WO2015067943A1 - Methods of modulating seed and organ size in plants - Google Patents
Methods of modulating seed and organ size in plants Download PDFInfo
- Publication number
- WO2015067943A1 WO2015067943A1 PCT/GB2014/053296 GB2014053296W WO2015067943A1 WO 2015067943 A1 WO2015067943 A1 WO 2015067943A1 GB 2014053296 W GB2014053296 W GB 2014053296W WO 2015067943 A1 WO2015067943 A1 WO 2015067943A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- pro
- lim
- domain
- seq
- plant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01H—NEW PLANTS OR NON-TRANSGENIC PROCESSES FOR OBTAINING THEM; PLANT REPRODUCTION BY TISSUE CULTURE TECHNIQUES
- A01H5/00—Angiosperms, i.e. flowering plants, characterised by their plant parts; Angiosperms characterised otherwise than by their botanic taxonomy
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01H—NEW PLANTS OR NON-TRANSGENIC PROCESSES FOR OBTAINING THEM; PLANT REPRODUCTION BY TISSUE CULTURE TECHNIQUES
- A01H5/00—Angiosperms, i.e. flowering plants, characterised by their plant parts; Angiosperms characterised otherwise than by their botanic taxonomy
- A01H5/08—Fruits
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01H—NEW PLANTS OR NON-TRANSGENIC PROCESSES FOR OBTAINING THEM; PLANT REPRODUCTION BY TISSUE CULTURE TECHNIQUES
- A01H5/00—Angiosperms, i.e. flowering plants, characterised by their plant parts; Angiosperms characterised otherwise than by their botanic taxonomy
- A01H5/10—Seeds
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/415—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from plants
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A40/00—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production
- Y02A40/10—Adaptation technologies in agriculture, forestry, livestock or agroalimentary production in agriculture
- Y02A40/146—Genetically Modified [GMO] plants, e.g. transgenic plants
Definitions
- This invention relates to methods of altering the size of the seeds and organs of plants, for example to improve plant yield.
- DAI growth-restricting factor
- a growth-restricting factor, DAI is a ubiquitin receptor and contains two ubiquitin interaction motifs (UIMs) that bind ubiquitin in vitro, and dal-1 mutant forms large seeds by influencing the maternal integuments of ovules (Li et al., 2008).
- UAMs ubiquitin interaction motifs
- BB E3 ubiquitin ligase BIG BROTHER
- An aspect of the invention provides a method of increasing the yield of a plant or enhancing a yield-related trait in a plant; comprising expressing a DAI protein having an inactivated LIM domain or LIM- like domain within cells of said plant.
- the DAI protein may comprise one or more mutations relative to the wild-type sequence that disrupt or inactivate the LIM domain or LIM-like domain of the DAI protein.
- DAI protein with a disrupted or inactivated LIM domain or LIM-like domain enhances one or more yield related traits and increases the yield of the plant.
- the DAI protein having an inactivated LIM domain or LIM-like domain may be expressed from a heterologous nucleic acid coding sequence in one or more cells of the plant or may be expressed from an
- Another aspect of the invention provides a method of producing a plant with an increased yield and/or one or more enhanced yield- related traits comprising:
- heterologous nucleic acid which encodes a DAI protein having an inactivated LIM domain or LIM- like domain
- Another aspect of the invention provides a plant cell comprising a heterologous nucleic acid encoding a DAI protein having an
- Another aspect of the invention provides a plant comprising one or more plant cells that comprise a heterologous nucleic acid encoding a DAI protein having an inactivated LIM domain or LIM-like domain.
- the plant may display increased yield or an enhanced a yield-related trait relative to controls.
- Figure 1 shows the spacing and identity of the eight zinc binding residues (1-8) in the LIM domain based on an analysis of 135 human LIM sequences. Infrequently observed patterns ( ⁇ 10%) of conserved sequence and topography of the LIM domain.
- Figure 2 shows the topology of Zn coordination of a LIM domain.
- FIG. 3 shows in vitro immunoprecipitation that shows the binding of dallim8 to wild-type DAI.
- E. coli expressed GST-tagged bait proteins were incubated with E. coli expressed FLAG-tagged prey proteins before purification on glutathione sepharose beads and immunoblotting for GST and FLAG.
- FLAG-DAI and FLAG-dallim8 co- purified with GST-DAl and GST-dallim8 (lanes 5,6,8,9) but not with the negative control GST-GUS (lanes 2,3); revealing that mutating the LIM domain in DAI is not sufficient to abolish the physical interaction between DAI proteins.
- Figure 4 shows the effect of the lim8 mutation on seed size in a Col background.
- This invention relates the expression in plants of DAI proteins in which the LIM or LIM-like domain is disrupted or inactivated
- LIM-disrupted DAI proteins (collectively termed LIM-disrupted DAI proteins herein) . This may be useful in altering plant traits which affect yield, such as seed and organ size.
- DAI is a plant ubiquitin receptor that is described in detail in Li et al (2008), Wang, et al (2012) and WO2009/047525.
- DAI proteins are characterised by the presence of a LIM domain, a LIM-like domain, a conserved C terminal domain and one or more UIM domains .
- a LIM domain comprises two Zn finger motifs and may have the amino acid sequence (SEQ ID NO:l);
- the Zn coordinating residues in the LIM domain may be C, H, D or E, preferably C.
- a LIM domain may comprise CXXC, HXXCXXCXXC and HxxC motifs, where X is any amino acid.
- a LIM domain may comprise the amino acid sequence (SEQ ID NO:2)
- a LIM domain nay comprise the amino acid sequence of the AtDAl LIM domain
- LIM domains include the LIM domain of an DAI amino acid sequence shown in Table 1 (dashed box) , for example residues 141 to 193 of SEQ ID NO: 4 (Si_GI-51481526 .pro) , residues 123 to 175 of SEQ ID NO: 5 (Bd_GI-35715718 .pro >, residues 155 to 207 of SEQ ID NO: 6 (Br_DAlb.pro) , residues 172 to 224 of SEQ ID NO: 7
- LIM domain sequences may be identified using standard sequence analysis techniques (e.g. Simple Modular Architecture Research Tool (SMART) ; EMBL Heidelberg, DE) .
- SMART Simple Modular Architecture Research Tool
- EMBL Heidelberg, DE EMBL Heidelberg, DE
- a LIM-like domain comprises two Zn finger motifs and may comprise CXXC, HXXXXXXCXXH and CxxC motifs, where X is any amino acid.
- a LIM-like domain may comprise the amino acid sequence (SEQ ID NO:28) ;
- a LIM-like domain may comprise the amino acid sequence (SEQ ID NO: 29 ) ;
- a LIM-like domain may comprise the amino acid sequence (SEQ ID NO: 30 ) ;
- a LIM-like domain may comprise the amino acid sequence of the AtDAI LIM-like domain
- CDVCSHFIPTNHAGLIEYRAHPFWVQKYCPSHEHDATPRCCSCERMEPRNTRYVELNDGRKLCLEC (SEQ ID NO: 31 )
- LIM-like domains include the LIM domain of an DAI amino acid sequence shown in Table 1 (solid box) , for example residues 200 to 266 of SEQ ID NO: 4 (Si_GI-514815267.pro) , residues 182 to 248 of SEQ ID NO: 5 (Bd_GI-357157184.pro ), residues 214 to 280 of SEQ ID NO: 6 (Br_DAlb.pro) , residues 231 to 297 of SEQ ID NO: 7
- LI -like domain sequences in other DAI proteins may be identified using standard sequence analysis techniques using the above information (e.g. Simple Modular Architecture Research Tool (SMART); EMBL Heidelberg, DE) .
- SMART Simple Modular Architecture Research Tool
- EMBL Heidelberg, DE EMBL Heidelberg, DE
- a DAI protein may further comprise a carboxyl terminal region having an amino acid sequence at least 20%, at least 301, at least 40%, at least 50%, at least 60%, at least 70%, at least 30%, at least 90%, at least 95%, or at least 98% amino acid identity to the sequence of residues 198 to 504 of SEQ ID NO: 4, residues 180 to 487 of SEQ ID NO: 5, residues 212 to 514 of SEQ ID NO: 6, residues 229 to 532 of SEQ ID NO: 7, residues 229 to 532 of SEQ ID NO: 8, residues 174 to 478 of SEQ ID NO: 9, residues 174 to 474 of SEQ ID NO: 10, residues 178 to 478 of SEQ ID NO: 11, residues 176 to 462 of SEQ ID NO: 12, residues 179 to 482 of SEQ ID NO: 13, residues 182 to 486 of SEQ ID NO: 14, residues 573 to 878 of SEQ ID NO: 15, residue
- the carboxyl terminal region may further comprise a EK (X) eR (X) 4 SEEQ (SEQ ID NO: 33) or EK (X) B R (X) 4SEQ (SEQ ID NO: 34) motif positioned between the LIM domain and HEMMH motif.
