabry mice.
  • Molecular therapy the journal of the American Society of Gene Therapy. 2004;9(2):231-40.
  • Glucocorticoid amplifies IL-2-dependent expansion of functional
  • control AAV8-GFP was injected intravenously into mice. Two weeks later, EAE was induced or not induced. The AAV control vector did not appear to interfere with development or progression of EAE (FIG. 12).
  • mice received AAV8- MOG or control vector. Mean clinical score was recorded. Even at increasing disease pathology, AAV-MOG vector had significantly reduced neurological deficit compared to control vector treated mice (FIGs. 13A-C). Bar graphs show statistical significance between final scores and peak-to-final scores.
  • Treg regulatory T cell
  • Treg-mediated suppression was measured by CFDA-SE Cell Tracer .
  • Effector T cells Teff
  • Treg regulatory T cell
  • Treg:Teff ratios After 72 hours, proliferation was determined by CFDA dilution and flow cytometric analysis. Tregs isolated from spleens of AAV-MOG treated mice were found to be functionally suppressive (FIG. 16A and 16B). [00190] In a further study, the ability of AAV-MOG to induce antigen specific Tregs was assessed. Splenocytes from mice injected with AAV-MOG vector 8 weeks prior showed an increase in frequencies of I-Ab MOG 35 -55 Tetramer positive CD4+ and Treg+ compared to control tetramer (FIGs. 17A-D), indicating that AAV-MOG vector induced antigen specific Tregs.
  • AAV8-PLP was used for this part of the study.
  • the PLP used was murine PLP.
  • This initial proof-of-concept experiment demonstrated the timeline and clinical scoring for successful induction of PLP/EAE and the potential therapeutic benefit of liver gene transfer.
  • Female SJL mice were injected with AAV8-PLP or control 2 weeks before immunization with 20C ⁇ g PLP emulsified in CFA containing 4mg/ml Mycobacterium tuberculosis. Clinical signs of EAE began -10 days later at which time mice were evaluated twice daily. Mice were scored according to the severity of the clinical signs (FIG. 2).
  • mice receiving AAV8-PLP vector had a significant reduction in disease at the peak of onset (FIG. 18). There was also a significant decrease in MCS during relapse (day 26) with fewer relapses overall (FIG. 18). These results show that AAV8-PLP reduced clinical severity in mice with PLP induced relapsing-remitting EAE. Increased reduction or complete prevention is anticipated with optimization of vector dose and timing.
  • AAV8-MBP was used for this part of the study.
  • the MBP used was murine MBP.
  • Western blot analysis from protein extracted from liver of mice injected with AAV8-MBP showed an increase in MBP expression (FIG. 19A), which was consistent with an increase in mRNA levels (FIG. 19B).
  • compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents that are chemically and/or physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Plant Pathology (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Immunology (AREA)
  • Rheumatology (AREA)
  • Mycology (AREA)
  • Pain & Pain Management (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2015/027598 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis Ceased WO2015164789A1 (en)

Priority Applications (18)

Application Number Priority Date Filing Date Title
CA2945984A CA2945984C (en) 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis
LTEP15782332.9T LT3133923T (lt) 2014-04-24 2015-04-24 Aav pagrindo genų terapija, skirta išsėtinei sklerozei
ES15782332T ES2814280T3 (es) 2014-04-24 2015-04-24 Terapia génica basada en VAA para la esclerosis múltiple
RS20201008A RS60816B1 (sr) 2014-04-24 2015-04-24 Genska terapija za multiplu sklerozu bazirana na aav
AU2015249328A AU2015249328B2 (en) 2014-04-24 2015-04-24 AAV-based gene therapy for multiple sclerosis
SM20200453T SMT202000453T1 (it) 2014-04-24 2015-04-24 Terapia genica a base di aav per la sclerosi multipla
US15/306,163 US20170043036A1 (en) 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis
DK15782332.9T DK3133923T3 (da) 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis
EP20167323.3A EP3744177A1 (en) 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis
PL15782332.9T PL3133923T3 (pl) 2014-04-24 2015-04-24 Oparta na aav genowa terapia stwardnienia rozsianego
HRP20201342TT HRP20201342T1 (hr) 2014-04-24 2015-04-24 Genetska terapija za multiplu sklerozu bazirana na aav
SI201531336T SI3133923T1 (sl) 2014-04-24 2015-04-24 Genska terapija za multiplo sklerozo na osnovi AAV
EP15782332.9A EP3133923B1 (en) 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis
JP2016564019A JP6646282B2 (ja) 2014-04-24 2015-04-24 多発性硬化症のためのaav系遺伝子療法
AU2019202958A AU2019202958B2 (en) 2014-04-24 2019-04-17 Aav-based gene therapy for multiple sclerosis
US16/679,102 US20200138978A1 (en) 2014-04-24 2019-11-08 Aav-based gene therapy for multiple sclerosis
CY20201100820T CY1123312T1 (el) 2014-04-24 2020-09-02 Aav-βασιζομενη γονιδιακη θεραπεια για σκληρυνση κατα πλακας
US18/191,790 US20230381342A1 (en) 2014-04-24 2023-03-28 Aav-based gene therapy for multiple sclerosis

