WO2015036062A1 - Novel compositions - Google Patents

Novel compositions Download PDF

Info

Publication number
WO2015036062A1
WO2015036062A1 PCT/EP2013/073365 EP2013073365W WO2015036062A1 WO 2015036062 A1 WO2015036062 A1 WO 2015036062A1 EP 2013073365 W EP2013073365 W EP 2013073365W WO 2015036062 A1 WO2015036062 A1 WO 2015036062A1
Authority
WO
WIPO (PCT)
Prior art keywords
composition according
clause
suitably
immunogenic composition
polypeptide
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2013/073365
Other languages
French (fr)
Inventor
Patricia B BOURGUIGNON
Marguerite Christine Koutsoukos
Clarisse Marie-Madeleine Lorin
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Biologicals SA
Original Assignee
GlaxoSmithKline Biologicals SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by GlaxoSmithKline Biologicals SA filed Critical GlaxoSmithKline Biologicals SA
Priority to CA2851871A priority Critical patent/CA2851871A1/en
Publication of WO2015036062A1 publication Critical patent/WO2015036062A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55572Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55577Saponins; Quil A; QS21; ISCOMS
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16111Human Immunodeficiency Virus, HIV concerning HIV env
    • C12N2740/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present invention relates to particular immunogenic compositions comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a saponin and a lipopolysaccharide. Methods for the preparation of such immunogenic compositions and related kits are also provided. BACKGROUND OF THE INVENTION
  • HIV is the primary cause of acquired immune deficiency syndrome (AIDS) which is regarded as one of the world's major health problems.
  • AIDS acquired immune deficiency syndrome
  • antiretroviral therapy is prolonging the lives of many people infected with HIV, to be effective antiretroviral therapy requires strict adherence to often complex multidrug administration regimes and does not cure the infection. New infections are greatly exceeding the number of people able to be treated through current global financial efforts.
  • HIV-1 Two types of HIV have been characterized: HIV-1 and HIV-2. HIV-1 is highly virulent and infective and is the cause of the majority of HIV infections globally, whilst HIV-2 has a lower virulence and infectivity and is largely confined to West Africa (Gilbert et al., Stat In Med 22(4):573-593 (2003) and Reeves and Doms J Gen Vir 83:1253-1265 (2002)). There are many genetically distinct subtypes (also known as 'clades') of HIV-1 and the amino acid sequences of just the envelope glycoproteins (gp120 and gp41 ) can vary from 25-30% between subtypes (Kalish et al., AIDS 9:851 -857 (1995)). The genetic diversity of HIV-1 along with the high mutation rate are major obstacles for HIV-1 vaccine development.
  • the HIV envelope glycoprotein gp120 and other HIV-1 proteins gp120 is the viral protein that is used for attachment to a host cell. This attachment is mediated by gp120 binding surface molecules of helper T cells and macrophages including one of the two chemokine receptors CCR-5 or CXCR-4.
  • the gp120 protein is first expressed as a larger precursor molecule (gp160), which is then cleaved post-translationally to yield gp120 and gp41.
  • the gp120 protein is retained on the surface of the virion, non-covalently associated with the gp41 molecule, which is inserted into the viral membrane.
  • Three non- covalently associated envelope glycoprotein gp120 and gp41 heterodimers form the trimeric Env spike found on the surface of HIV-1.
  • Non-envelope proteins of HIV-1 have been described and include for example internal structural proteins such as other products of the Env gene (such as gp160 and gp41 ) the products of the gag and pol genes (such as MA, CA, SP1 , NC, SP2 and P6; and RT, RNase H, IN and PR, respectively) and other non-structural proteins such as Rev, Nef, Vif, Vpr, Vpu and Tat (Greene et al., New Eng J Med, 324, 5, 308 et seq (1991 ) and Bryant et al. (Ed. Pizzo), Pediatr Infect Dis J, 1 1 , 5, 390 et seq (1992)).
  • internal structural proteins such as other products of the Env gene (such as gp160 and gp41 ) the products of the gag and pol genes (such as MA, CA, SP1 , NC, SP2 and P6; and RT, RNase H, IN and PR, respectively) and other non-structural
  • gp120 cytotoxic T lymphocytes
  • CTL cytotoxic T lymphocytes
  • Some CTL epitopes appear to be relatively conserved among different HIV strains.
  • current CTL-based vaccines do not protect against infection in animal models of HIV (Amara et al., Science 292(5514):69-74 (2001 )).
  • CTL-based vaccines studied to date in humans have not induced these intended responses in all recipients (Goepfert et al., J Infect Dis 192(7): 1249-1259 (2005)). Such CTL-based vaccines were not able to protect against infection, nor impact viral load post infection (the "HVTN-505 study").
  • the gp120 protein is a major target of neutralising antibodies (Pantophlet et al., Annu Rev Immunol 24:739-769 (2006)) and neutralising antibodies were previously thought to be a potential correlate of protection (Bruck et al., Vaccine 12(12):1 141-1 148 (1994) and Plotkin, Pediatr Infect Dis J 20:63-75 (2001 )).
  • One region of the gp120 protein in particular, the V3 loop' is targeted by neutralising antibodies.
  • Antibodies present in immune sera of infected individuals bind to V3 loop peptides (Spenlehauer et al., J Vir, 72(12):98559864 (1998)).