- a DAI protein may comprise a UIMl domain and a UIM2 domain.
- the UIMl and UIM2 domains may be located between the N terminal and the LIM domain of the DAI protein.
- a UIMl domain may consist of the sequence of SEQ ID NO: 35 and a UIM2 domain may consist of the sequence of SEQ ID NO: 36.
- p pLpbAl pb.Sbp-.pp p (SEQ ID NO: 35)
- p is a polar amino acid residue, for example, C, D, E, H, K, N, Q, R, S or T;
- b is a big amino acid residue, for example, E, F, H, I, K, L, M, Q, R, W or Y;
- s is a small amino acid residue, for example, A, C, D, G, N, P, S, T or V;
- 1 is an aliphatic amino acid residue, for example, I, L or V;
- . is absent or is any amino acid
- UIMl and UIM2 domain sequences may be identified using standard sequence analysis techniques as described herein (e.g. Simple Modular Architecture Research Tool (SMART); EMBL
- a DAI protein may comprise;
- a C terminal region having at least 20% sequence identity to residues 229 to 532 of SEQ ID NO: 8 or the equivalent region of any one of SEQ NOS 4 to 7 or 9 to 27, as set out above and comprising a EK(X) 8 R(X>4SEEQ or EK (X) 8 R (X) 4 SEQ motif and a HEMMH motif, a UIM domain of SEQ ID NO: 35, and
- a DAI protein may comprise an amino acid sequence of a plant DAI protein shown in Table 1 (SEQ ID NOS: 4 to 27) or may be an allele or variant of one of these sequences which has DAI activity.
- a DAI protein may comprise the amino acid sequence of AtDAl, AtDARl, AtDAR2, AtDAR3, AtDAR4, AtDAR5, AtDAR6, AtDAR7, BrDAla, BrDAlb, BrDARl, BrDAR2, BrDAR3-7, BrDALl, BrDAL2, BrDAL3, OsDAl, OSDAR2, OsDAL3, OSDAL5, PpDALl, PpDAL2, PpDAL3, PpDAL4,
- a DAI protein may comprise the amino acid sequence of AtDAl (SEQ ID NO: 8; AT1G19270; NP_173361.1 GI : 15221983) or may be an allele or variant of this sequence which has DAI activity.
- Other DAI protein sequences which include the characteristic features set out above and encoding DAI nucleic acid sequences may be identified using standard sequence analysis tools in any plant species of interest.
- a DAI protein in a plant species of interest may have an amino acid sequence which is a variant of a DAI protein reference amino acid sequence set out herein.
- a DAI protein which is a homologue or variant of a reference plant DAI sequence, such as any one of SEQ ID NOS : 4-27, may comprise an amino acid sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% sequence identity to the
- a DAI polypeptide which is a variant of AtDAl sequence of any one of SEQ NOS: 4 to 27 may comprise a LIM domain having the sequence of SEQ ID NO: 3 and a LIM-like domain having the sequence of SEQ ID NO: 31.
- a nucleic acid encoding a DAI protein may comprise a nucleotide sequence set out in a database entry selected from the group consisting of NM_101785.3 GI:42562:170 (AtDAl); NM_001057237.1 GI: 115454202 (OsDAl) ; BT085014.1 GI : 238008663 (ZmDAl) or may be an allele or variant of one of these sequences which encodes an active DAI protein.
- a nucleic acid encoding a DAI protein may comprise the nucleotide sequence cf AtDAl (NM_101785.3 GI :
- a nucleic acid that encodes a DAI protein in a plant species of interest may have a nucleotide sequence which is a variant of a DAI reference nucleotide sequence set out herein.
- DAI polypeptides and encoding nucleic acids may be identified in plant species, in particular crop plants, such as wheat, barley, maize, rice, and another agricultural plants, using routine sequence analysis techniques.
- variant nucleotide sequence may be a homologue of a reference DAI sequence set out herein, and may differ from the reference DAI nucleotide sequence by one or more of addition, insertion, deletion or substitution of one or more nucleotides in the nucleic acid, for example 2, 3, 4, 5-10, 10-20 20-30, 30-50, or more than 50, leading to the addition, insertion, deletion or substitution of one or more amino acids in the encoded protein.
- changes to the nucleic acid that make no difference to the encoded amino acid sequence are included.
- a nucleic acid encoding a DAI protein may comprise a sequence having at least 20% or at least 30% sequence identity with the reference nucleic acid sequence, preferably at least 40%, at least 50%, at least 60%, at least 65%, at least 70%, at least 80%, at least 90%, at least 95% or at least 98%. Sequence identity is described herein. Sequence identity is commonly defined with reference to the
- GAP Garnier algorithm
- Use of GAP may be preferred but other algorithms may be used, e.g. BLAST (which uses the method of Altschul et al. (1990) J. Mol. Biol. 215: 405- 410), FAS A (which uses the method of Pearson and Lipman (1988) PNAS USA 85: 2444-2448), or the Smith-Waterman algorithm (Smith and Water an (1981) J. Mol Biol.
- a DAI nucleotide sequence which is a variant of a reference DAI nucleic acid sequence set out herein, may selectively hybridise under stringent conditions with this reference nucleic acid sequence or the complement thereof.
- Stringent conditions include, e.g. for hybridization of sequences that are about 80-90% identical, hybridization overnight at 42°C in 0.25M Na 2 HP0 , pH 7.2, 6.5% SDS, 10% dextran sulfate and a final wash at 55°C in 0. IX SSC, 0.1% SDS.
- suitable conditions include hybridization overnight at 65°C in 0.25M Na 2 HP0 4 , pH 7.2, 6.5% SDS, 10% dextran sulfate and a final wash at 60°C in 0.1X SSC, 0.1% SDS.
- An alternative, which may be particularly appropriate with plant nucleic acid preparations, is a solution of 5x SSPE (final 0.9 M NaCl, 0.05M sodium phosphate, 0.005M EDTA pH 7.7), 5X Denhardt' s solution, 0.5% SDS, at 50°C or 65°C overnight. Washes may be performed in 0.2x SSC/0.1% SDS at 65°C or at 50-60°C in lx SSC/0.1% SDS, as required.
- DAI proteins and encoding nucleic acids may be identified in plant species, in particular crop plants, such as wheat, barley, maize, rice, and another agricultural plants, using routine sequence analysis techniques and/or comparison with the reference sequences set out herein.
- LIM domain, the LIM-like domain or both the LIM domain and the LIM-like domain of a DAI protein for use as described herein may be inactivated or disrupted ("LIM disrupted-DAl protein") .
- LIM domains and LIM-like domains are described in detail above and may be identified within any DAI protein using standard sequence analysis techniques.
- a DAI protein with an inactivated or disrupted LIM domain or LIM- like domain may display aberrant, for example increased or activated, peptidase activity.
- inactivation or disruption of the LIM domain or LIM-like domain may reduce or prevent the domain from interacting with the C terminal region of the DAI protein and inhibiting DAI peptidase activity.
- a DAI protein with an inactivated or disrupted LIM domain or LIM-like domain may be display reduced stability in a plant cell following ubiquitinylation compared to wild-type DAI protein.
- a disrupted or inactivated LIM domain or LIM-like domain may be unable to coordinate Zn or form Zn finger motifs, such that the function of the domain is abolished i.e. the disrupted LIM or LIM- like domain is unable to mediate protein : protein interactions.
- a disrupted LIM domain or LIM-like domain may be unable to interact intramolecularly with the C terminal region of the DAI protein to inhibit peptidase activity.
- An inactivated or disrupted LIM domain or LIM-like domain may comprise a sequence alteration or mutation which abolishes one or more Zn finger motifs in the LIM or LIM-like domain.
- the amino acid sequence of a DAI protein may be altered or mutated by insertion, substitution or deletion of one or more amino acids relative to the wild-type amino acid sequence in order to inactivate the LIM domain or LIM-like domain.