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201461983924P 2014-04-24 2014-04-24
US61/983,924 2014-04-24

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/306,163 A-371-Of-International US20170043036A1 (en) 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis
US16/679,102 Division US20200138978A1 (en) 2014-04-24 2019-11-08 Aav-based gene therapy for multiple sclerosis

Publications (1)

Publication Number Publication Date
WO2015164789A1 true WO2015164789A1 (en) 2015-10-29

Family

ID=54333299

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/027598 Ceased WO2015164789A1 (en) 2014-04-24 2015-04-24 Aav-based gene therapy for multiple sclerosis

Country Status (17)

Country Link
US (3) US20170043036A1 (cg-RX-API-DMAC7.html)
EP (2) EP3133923B1 (cg-RX-API-DMAC7.html)
JP (3) JP6646282B2 (cg-RX-API-DMAC7.html)
AU (2) AU2015249328B2 (cg-RX-API-DMAC7.html)
CA (1) CA2945984C (cg-RX-API-DMAC7.html)
CY (1) CY1123312T1 (cg-RX-API-DMAC7.html)
DK (1) DK3133923T3 (cg-RX-API-DMAC7.html)
ES (1) ES2814280T3 (cg-RX-API-DMAC7.html)
HR (1) HRP20201342T1 (cg-RX-API-DMAC7.html)
HU (1) HUE050681T2 (cg-RX-API-DMAC7.html)
LT (1) LT3133923T (cg-RX-API-DMAC7.html)
PL (1) PL3133923T3 (cg-RX-API-DMAC7.html)
PT (1) PT3133923T (cg-RX-API-DMAC7.html)
RS (1) RS60816B1 (cg-RX-API-DMAC7.html)
SI (1) SI3133923T1 (cg-RX-API-DMAC7.html)
SM (1) SMT202000453T1 (cg-RX-API-DMAC7.html)
WO (1) WO2015164789A1 (cg-RX-API-DMAC7.html)

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP7270946B2 (ja) * 2017-08-08 2023-05-11 国立大学法人浜松医科大学 自己免疫疾患の治療又は予防剤
CA3111047A1 (en) * 2018-08-24 2020-02-27 Spark Therapeutics, Inc. Optimized promoter sequences, intron-free expression constructs and methods of use
EP3979993A4 (en) * 2019-06-04 2023-07-05 Thomas Jefferson University EXTRACELLULAR VESICLES OF OLIGODENDROCYTES FOR THE THERAPY OF MULTIPLE SCLEROSIS
AR121837A1 (es) 2020-04-14 2022-07-13 Univ Florida Terapias génicas basadas en aav para el tratamiento de enfermedades autoinmunes
EP4135852A4 (en) * 2020-04-14 2024-11-20 University Of Florida Research Foundation, Incorporated ENHANCED EFFECTS OF GENE IMMUNOTHERAPY AND IMMUNOSUPPRESSANTS IN MULTIPLE SCLEROSIS
EP4171660A4 (en) * 2020-06-30 2025-03-26 Children's National Medical Center USE OF RECOMBINANT HUMAN ACID SPHINGOMYELINASE TO IMPROVE SKELETAL MYOFIBER REPAIR
WO2024081570A1 (en) * 2022-10-10 2024-04-18 Eli Lilly And Company Methods and systems for using causal networks to develop models for evaluating biological processes
WO2024258925A1 (en) 2023-06-12 2024-12-19 Children's Hospital Medical Center Aav-cftr vectors and methods of using same