- 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 or more amino acids may be altered, for example deleted or substituted, relative to the wild-type amino acid sequence.
- 1 to 30, 1 to 20 or 1 to 10 residues may be altered.
- Single amino acid substitutions within LIM domains and LIM-like domains are sufficient to elicit a LIM knockout phenotype.
- LIM domains for example, may be inactivated by mutations in the Zn coordinating residues or other residues within the LIM domain
- LIM-like domains may also be inactivated by mutations in the Zn coordinating residues (i.e.
- Suitable inactivating or disrupting mutations are preferably within the LIM domain or LIM-like domain or adjacent thereto.
- An inactivated or disrupted LIM domain or LIM-like domain may comprise a mutation of one or more Zn coordinating residues, or putative Zn coordinating residues, for example a cysteine or histidine residue in a CxxC or CXXH context, and/or a mutation of one or more non-Zn coordinating amino acid residues.
- An inactivated or disrupted LIM domain may comprise a mutation at one or more of the first, second, third, fourth, fifth, sixth, seventh and eighth Zn coordinating residues in the LIM domain as shown in SEQ ID NO: 1 or SEQ ID NO: 2 above.
- a mutation at one or more of the first, second, third, fourth, fifth, sixth, seventh and eighth Zn coordinating residues in the LIM domain as shown in SEQ ID NO: 1 or SEQ ID NO: 2 above.
- inactivated or disrupted LIM domain may comprise a mutation at one or more of the cysteine residues in the CXXC motifs or a cysteine or histidine residue in the HXXC motif, for example the
- the LIM domain of said DAI protein may comprise a mutation at one or more of the underlined residues of the DAI LIM domain shown above, preferably C141, C144, H162, C165, C168, C171, H189 and C192 of the DAI sequence of SEQ ID NO: 4, C123, C126, H144, C147, C150, C153, H171 and C174 of the DAI sequence of SEQ ID NO: 5, C155, C158, H176, C179, C182, C185, H203 and C206 of the DAI sequence of SEQ ID NO: 6, C172, C175, H193, C196, C199, C202, H220 and C223 of the DAI sequence of SEQ ID NO: 7, C172, C175, H193, C196, C199, C202, H220 and C223 of the AtDAI sequence
- Zn coordinating residues within the LIM domain of a DAl protein may be identified by standard sequence analysis.
- Cysteine and histidine residues equivalent to C172, C175, H193, C196, C199, C202, H220 and C223 of SEQ ID NO: 8 are sequence residues in the same sequence context in a different DAI protein sequence and may be identified by standard sequence analysis, as shown in Table 1.
- An inactivated or disrupted LIM domain may comprise a mutation at one or more non-Zn coordinating residues in the LIM domain as shown in SEQ ID NO:l or SEQ ID N0:2 above.
- a non-Zn coordinating residue may be located within 4 residues of a Zn coordinating residue in the LIM domain sequence or may be located 4 or more residues away from a Zn coordinating residue.
- An inactivated or disrupted LIM-like domain may comprise a mutation at one or more of the first, second, third, fourth, fifth, sixth, seventh and eighth Zn coordinating residues or putative Zn
- a inactivated or disrupted LIM-like domain may comprise a mutation at one or more of the cysteine residues in the CXXC motifs or a cysteine or histidine residue in the CXXH motif, for example the cysteine/histidine residues shown in positions 1, 4, 29, 32, 40, 43, 63 or 66 of SEQ ID NO: 31 and underlined in SEQ ID NOS 28 to 31 above.
- Two of the three putative Zn coordinating residues H252, C260, H263 in the LIM- like domain are responisible for Zn coordination (i.e.
- the LIM-like domain of said DAI protein may comprise a mutation at one or more of the underlined residues of the AtDAI LIM-like domain shown above, preferably C232, C235, H252, C260, H263, C271, C274, C294 and/or C297 of the AtDAI sequence of SEQ ID NO: 8, or the equivalent cysteine residues in other DAI protein sequences.
- the LIM disrupted DAI protein may have a C to Y, C to G or other substitution at one or more of these positions.
- Cysteine residues equivalent to C232, C235, H252, C260, H263, C271, C274, C294 and C297 of SEQ ID NO: 8 are sequence residues in the same sequence context in a different DAI protein sequence and may be identified by standard sequence analysis, as shown in Table 1.
- An inactivated or disrupted LIM-like domain may comprise a mutation at one or more residues in the LIM-like domain other than conserved cysteine or histidine residues as shown in SEQ ID NO: 28 to SEQ ID NO: 31 above. Suitable residues may be located within 4 residues of a conserved cysteine or histidine residue in the LIM-like domain sequence or may be located 4 or more residues away from a conserved cysteine or histidine residue.
- Some preferred mutations include the conversion of a Zn coordinating residue in a LIM or LIM-like domain, such as cysteine or histidine, to a neutral amino acid, such as glycine.
- LIM domain and LIM-like domain mutations destabilise the DAl protein in the presence of its interacting partner EODl in the plant cell. Suitable LIM domain and LIM-like domain mutations may therefore be identified by determining the stability the mutant DAl protein in the presence of EODl using standard experimental techniques. Reduce stability relative to the wild-type DAl is indicative that a mutation disrupts the LIM or LIM- like domain.
- a LIM-disrupted DAl protein as described herein may comprise a conserved R residue located at a position in the DAl amino acid sequence which is equivalent to position 358 of SEQ ID NO: 8 of A. thaliana DAl, position 333 of SEQ ID NO: 8 of the Z. mays DAl or the equivalent position in another DAl amino acid sequence, for example a DAl sequence of Table 1 (conserved R residue shown by arrow) .
- DAl of SEQ ID NO: 20 is located at the position within the DAl amino acid sequence which corresponds to R333 of SEQ ID NO: 20 and R358 of SEQ ID NO: 8 i.e. it is in the same position relative to to the other motifs and domains of the DAl protein.
- the conserved R residue is located between the LIM domain and the HEM H (SEQ ID NO: 32) peptidase motif of the C terminal region and is completely conserved in the same sequence context in DAI proteins.
- the conserved R residue may be contained in a EK(X) 8 R(X) 4SEEQ (SEQ ID NO: 33) or EK (X) gR (X) ,SEQ (SEQ ID NO: 34) motif within the C terminal region.
- the data herein shows that the LIM domain and the LIM-like domain do not mediate DAI homodimersation and a LIM disrupted-DAl protein retains the ability to bind to wild-type DAI.
- a LIM-disrupted DAI protein in one or more cells of a plant reduces DAI activity in the cells and enhances yield-related plant traits, such as seed or organ size (see for example Li et al (2008); WO2009/047525; Wang et al 2012) thereby increasing plant yield.
- a plant expressing a LIM-disrupted DAI protein may have a dal-1 or a dal-1 like phenotype.
- a LIM-disrupted DAI protein may be expressed from heterologous nucleic acid in the one or more plant cells.
- the LIM-disrupted DAI protein may be expressed in one or more cells of a plant by any convenient technique and suitable techniques are well-known in the art. Nucleic acid encoding the LIM-disrupted DAI protein may be
- Nucleic acids provided may be double- or single-stranded, cDNA or genomic DNA, or RNA.
- the nucleic acid may be wholly or partially synthetic, depending on design.
- the skilled person will understand that where the nucleic acid includes RNA, reference to the sequence shown should be construed as reference to the RNA equivalent, with U substituted for T.
- Heterologous indicates that the gene/sequence of nucleotides in question or a sequence regulating the gene/sequence in question, has been introduced into said cells of the plant or an ancestor thereof, using genetic engineering or recombinant means, i.e. by human intervention.
- Nucleotide sequences which are heterologous to a plant cell may be non-naturally occurring in cells of that type, variety or species (i.e. exogenous or foreign) or may be sequences which are non-naturally occurring in that sub-cellular or genomic environment of the cells or may be sequences which are non-naturally regulated in the cells i.e. operably linked to a non-natural regulatory element .
- Nucleic acid encoding the LIM-disrupted DAI protein may be operably linked to a heterologous regulatory sequence, such as a promoter, for example a constitutive, inducible, tissue-specific or
- the nucleic acid encoding the LIM-disrupted DAI protein may be contained on a nucleic acid construct or vector.
- the construct or vector is preferably suitable for transformation into and/or expression within a plant cell.
- a vector is, inter alia, any plasmid, cosmid, phage or Agrobactarium binary vector in double or single stranded linear or circular form, which may or may not be self-transmissible or mobilizable, and which can transform
- prokaryotic or eukaryotic host in particular a plant host, either by integration into the cellular genome or exist extrachromasomally (e.g. autonomous replicating plasmid with an origin of replication).
- shuttle vectors by which is meant a DNA vehicle capable, naturally or by design, of replication in two different organisms, which may be selected from Actinomyces and related species, bacteria and eukaryotic (e.g. higher plant, mammalia, yeast or fungal) cells.
- a construct or vector comprising nucleic acid as described above need not include a promoter or other regulatory sequence, particularly if the vector is to be used to introduce the nucleic acid into cells for recombination into the genome.
- Constructs and vectors may further comprise selectable genetic markers consisting of genes that confer selectable phenotypes such as resistance to antibiotics such as kanamycin, hygromycin,
- Suitable vectors can be chosen or constructed, containing appropriate regulatory sequences, including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- appropriate regulatory sequences including promoter sequences, terminator fragments, polyadenylation sequences, enhancer sequences, marker genes and other sequences as appropriate.
- nucleic acid to be inserted should be assembled within a construct that contains effective regulatory elements that will drive transcription. There must be available a method of transporting the construct into the cell. Once the construct is within the cell membrane, integration into the
- the target cell type is preferably such that cells can be regenerated into whole plants. It is desirable to use a construct and transformation method which enhances expression of the nucleic acid encoding the LIM or LIM-like disrupted DAI protein. Integration of a single copy of the gene into the genome of the plant cell may be beneficial to minimize gene silencing effects. Likewise, control of the complexity of
- Agrobacterium transformation is one method widely used by those skilled in the art to transform plant species. Production of stable, fertile transgenic plants is now routine in the art (see for example Toriyama, et al . (1988) Bio/Technology 6, 1072-1074; Zhang, et al. (1988) Plant Cell Rep. 7, 379-384; Zhang, et al. (1988) 53 ⁇ 4eor Appl Genet 76, 835-840; Shimamoto, et al. (1989) Nature 338, 274-276; Datta, et al . (1990) Bio/Technology 8, 736-740; Christou, et al. (1991) Bio/Technology 9, 957-962; Peng, et al.
- PNAS U.S.A. 87: 1228 (1990d) may be preferred where Agrobacterium transformation is inefficient or ineffective, for example in some gymnosperm species. Physical methods for the transformation of plant cells are reviewed in Oard, 1991, Biotech. Adv. 9: 1-11.
- a plant nay be regenerated, e.g. from single cells, callus tissue or leaf discs, as is standard in the art. Almost any plant can be entirely regenerated from cells, tissues and organs of the plant. Available techniques are reviewed in Vasil et al., Cell Culture and Somatic Cell Genetics of Plants, Vol I, II and III, Laboratory Procedures and Their Applications, Academic Press, 1984, and Weissbach and Weissbach, Methods for Plant Molecular Biology, Academic Press, 1989.
- a transformation technology will be determined by its efficiency to transform certain plant species as well as the experience and preference of the person practising the invention with a particular methodology of choice. It will be apparent to the skilled person that the particular choice of a transformation system to introduce nucleic acid into plant cells is not essential to or a limitation of the invention, nor is the choice of technique for plant regeneration.
- a plant cell that expresses the LIM- disrupted DAI protein may be identified and/or selected.
- a plant may be regenerated from the plant cell.
- a mutation may be introduced into a nucleic acid sequence within the genome of a plant cell which encodes a DAI protein, such that the nucleic acid encodes a LIM-disrupted DAI protein.
- a mutation nay be introduce into the sequence encoding the LIM domain or LIM-like domain of the DAI protein.
- a plant may then be regenerated from the mutated cell.
- the nucleic acid encoding the DAI protein may be mutated by insertion, substitution or deletion of one or more nucleotides relative to the wild-type nucleotide sequence. For example, 1,2, 3, 4,5,6, 7, 8, 9 or 10 or more nucleotides may be altered relative to the wild-type nucleotide sequence in order to inactivated the encoded LIM or LIM-like domain.
- the mutations inactivate or knock out the LIM domain and/or the LIM-like domain and are preferably in the region of the nucleic acid sequence encoding the LIM domain or the LIM-like domain. Prefered mutations do not cause frameshifts.
- mutations may be introduced into a target DAI coding sequence by genome editing techniques, for example RNA guided nuclease
- a plant that expresses a LIM-disrupted DAI protein as described above may be sexually or asexually propagated or grown to produce off-spring or descendants.
- Off-spring or descendants of the plant regenerated from the one or more cells may be sexually or asexually propagated or grown.
- the plant or its offspring or descendents may be crossed with other plants or with itself.
- the plant or its off-spring or descendents may be tested for seed size, organ size and/or plant yield relative to controls.
- a plant which expresses a LIM-disrupted DAI protein as described herein may display increased seed and/or organ size relative to the controls and may have higher plant yields.
- a LIM-disrupted DAI protein may be expressed as described above in a plant that is deficient in EODl expression or activity.
- EODl proteins are plant E3 ubiquitin ligases (Disch et al. (2006), Li et al (2008), WO2009/047525) .
- EODl proteins comprise an EOD domain.
- a plant EOD domain may consist of the amino acid sequence of SEQ ID NO: 37; (E/K) RCVICQ (L/M) (K/R/G/T/E) Y (K/R) (R/I) (G/K) (D/N/E) (R/Q/K/L) Q (I/M/V) (K
- an EODl protein may comprise a EOD domain having an amino acid sequence of residues 150 to 192 of SEQ
- EOD domain sequences may be identified using standard sequence analysis techniques as described herein (e.g.,
- a EODl protein whose expression or activity is reduced in the plant cell expressing the LIM disrupted DAI protein may comprise an amino acid sequence of any one of SEQ ID NOS 38 to 53 as set out in Table 2.
- a EODl protein may comprise the amino acid sequence of SEQ ID NO: 45 (AtEODl) or SEQ ID NOS: 50 or 51 (OsEODl) or may be a variant of this sequence which retains E3 ubiquitin ligase activity.
- a EODl protein which is a variant of any one of SEQ ID NOS: 38 to 53 or other reference EODl sequence may comprise an amino acid sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 98% sequence identity to the reference EODl sequence.
- a EOD protein which is a variant of any one of SEQ ID NOS: 38 to 53 may further comprise a EOD domain having the sequence of SEQ ID NO: 37. Examples of suitable sequences are set out above.
- a nucleic acid encoding a EODl protein may comprise a nucleotide sequence set out in a database entry selected from the group consisting of XM_002299911.1 GI:224059639 (PtEODl) ; XM_002531864.1 GI:255582235 (RcEODl) ; XM_002279758.2 GI:359487285 (VvEODl) ;
- a nucleotide sequence encoding a EODl protein in a plant may encode AtEODl or OsEODl or may be a variant thereof .
- EODl proteins and encoding nucleic acids whose expression or activity may be reduced as described herein may be readily
- a crop plant such as wheat, barley, maize, rice, and another agricultural plants, using routine sequence analysis techniques.
- the activity of EODl may be reduced, preferably abolished, by introducing a mutation, such as a deletion, insertion or substitution, at a position corresponding to position 44 of SEQ ID NO: 45, for example, an A to T substitution.
- a mutation such as a deletion, insertion or substitution
- a position in a EODl protein sequence which is equivalent to position 44 of SEQ ID NO: 45 may be identified using standard sequence analysis and alignment tools.
- the expression of a EODl protein may be reduced in a plant cell by expressing a heterologous nucleic acid which encodes or transcribes a suppressor nucleic acid, for example a suppressor RNA or RNAi molecule, within cells of said plant.
- a suppressor nucleic acid for example a suppressor RNA or RNAi molecule
- the suppressor RNA suppresses the expression of EODl protein in the plant cells that express LIM-disrupted DAI.
- RNAi sequence may correspond to a fragment of a reference EODl nucleotide sequence set out herein or may be a variant thereof.
- a knock out or knock down mutation may be introduced into a nucleic acid sequence within the genome of a plant cell which encodes an EODl protein, such that expression or activity of EODl is reduced.
- a plant may then be regenerated from the mutated cell.