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020151509A1 (en) * 1996-12-02 2002-10-17 Richard O. Snyder Adeno-associated viral vector-mediated delivery of DNA to cells of the liver
US20070015238A1 (en) 2002-06-05 2007-01-18 Snyder Richard O Production of pseudotyped recombinant AAV virions
US20090304726A1 (en) * 2006-02-15 2009-12-10 Ramot At Tel Aviv University Ltd. Viral display vehicles for treating multiple sclerosis
US20120322861A1 (en) 2007-02-23 2012-12-20 Barry John Byrne Compositions and Methods for Treating Diseases
WO2013045488A1 (en) * 2011-09-26 2013-04-04 Universität Zürich Prorektorat Mnw Apc-mediated tolerance induction for therapy of multiple sclerosis

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FI961000A7 (fi) * 1993-09-03 1996-03-04 Immulogic Pharma Corp Myeliinioligodendrosyyttiglykoproteiinin ja tämän peptidiosien käyttöm uotoja autoimmuunisairauksiin liittyvissä menetelmissä
DE60104069T2 (de) * 2000-10-02 2005-08-25 Yonsei University Einkettige Insulinanaloge
KR100449454B1 (ko) * 2000-10-02 2004-09-21 이현철 단일사슬 인슐린 유도체의 유전자를 포함하는 당뇨병치료용 벡터
CA2361462A1 (en) * 2001-11-07 2003-05-08 Katherine A. High Induction of tolerance to a therapeutic polypeptide
DK2364362T3 (en) * 2008-11-12 2016-01-25 Ospedale San Raffaele Srl Gene vector FOR INDUCTION OF IMMUNE TOLERANCE transgene
AU2012225749B2 (en) * 2011-03-04 2015-01-22 Intrexon Corporation Vectors conditionally expressing protein
CA2929273C (en) * 2013-11-22 2022-05-31 Amarna Holding B.V. Method for restoring immune tolerance in vivo
AR121837A1 (es) * 2020-04-14 2022-07-13 Univ Florida Terapias génicas basadas en aav para el tratamiento de enfermedades autoinmunes

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20020151509A1 (en) * 1996-12-02 2002-10-17 Richard O. Snyder Adeno-associated viral vector-mediated delivery of DNA to cells of the liver
US20070015238A1 (en) 2002-06-05 2007-01-18 Snyder Richard O Production of pseudotyped recombinant AAV virions
US20090304726A1 (en) * 2006-02-15 2009-12-10 Ramot At Tel Aviv University Ltd. Viral display vehicles for treating multiple sclerosis
US20120322861A1 (en) 2007-02-23 2012-12-20 Barry John Byrne Compositions and Methods for Treating Diseases
WO2013045488A1 (en) * 2011-09-26 2013-04-04 Universität Zürich Prorektorat Mnw Apc-mediated tolerance induction for therapy of multiple sclerosis

Non-Patent Citations (9)

* Cited by examiner, † Cited by third party
Title
AURICCHIO ET AL., HUM. MOLEC. GENET., vol. 10, 2001, pages 3075 - 3081
DUAN ET AL., J. VIROL., vol. 75, 2001, pages 7662 - 7671
GRIMM ET AL., HELPER, 2003
GRIMM ET AL.: "Novel Tools for Production and Purification of Recombinant Adenoassociated Virus Vectors", HUMAN GENE THERAPY, vol. 9, 1998, pages 2745 - 2760, XP002093963
HALBERT ET AL., J. VIROL., vol. 74, 2000, pages 1524 - 1532
KERN, A. ET AL.: "Identification of a Heparin-Binding Motif on Adeno-Associated Virus Type 2 Capsids", JOURNAL OF VIROLOGY, vol. 77, 2003, pages 11072 - 11081, XP055548734, DOI: doi:10.1128/JVI.77.20.11072-11081.2003
KOHM APCARPENTIER PAANGER HAMILLER SD: "Cutting edge: CD4+CD25+ regulatory T cells suppress antigen-specific autoreactive immune responses and central nervous system inflammation during active experimental autoimmune encephalomyelitis", JOURNAL OF IMMUNOLOGY (BALTIMORE, MD, vol. 169, no. 9, 2002, pages 4712 - 4716, XP055419573, DOI: doi:10.4049/jimmunol.169.9.4712
LUTH ET AL.: "Ectopic expression of neural autoantigen in mouse liver suppresses experimental autoimmune neuroinflammation by inducing antigen-specific Tregs.", J CLIN INVEST., vol. 118, no. 10, October 2008 (2008-10-01), pages 3403 - 3410, XP055037006, ISSN: 0021-9738 *
ZOLOTUKHIN ET AL.: "Production and purification of serotype 1, 2, and 5 recombinant adeno-associated viral vectors", METHODS, vol. 28, 2002, pages 158 - 167, XP002256404, DOI: doi:10.1016/S1046-2023(02)00220-7