- the nucleic acid encoding EOD1 may be mutated by insertion, substitution or deletion of one or more nucleotides relative to the wild-type nucleotide sequence. For example, 1, 2, 3, 4, 5 , 6, 7, 8, 9 or 10 or more nucleotides may be altered relative to the wild-type nucleotide sequence.
- LI -disrupted DAI proteins may be expressed as described herein in any plant species.
- suitable plants for use in accordance with any aspect of the invention described herein include
- monocotyledonous and dicotelydonous higher plants for example agricultural or crop plants, such as plants selected from the group consisting of Lithospermum erythrorhizon, Taxus spp, tobacco, cucurbits, carrot, vegetable brassica, melons, capsicums, grape vines, lettuce, strawberry, oilseed brassica, sugar beet, wheat, barley, maize, rice, soyabeans, peas, sorghum, sunflower, tomato, potato, pepper, chrysanthemum, carnation, linseed, hemp and rye.
- agricultural or crop plants such as plants selected from the group consisting of Lithospermum erythrorhizon, Taxus spp, tobacco, cucurbits, carrot, vegetable brassica, melons, capsicums, grape vines, lettuce, strawberry, oilseed brassica, sugar beet, wheat, barley, maize, rice, soyabeans, peas, sorghum, sunflower, tomato, potato, pepper,
- Another aspect of the invention provides a transgenic plant which expresses a LIM-disrupted DAI protein, as described above.
- the plant may comprise an exogenous nucleic acid which encodes the LIM-disrupted DAI protein.
- One or more yield-related traits in the plant may be improved, increased or enhanced in the plant relative to control plants which do not express LIM-disrupted DAI protein.
- Yield-related traits may include life-span, organ size and seed size.
- the plant may have increased yield relative to control wild-type plants (i.e. identical plants which do not express a LIM-disrupted DAI protein) .
- the mass of seeds (e.g. grain) or other plant product per unit area may be increased relative to control plants .
- a suitable plant may be produced by a method described above.
- the invention encompasses any clone of such a plant, seed, selfed or hybrid progeny and descendants, and any part or propagule of any of these, such as cuttings and seed, which may be used in reproduction or propagation, sexual or asexual.
- a plant according to the present invention may be one which does not breed true in one or more properties.
- Plant varieties may be excluded, particularly registrable plant varieties according to Plant Breeders Rights.
- "and/or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other.
- “A and/or B” is to be taken as specific disclosure of each of (i) A, (ii) 3 and (iii) A and B, just as if each is set out individually herein.
- a flask of 10ml LB with appropriate antibiotics was inoculated with a BL21 glycerol stock of the appropriate expression construct and left to grow overnight at 37 °C and 220rpm.
- the flask was removed from the incubator, IPTG (Melford MB1008) was added to a final concentration of lmM before the culture was incubated at 28 °C (and 220rpm) for another three hours.
- the cultures were centrifuged at 4500xg for 10 minutes, the supernatants were discarded and the pellets resuspended at 4°C in 2.5ml TGH Buffer (50mM HEPES (pH7.5), 150mM NaCl, 1% Triton-X-100, 10% Glycerol, lmM DTT, 1 complete EDTA-free protease inhibitor tablet (per 50ml) (Roche 11873580001) ) .
- the bacterial suspension was then sonicated (on ice) for four bursts of ten seconds, separated by 20-second intervals, before being centrifuged at 12 OOOx g for 20minutes to pellet any cellular debris.
- the membrane was washed for 10 minutes in 50ml PBS (140mM NaCl, 2.7mM KC1, lOmM Na 2 HPO,, 1.8mM KH2PO4, pH 7.3) at room temperature, before being agitated in 50ml blocking solution (5% (w/v) milk powder, 0.1% (v/v) Tween-20) for either one hour at room temperature or overnight at 4°C.
- PBS 140mM NaCl, 2.7mM KC1, lOmM Na 2 HPO,, 1.8mM KH2PO4, pH 7.3
- Membranes were left in this substrate for five minutes, dried as before and placed in an X-ray cassette under a piece of X-ray film (Fuji Film X-RAY 18x24cm - (FujiFilm 497772RXNO) ) .
- X-ray films were developed using a Konica SRX-101 Table Top X-ray film developer (Konica 106931659) .
- membranes were washed in 50ml PBST and stained with 10ml Ponceau S solution (Sigma-Aldrich P7170) for 30 minutes, followed by a single wash in 50ml PBST and drying at room temperature.
- Ponceau S solution Sigma-Aldrich P7170
- Seed area was used as a proxy measurement of seed size. Seeds were scattered in a petri dish and scanned against a white background using a desktop scanner (Hewlett Packard Scanjet 4370) at a high resolution ( ⁇ 3600dpi) . Images were stored as black and white 8-bit images, and subjected to image analysis using the ImageJ software. ImageJ was opened and the threshold (Ctrl+Shift+T) set such that all seeds are completely red, then select all seeds with the
- LIM domains (Prosite: PS00478) are a tandem zinc finger domains that act as a platform for protein:protein interactions (fig 1) .
- Recombinant GST-tagged bait proteins were incubated with recombinant FLAG-tagged prey proteins before precipitation of GST-tagged bait proteins on glutathione sepharose beads.
- the purified proteins were then eluted and subjected to SDS-PAGE and immunoblot analysis.
- the ability of ⁇ -glucuronidase (GUS) tc form a homo-tetramer was utilised to design a positive control of GST-GUS vs FLAG-GUS.
- Two sets of negative controls were alsc used; these were GST-GUS vs FLAG-prey, and GST-bait vs FLAG-GUS.
- Dallim8 is able to bind to wild-type DAI protein ( Figure 3) and that the lim8 seed size phenotype in a Col background is equivalent to that of dal-1 ( Figure 4) .
- DAI proteins were further analysed using a two-step domain prediction analysis.
- an initial homology detection screen (HHpred) was carried out to identify proteins with similar domains and structures. This was then followed by a domain
- the LIM-like domain therefore represents a second Zn finger containing LIM domain within the DAI protein.
- At_GI-22326876 pro SIKQNQPLTDGARVLVVVISDSVEFYDP FPKFLKVIQG QNNGHVVVPVFYGVDSLTRV 120
- At_GI-22326876 pro YG ANS LEAEKLTSHQSKIL3NNVLTDSELVEEIVRDVYGKLYPAERVGIYARLLEIEK 180
- At_GI-22326876 pro LLYKQHRDIRSIGIWGMPGIGKTTLRAVFNH STDYDASCFIENFDEAFHKEGLHRLLK 240
- At_GI-22326876 pro ERIGKILKDEFDIESSYIMRPTLHRDKLYDKRILWLDDVRDSLAAESFL RLDWFGSGS 300
- At_GI-22326876 pro MTDLVPWMQKPISGFSMSVVVSFQDDYHNDVGLRIRCVGTWKTWNNQPDRIVERFFQCWA 960
- At_GI-22326876 pro GVEVITAATGDTSVSGIIRESETITIIEKEDTHDEEDTPLLSRKPEETNRSRSSSELQK 1080
- At_GI-22326876 pro EQRKHSKDHEEEEIESNEKEERRHSKDYVIEELVLKGKGKRKQLDDDKADEKEQ 1221
- Vv_GI-359492104 pro GCNTEIGHGRFLSCMGAVWHPECFRCHGCGYPISDYEYS NG- 179
- At_GI-22326876 pro DCKSAIEDGISINAYGSVWHPQCFCCLRCREPIAMNEISDLR- —G YHKPCYKELR-H 1296
- Vv_GI-359492104 pro GHHHMP ETRGLCLSEEQTVSTILRRPKI-GTGNRVMNMITEPCKLTRRCDVTAVLIL 355
- At_GI-334188680 pro DNQH GWTRGICLSEGQIVNSVFKKPTM-GPNGELVSLGTEPQKVVGGCEVTAILIL 427
- Vv_GI-359492104 pro YGLPRLLTGSILAHEMMHAWLRLN GYRTLAQDV 388
- pro MNGS RQMELHYINTGFPYTITESFMDFFEGLTYAHA 36
- Gm_GI-3565 8935 pro NYAFAGSIPD QESVYWSMN-MNPYKFGLSGPGSTSYYSS YEVNGHLPRMEIDRA 89
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Botany (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Environmental Sciences (AREA)
- Developmental Biology & Embryology (AREA)
- Physiology (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Peptides Or Proteins (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
Description
Claims
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201480061807.4A CN105814075B (en) | 2013-11-11 | 2014-11-05 | Method for modulating seed and organ size in plants |
| EP14802104.1A EP3068794B1 (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
| EP23188752.2A EP4269600A3 (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
| EA201690831A EA036049B1 (en) | 2013-11-11 | 2014-11-05 | METHODS FOR MODULATING THE SIZE OF SEEDS AND ORGANS IN PLANTS |
| MX2016006051A MX367015B (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants. |
| CA2929569A CA2929569C (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
| MX2019009031A MX390791B (en) | 2013-11-11 | 2014-11-05 | METHODS OF MODULATION OF SEED AND ORGAN SIZE IN PLANTS. |
| US15/035,657 US10337021B2 (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
| AU2014345338A AU2014345338B2 (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
| BR112016010690A BR112016010690A2 (en) | 2013-11-11 | 2014-11-05 | methods for modulating seed and organ size in plants |
| UAA201605610A UA122119C2 (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
| CL2016001122A CL2016001122A1 (en) | 2013-11-11 | 2016-05-11 | Methods of modulating the size of seeds and plant organs |
| US16/405,740 US11118188B2 (en) | 2013-11-11 | 2019-05-07 | Methods of modulating seed and organ size in plants |
| US17/305,967 US12247210B2 (en) | 2013-11-11 | 2021-07-19 | Methods of modulating seed and organ size in plants |
| US19/038,251 US20250270577A1 (en) | 2013-11-11 | 2025-01-27 | Methods of modulating seed and organ size in plants |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GBGB1319876.7A GB201319876D0 (en) | 2013-11-11 | 2013-11-11 | Methods of modulating seed and organ size in plants |
| GB1319876.7 | 2013-11-11 |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/035,657 A-371-Of-International US10337021B2 (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
| US201615035657A Continuation | 2013-11-11 | 2016-05-10 | |
| US16/405,740 Continuation US11118188B2 (en) | 2013-11-11 | 2019-05-07 | Methods of modulating seed and organ size in plants |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2015067943A1 true WO2015067943A1 (en) | 2015-05-14 |
Family
ID=49818439
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/GB2014/053296 Ceased WO2015067943A1 (en) | 2013-11-11 | 2014-11-05 | Methods of modulating seed and organ size in plants |
Country Status (11)
| Country | Link |
|---|---|
| US (4) | US10337021B2 (en) |
| EP (2) | EP3068794B1 (en) |
| CN (2) | CN111378683A (en) |
| AU (1) | AU2014345338B2 (en) |
| BR (1) | BR112016010690A2 (en) |
| CL (1) | CL2016001122A1 (en) |
| EA (2) | EA036049B1 (en) |
| GB (1) | GB201319876D0 (en) |
| MX (2) | MX390791B (en) |
| UA (1) | UA122119C2 (en) |
| WO (1) | WO2015067943A1 (en) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017178318A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| WO2017178368A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and embryo-preferential promoters and uses thereof |
| WO2017178322A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| WO2017178367A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed- and funiculus-preferential promoters and uses thereof |
| WO2023034731A1 (en) * | 2021-08-30 | 2023-03-09 | Pairwise Plants Services, Inc. | Modification of ubiquitin binding peptidase genes in plants for yield trait improvement |
| WO2023052561A1 (en) | 2021-10-01 | 2023-04-06 | Basf Se | Plants with improved properties |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116535476B (en) * | 2023-04-17 | 2025-01-28 | 西南大学 | Tumorous stem mustard BjuDA1R356K gene and its encoded protein and application |
Citations (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0175966A1 (en) | 1984-09-25 | 1986-04-02 | Calgene, Inc. | Plant cell microinjection technique |
| US4684611A (en) | 1982-02-11 | 1987-08-04 | Rijksuniversiteit Leiden | Process for the in-vitro transformation of plant protoplasts with plasmid DNA |
| WO1987006614A1 (en) | 1986-04-30 | 1987-11-05 | Boyce Thompson Institute For Plant Research, Inc. | Electric field mediated dna transformation of plant cells and organelles |
| EP0290395A2 (en) | 1987-05-05 | 1988-11-09 | Sandoz Ag | Plant tissue transformation |
| EP0331083A2 (en) | 1988-03-02 | 1989-09-06 | Schweizerische Eidgenossenschaft Eidgenössische Technische Hochschule (Eth) | Method for the production of transgenic plants |
| WO1990012096A1 (en) | 1989-04-03 | 1990-10-18 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| EP0434616A1 (en) | 1989-12-19 | 1991-06-26 | Ciba-Geigy Ag | Method and appliance for the genetic transformation of cells |
| DE4005152A1 (en) | 1990-02-17 | 1991-08-22 | Guenter Prof Dr Kahl | Transforming plant protoplast(s) with DNA-histone complex - providing high and reproducible transfer rate, and expression of foreign genes |
| EP0444882A2 (en) | 1990-02-26 | 1991-09-04 | Agracetus, Inc. | Plant transformation process with early identificaton of germ line transformation events |
| US5100792A (en) | 1984-11-13 | 1992-03-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues |
| EP0486234A2 (en) | 1990-11-14 | 1992-05-20 | Pioneer Hi-Bred International, Inc. | Plant transformation method using agrobacterium species |
| EP0486233A2 (en) | 1990-11-14 | 1992-05-20 | Pioneer Hi-Bred International, Inc. | Plant transformation method using agrobacterium species |
| WO1992009696A1 (en) | 1990-11-23 | 1992-06-11 | Plant Genetic Systems, N.V. | Process for transforming monocotyledonous plants |
| WO1992014828A1 (en) | 1991-02-14 | 1992-09-03 | Svalöf Ab | Method for genetic transformation of tissue organs from monocotyledonous plants |
| WO1994000583A1 (en) | 1992-06-23 | 1994-01-06 | South Dakota State University | Transformation of plants by direct injection of dna |
| EP1407000B1 (en) | 1999-07-19 | 2005-11-30 | Plant Bioscience Limited | Transformation method and transgenic plants produced thereby |
| US20090094717A1 (en) * | 2007-10-03 | 2009-04-09 | Ceres, Inc. | Nucleotide sequences and corresponding polypeptides conferring modulated plant characteristics |