Also Published As

Publication number Publication date
CA2945984C (en) 2023-09-26
EP3133923A4 (en) 2017-12-27
JP2020062038A (ja) 2020-04-23
EP3133923B1 (en) 2020-06-03
DK3133923T3 (da) 2020-08-10
PT3133923T (pt) 2020-09-04
EP3133923A1 (en) 2017-03-01
JP7430898B2 (ja) 2024-02-14
CA2945984A1 (en) 2015-10-29
AU2019202958A1 (en) 2019-05-16
HUE050681T2 (hu) 2020-12-28
ES2814280T3 (es) 2021-03-26
AU2015249328A1 (en) 2016-10-27
JP6646282B2 (ja) 2020-02-14
CY1123312T1 (el) 2021-12-31
AU2019202958B2 (en) 2021-08-05
US20170043036A1 (en) 2017-02-16
JP2017513500A (ja) 2017-06-01
HRP20201342T1 (hr) 2020-11-27
US20230381342A1 (en) 2023-11-30
US20200138978A1 (en) 2020-05-07
AU2015249328B2 (en) 2019-01-17
PL3133923T3 (pl) 2021-02-22
SI3133923T1 (sl) 2020-11-30
RS60816B1 (sr) 2020-10-30
SMT202000453T1 (it) 2020-09-10
EP3744177A1 (en) 2020-12-02
LT3133923T (lt) 2020-08-25
JP2022081549A (ja) 2022-05-31

Similar Documents

Publication Publication Date Title
US20230381342A1 (en) Aav-based gene therapy for multiple sclerosis
EP3134522B1 (en) Recombinant aav vectors useful for reducing immunity against transgene products
AU2013262804B2 (en) High-transduction-efficiency rAAV vectors, compositions, and methods of use
AU2022204246A1 (en) Capsid-modified, raav3 vector compositions and uses in gene therapy of human liver cancer
EP4378487A2 (en) Modified factor ix, and compositions, methods and uses for gene transfer to cells, organs and tissues
US12297444B2 (en) AAV-based gene therapies for treatment of autoimmune diseases
CN117642173A (zh) 用于诱导对基因递送靶媒剂的免疫耐受性的方法和试剂盒
EP4149622A1 (en) Immunosuppressive agents and viral delivery re-dosing methods for gene therapy
US20230263909A1 (en) Enhanced effects of gene-immunotherapy and immunosuppressants in multiple sclerosis
US20230332180A1 (en) Use of novel mirna-binding site cassettes for antigen-presenting cell detargeting of transgene expression by raav gene therapy
HK40041411A (en) Aav-based gene therapy for multiple sclerosis
HK1234606B (en) Aav-based gene therapy for multiple sclerosis
HK1234606A1 (en) Aav-based gene therapy for multiple sclerosis
Li Optimization of Adeno-associated Virus Vectors Encoding Immune Checkpoint Protein for Arthritis Gene Therapy
Wang Overcoming Genetic and Immunological Barriers to the Use of Adeno-Associated Viral Vectors for Ocular Gene Therapy

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15782332

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2945984

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2016564019

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 15306163

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015249328

Country of ref document: AU

Date of ref document: 20150424

Kind code of ref document: A

REEP Request for entry into the european phase

Ref document number: 2015782332

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015782332

Country of ref document: EP