| WO2009047525A1 (en) | 2007-10-11 | 2009-04-16 | Plant Bioscience Limited | Methods of controlling plant seed and organ size |
Family Cites Families (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20040031072A1 (en) * | 1999-05-06 | 2004-02-12 | La Rosa Thomas J. | Soy nucleic acid molecules and other molecules associated with transcription plants and uses thereof for plant improvement |
| WO2002083911A1 (en) * | 2001-04-12 | 2002-10-24 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Production of plants with increased tolerance to drought stress or with increased transpiration |
| JP2005185101A (en) * | 2002-05-30 | 2005-07-14 | National Institute Of Agrobiological Sciences | Plant full-length cDNA and use thereof |
| US20120225090A1 (en) * | 2009-08-03 | 2012-09-06 | The Johns Hopkins University | Methods for enhancing antigen-specific immune responses |
| AU2014308078B2 (en) * | 2013-08-14 | 2018-04-05 | Institute Of Genetics And Developmental Biology | Methods of modulating seed and organ size in plants |
-
2013
- 2013-11-11 GB GBGB1319876.7A patent/GB201319876D0/en not_active Ceased
-
2014
- 2014-11-05 CN CN202010021870.2A patent/CN111378683A/en active Pending
- 2014-11-05 BR BR112016010690A patent/BR112016010690A2/en not_active Application Discontinuation
- 2014-11-05 EA EA201690831A patent/EA036049B1/en unknown
- 2014-11-05 CN CN201480061807.4A patent/CN105814075B/en active Active
- 2014-11-05 MX MX2019009031A patent/MX390791B/en unknown
- 2014-11-05 EA EA202090273A patent/EA202090273A3/en unknown
- 2014-11-05 WO PCT/GB2014/053296 patent/WO2015067943A1/en not_active Ceased
- 2014-11-05 MX MX2016006051A patent/MX367015B/en active IP Right Grant
- 2014-11-05 EP EP14802104.1A patent/EP3068794B1/en active Active
- 2014-11-05 EP EP23188752.2A patent/EP4269600A3/en active Pending
- 2014-11-05 UA UAA201605610A patent/UA122119C2/en unknown
- 2014-11-05 US US15/035,657 patent/US10337021B2/en active Active
- 2014-11-05 AU AU2014345338A patent/AU2014345338B2/en active Active
-
2016
- 2016-05-11 CL CL2016001122A patent/CL2016001122A1/en unknown
-
2019
- 2019-05-07 US US16/405,740 patent/US11118188B2/en active Active
-
2021
- 2021-07-19 US US17/305,967 patent/US12247210B2/en active Active
-
2025
- 2025-01-27 US US19/038,251 patent/US20250270577A1/en active Pending
Patent Citations (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4684611A (en) | 1982-02-11 | 1987-08-04 | Rijksuniversiteit Leiden | Process for the in-vitro transformation of plant protoplasts with plasmid DNA |
| EP0175966A1 (en) | 1984-09-25 | 1986-04-02 | Calgene, Inc. | Plant cell microinjection technique |
| US5100792A (en) | 1984-11-13 | 1992-03-31 | Cornell Research Foundation, Inc. | Method for transporting substances into living cells and tissues |
| WO1987006614A1 (en) | 1986-04-30 | 1987-11-05 | Boyce Thompson Institute For Plant Research, Inc. | Electric field mediated dna transformation of plant cells and organelles |
| EP0290395A2 (en) | 1987-05-05 | 1988-11-09 | Sandoz Ag | Plant tissue transformation |
| EP0331083A2 (en) | 1988-03-02 | 1989-09-06 | Schweizerische Eidgenossenschaft Eidgenössische Technische Hochschule (Eth) | Method for the production of transgenic plants |
| WO1990012096A1 (en) | 1989-04-03 | 1990-10-18 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| EP0434616A1 (en) | 1989-12-19 | 1991-06-26 | Ciba-Geigy Ag | Method and appliance for the genetic transformation of cells |
| DE4005152A1 (en) | 1990-02-17 | 1991-08-22 | Guenter Prof Dr Kahl | Transforming plant protoplast(s) with DNA-histone complex - providing high and reproducible transfer rate, and expression of foreign genes |
| EP0444882A2 (en) | 1990-02-26 | 1991-09-04 | Agracetus, Inc. | Plant transformation process with early identificaton of germ line transformation events |
| EP0486234A2 (en) | 1990-11-14 | 1992-05-20 | Pioneer Hi-Bred International, Inc. | Plant transformation method using agrobacterium species |
| EP0486233A2 (en) | 1990-11-14 | 1992-05-20 | Pioneer Hi-Bred International, Inc. | Plant transformation method using agrobacterium species |
| WO1992009696A1 (en) | 1990-11-23 | 1992-06-11 | Plant Genetic Systems, N.V. | Process for transforming monocotyledonous plants |
| WO1992014828A1 (en) | 1991-02-14 | 1992-09-03 | Svalöf Ab | Method for genetic transformation of tissue organs from monocotyledonous plants |
| WO1994000583A1 (en) | 1992-06-23 | 1994-01-06 | South Dakota State University | Transformation of plants by direct injection of dna |
| EP1407000B1 (en) | 1999-07-19 | 2005-11-30 | Plant Bioscience Limited | Transformation method and transgenic plants produced thereby |
| US20090094717A1 (en) * | 2007-10-03 | 2009-04-09 | Ceres, Inc. | Nucleotide sequences and corresponding polypeptides conferring modulated plant characteristics |
| WO2009047525A1 (en) | 2007-10-11 | 2009-04-16 | Plant Bioscience Limited | Methods of controlling plant seed and organ size |
Non-Patent Citations (71)
| Title |
|---|
| "Current Protocols in Molecular Biology", 2013, WILEY |
| "In Vitro Mutagenesis Protocols; Methods in Molecular Biology" |
| "Protocols in Molecular Biology", 1992, JOHN WILEY & SONS |
| AGULNICK ET AL., NATURE, vol. 384, 1996, pages 270 - 2 |
| ALONSO-BLANCO, C., PNAS USA, vol. 96, 1999, pages 4710 - 7 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 405 - 410 |
| BEVAN, NUCL. ACIDS RES., vol. 12, 1984, pages 8711 - 8721 |
| CAO ET AL., PLANT CELL REP., vol. 11, 1992, pages 585 - 591 |
| CHRISTOU ET AL., BIO/TECHNOLOGY, vol. 9, 1991, pages 957 - 962 |
| CHRUFF, M.C., DEVELOPMENT, vol. 137, 2006, pages 251 - 261 |
| CLOUGH ET AL., HUMAN MUTATION, vol. 14, 1999, pages 459 - 465 |
| CONG, L. ET AL., SCIENCE, vol. 339, 2013, pages 819 - 823 |
| DATTA ET AL., BIO/TECHNOLOGY, vol. 8, 1990, pages 736 - 740 |
| D'HALLUIN ET AL., PLANT CELL, vol. 4, 1992, pages 1495 - 1505 |
| DINNENY, J.R., DEVELOPMENT, vol. 131, 2004, pages 1101 - 10 |
| DISCH, S., CURR BIOL, vol. 16, 2006, pages 272 - 9 |
| FAN, C., THEOR. APPL. GENET., vol. 112, 2006, pages 1164 - 1171 |
| FREEMAN ET AL., PLANT CELL PHYSIOL., vol. 29, 1984, pages 1353 |
| FROMM ET AL., BIO/TECHNOLOGY, vol. 8, 1990, pages 833 - 839 |
| GARCIA, D., PLANT CELL, vol. 17, 2005, pages 52 - 60 |
| GASIUNAS, G. ET AL., PNAS USA, vol. 109, 2012, pages E2579 - 2586 |
| GORDON-KAMM ET AL., PLANT CELL, vol. 2, 1990, pages 603 - 618 |
| GREEN ET AL.: "Plant Tissue and Cell Culture", 1987, ACADEMIC PRESS |
| GUERINEAU; MULLINEAUX: "Plant Molecular Biology Labfax", 1993, BIOS SCIENTIFIC PUBLISHERS, article "Plant transformation and expression vectors", pages: 121 - 148 |
| HAMLINGTON ET AL., HUMAN MUTATION, vol. 18, 2001, pages 458 - 464 |
| HORIGUCHI, G., PLANT J, vol. 43, 2005, pages 68 - 78 |
| HORVATH, B.M., EMBO J, vol. 25, 2006, pages 4909 - 20 |
| HU, Y, PLANT J, vol. 47, 2006, pages 1 - 9 |
| HU, Y., PLANT CELL, vol. 15, 2003, pages 1951 - 61 |
| JOFUKU, K.D., PNAS USA, vol. 102, 2005, pages 3117 - 3122 |
| JOUNG, J.K. ET AL., NATURE REVIEWS. MOLECULAR CELL BIOLOGY, vol. 14, 2013, pages 49 - 55 |
| KINDLE, PNAS U.S.A., vol. 87, 1990, pages 1228 |
| KOZIEL ET AL., BIOTECHNOLOGY, vol. 11, 1993, pages 194 - 200 |
| KRIZEK, B.A., DEV GENET, vol. 25, 1999, pages 224 - 36 |
| LI ET AL., PLANT CELL REP., vol. 12, 1993, pages 250 - 255 |
| LI YUNHAI ET AL: "Control of final seed and organ size by the DA1 gene family in Arabidopsis thaliana", GENES AND DEVELOPMENT, COLD SPRING HARBOR LABORATORY PRESS, PLAINVIEW, NY, US, vol. 22, no. 10, 1 May 2008 (2008-05-01), pages 1331 - 1336, XP002512707, ISSN: 0890-9369, DOI: 10.1101/GAD.463608 * |
| MCINTOSH ET AL., AM J HUMAN GENET, vol. 63, 1998, pages 1651 - 16581 |
| MIZUKAMI, Y., PNAS USA, vol. 97, 2000, pages 942 - 7 |
| MIZUKAMI, Y., PROC NATL ACAD SCI U S A, vol. 97, 2000, pages 942 - 7 |
| NATH, U., SCIENCE, vol. 299, 2003, pages 1404 - 7 |
| NILSSON, O. ET AL., TRANSGENIC RESEARCH, vol. 1, 1992, pages 209 - 220 |
| NUCL. ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| OARD, BIOTECH. ADV., vol. 9, 1991, pages 1 - 11 |
| OHNO, C.K., DEVELOPMENT, vol. 131, 2004, pages 1111 - 22 |
| OHTO, M.A., PNAS USA, vol. 102, 2005, pages 3123 - 3128 |
| PEARSON; LIPMAN, PNAS USA, vol. 85, 1988, pages 2444 - 2448 |
| PENG ET AL., INTERNATIONAL RICE RESEARCH INSTITUTE, 1991, pages 563 - 574 |
| RATHORE ET AL., PLANT MOLECULAR BIOLOGY, vol. 21, 1993, pages 871 - 884 |
| SAMBROOK ET AL.: "Molecular Cloning: a Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK J ET AL.: "Molecular Cloning: A Laboratory Manual", 2012, CSH PRESS |
| SCIENCE, vol. 289, 2000, pages 85 - 8 |
| SHIMAMOTO ET AL., NATURE, vol. 338, 1989, pages 274 - 276 |
| SMITH; WATERMAN, J. MOL BIOL., vol. 147, 1981, pages 195 - 197 |
| SOMERS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 1589 - 1594 |
| SONG, X.J., NAT GENET, vol. 39, 2007, pages 623 - 30 |
| SZECSI, J., EMBO J, vol. 25, 2006, pages 3912 - 20 |
| T. XIA ET AL: "The Ubiquitin Receptor DA1 Interacts with the E3 Ubiquitin Ligase DA2 to Regulate Seed and Organ Size in Arabidopsis", THE PLANT CELL ONLINE, vol. 25, no. 9, 1 September 2013 (2013-09-01), pages 3347 - 3359, XP055146588, ISSN: 1040-4651, DOI: 10.1105/tpc.113.115063 * |
| TAIRA ET AL., NATURE, vol. 372, 1994, pages 677 - 9 |
| TORIYAMA ET AL., BIO/TECHNOLOGY, vol. 6, 1988, pages 1072 - 1074 |
| URNOV, F.D. ET AL., NATURE REVIEWS. GENETICS, vol. 11, 2010, pages 636 - 646 |
| VASIL ET AL.: "Cell Culture and Somatic Cell Genetics of Plants", vol. I, II, I, 1984, ACADEMIC PRESS |
| VASIL, I. K., PLANT MOLECULAR BIOLOGY, vol. 25, 1994, pages 925 - 937 |
| WALTERS ET AL., PLANT MOLECULAR BIOLOGY, vol. 18, 1992, pages 189 - 200 |
| WEEKS ET AL., PLANT PHYSIOLOGY, vol. 102, 1993, pages 1077 - 1084 |
| WEISS, J., INT J DEV BIOL, vol. 49, 2005, pages 513 - 25 |
| WEISSBACH; WEISSBACH: "Methods for Plant Molecular Biology", 1989, ACADEMIC PRESS |
| WENJUAN FANG ET AL: "Maternal control of seed size by EOD3/CYP78A6 in Arabidopsis thaliana", vol. 70, no. 6, 1 June 2012 (2012-06-01), pages 929 - 939, XP002694140, ISSN: 0960-7412, Retrieved from the Internet <URL:http://onlinelibrary.wiley.com/doi/10.1111/j.1365-313X.2012.04907.x/pdf> [retrieved on 20120402], DOI: 10.1111/J.1365-313X.2012.04907.X * |
| WHITE, D.W., PNAS USA, vol. 103, 2006, pages 13238 - 43 |
| YANG ET AL., THE PLANT JOURNAL, vol. 63, 2010, pages 283 - 296 |
| ZHANG ET AL., PLANT CELL REP., vol. 7, 1988, pages 379 - 384 |
| ZHANG ET AL., THEOR APPL GENET, vol. 76, 1988, pages 835 - 840 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017178318A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| WO2017178322A1 (en) | 2016-04-11 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and endosperm-preferential promoters and uses thereof |
| US10975380B2 (en) | 2016-04-11 | 2021-04-13 | Basf Agricultural Solutions Seed, Us Llc | Seed-specific and endosperm-preferental promoters and uses thereof |
| WO2017178368A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed-specific and embryo-preferential promoters and uses thereof |
| WO2017178367A1 (en) | 2016-04-13 | 2017-10-19 | Bayer Cropscience Nv | Seed- and funiculus-preferential promoters and uses thereof |
| US10900046B2 (en) | 2016-04-13 | 2021-01-26 | BASF Agricultural Solutions Seed US LLC | Seed- and funiculus-preferential promoters and uses thereof |
| WO2023034731A1 (en) * | 2021-08-30 | 2023-03-09 | Pairwise Plants Services, Inc. | Modification of ubiquitin binding peptidase genes in plants for yield trait improvement |
| US12359215B2 (en) | 2021-08-30 | 2025-07-15 | Pairwise Plants Services, Inc. | Modification of ubiquitin binding peptidase genes in plants for yield trait improvement |
| WO2023052561A1 (en) | 2021-10-01 | 2023-04-06 | Basf Se | Plants with improved properties |
Also Published As
| Publication number | Publication date |
|---|---|
| CN105814075B (en) | 2020-02-07 |
| EP3068794A1 (en) | 2016-09-21 |
| GB201319876D0 (en) | 2013-12-25 |
| EP4269600A2 (en) | 2023-11-01 |
| US20210348181A1 (en) | 2021-11-11 |
| AU2014345338B2 (en) | 2019-03-07 |
| US10337021B2 (en) | 2019-07-02 |
| US20190352660A1 (en) | 2019-11-21 |
| UA122119C2 (en) | 2020-09-25 |
| BR112016010690A2 (en) | 2017-12-05 |
| EA202090273A3 (en) | 2020-12-30 |
| EA036049B1 (en) | 2020-09-18 |
| MX390791B (en) | 2025-03-21 |
| CN105814075A (en) | 2016-07-27 |
| EA201690831A1 (en) | 2016-11-30 |
| AU2014345338A1 (en) | 2016-06-09 |
| CA2929569A1 (en) | 2015-05-14 |
| US11118188B2 (en) | 2021-09-14 |
| CN111378683A (en) | 2020-07-07 |
| CL2016001122A1 (en) | 2017-10-13 |
| EP3068794B1 (en) | 2023-09-13 |
| EA202090273A2 (en) | 2020-10-30 |
| MX2016006051A (en) | 2016-11-14 |
| MX2019009031A (en) | 2019-09-11 |
| MX367015B (en) | 2019-08-02 |
| US20160272989A1 (en) | 2016-09-22 |
| US20250270577A1 (en) | 2025-08-28 |
| EP4269600A3 (en) | 2024-01-24 |
| US12247210B2 (en) | 2025-03-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12247210B2 (en) | Methods of modulating seed and organ size in plants | |
| US20230203519A1 (en) | Methods of modulating seed and organ size in plants | |
| CN114958867B (en) | Corn ear weight and yield regulation gene KWE2, its encoded protein, functional marker, expression vector and application | |
| CN101855353B (en) | Method for controlling the size of plant seeds and organs | |
| CN105612171B (en) | Methods of regulating seed and organ size in plants | |
| US20190246593A1 (en) | Manipulation of Self-Incompatibility in Plants | |
| AU2019321983A1 (en) | Genetically altered LysM receptors with altered agonist specificity and affinity | |
| CN104087561A (en) | White green leaf gene WGL1 of rice and application thereof | |
| CA2929569C (en) | Methods of modulating seed and organ size in plants | |
| CN111154786A (en) | Gene for regulating and controlling plant seed germination and seedling growth, and coding protein and application thereof | |
| EA047279B1 (en) | WAYS TO MODULATE THE SIZE OF SEEDS AND ORGANS IN PLANTS | |
| CN110241130A (en) | Control the GSN1 gene, coding albumen and its application of plant grain number and grain weight | |
| CN109439672B (en) | Application of gene ESP regulating rice ear development | |
| CN119410694A (en) | A method for preparing rice with changed tiller number |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14802104 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2929569 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/006051 Country of ref document: MX |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15035657 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122020003055 Country of ref document: BR |
|
| REEP | Request for entry into the european phase |
Ref document number: 2014802104 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014802104 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201690831 Country of ref document: EA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112016010690 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2014345338 Country of ref document: AU Date of ref document: 20141105 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201605610 Country of ref document: UA |
|
| ENP | Entry into the national phase |
Ref document number: 112016010690 Country of ref document: BR Kind code of ref document: A2 Effective date: 20160511 |