  • V3 loop of the gp120 protein.
  • V3 loop is unfortunately highly variable and highly strain specific (Vaine et al., PLoS One, 5(1 1 ):e13916, (2010), Jones et al., J Infect Dis, 179:558-566 (1999) and McCormack et al., Vaccine 18(13): 1 166-1 177 (2000)).
  • HIV-1 NefTat, gp120 W 6iD and SIV Nef proteins formulated with the AS02A adjuvant system 50ug of QS-21 and 50ug of 3D-MPL in an oil-in-water emulsion
  • AS02A adjuvant system 50ug of QS-21 and 50ug of 3D-MPL in an oil-in-water emulsion
  • a vaccine comprising gp120 with an adjuvant comprising QS-21 and 3D-MPL had poor cross-subtype reactivity and (ii) it appears that gp120 may have a detrimental impact on previously accepted potential markers of efficacy for HIV vaccines containing other antigens.
  • the use of gp120 as a vaccine antigen to elicit humoral responses was thought to be of limited use for a broadly protective vaccine and, consequently, interest in this protein has reduced.
  • the RV144 HIV-1 vaccine trial was the first to demonstrate evidence of protection against HIV- 1 infection, with an estimated vaccine efficacy of 31.2% (Rerks-Ngarm et al, N Engl J Med 361 :2209-2220 (2009)).
  • the protocol consisted of four priming injections of ALVAC-HIV (vCP1521 ), and two booster injections of AIDSVAX B/E.
  • ALVAC-HIV was administered at baseline (day 0), 4 weeks, 12 weeks and 24 weeks.
  • AIDSVAX B/E was administered at weeks 12 and 24.
  • ALVAC-HIV (vCP1521 ) is a recombinant canary pox viral vector containing gp120 from HIV-1 subtype E (CRF01_AE) strain 92TH023, linked to the transmembrane-anchoring portion of gp41 (carrying a deletion in the immunodominant region) from HIV-1 subtype B strain LAI .
  • the vector also contained H IV L AI gag and pol genes.
  • AI DSVAX B/E is a preparation of recombinant HIV-1 subtype B MN gp120, CM244 subtype E A244 gp120 and an alum adjuvant.
  • (xiii) be of utility in the treatment or prevention of HIV-1 infection by a first HIV-1 subtype when the gp120 related polypeptide of the composition is derived from a second HIV-1 subtype
  • mice administered with gp120 W 6iD and AS01 B had a higher mean level of anti-V1V2 antibodies in their serum compared to mice administered with gp120 W 6iD, AS01 B and NefTat.
  • the present inventors analysed serum from 30 subjects who had previously taken part in the "PRO HIV-002" trial and had been vaccinated with gp120, NefTat and AS01 B adjuvant (QS-21 and 3D-MPL in liposomal form).
  • the present inventors found that, surprisingly, subjects from the PRO HIV-002 trial had a high level of anti-V1V2 antibodies in their serum, which showed high persistence and exceeded the level of anti-V1V2 antibodies in serum from subjects of the RV144 trial.
  • the claimed immunogenic compositions elicit a high level of anti-V1V2 antibodies, and have utility the in the prophylaxis of HIV infection.
  • the present invention provides an immunogenic composition which is in the form of a human dose comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises between 10-40ug of a lipopolysaccharide and between 10-40ug of an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
  • an immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome wherein:
  • the conductivity of the composition is 13 mS/cm or lower;
  • the concentration of salts in said composition is 130 mM or lower;
  • the concentration of sodium chloride in said composition is 130 mM or lower.
  • an immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome and wherein the composition is substantially free of a NefTat related polypeptide wherein the NefTat related polypeptide is a polypeptide consisting of SEQ ID NO: 4.
  • Figure 2 PRO HIV-002 and RV144 trial analysis: anti-V1V2 IgG comparison
  • Figure 4 PRO HIV-002 anti-V1V2 IgG cross-subtype reactivity as compared to
  • FIG. 5 PRO HIV-002 anti-V1V2 IgG durability
  • SEQ ID NO: 6 polynucleotide sequence encoding gp1 20 Z Mis
  • SEQ ID NO: 8 polynucleotide sequence encoding native gp1 20 Z Mis DETAILED DESCRIPTION OF THE INVENTION
  • the term 'a gp120 related polypeptide' refers to a polypeptide comprising the V1 V2 region of SEQ ID NO: 1 or to an immunogenic derivative or fragment of the V1 V2 region of SEQ ID NO: 1 , or to a polypeptide comprising the V1V2 region of SEQ ID NO: 5 or to an immunogenic derivative or fragment of the V1V2 region of SEQ ID NO: 5.
  • the gp120 related polypeptide refers to a polypeptide consisting of the V1 V2 region of SEQ ID NO: 1 or to an immunogenic derivative or fragment of the V1V2 region of SEQ ID NO: 1 , or to a polypeptide consisting of the V1 V2 region of SEQ ID NO: 5 or to an immunogenic derivative or fragment of the V1V2 region of SEQ ID NO: 5.
  • the V1V2 region of a gp120 related polypeptide is the stretch of residues defined by two particular cysteine residues which form a disulphide bridge in the folded state of the polypeptide. The V1V2 region itself excludes these cysteine residues.
  • V1V2 region in the case of the gp120 W 6iD polypeptide is the stretch of residues from residue 90 to 184.
  • the skilled person will appreciate that the position of these cysteine residues and therefore the position of the V1V2 region within a given gp120 related polypeptide can vary. This is illustrated by another gp120 related polypeptide, gp120 Z Mis (SEQ ID NO: 5) wherein the V1V2 region is the stretch of residues from residue 90 to 172.
  • the term 'a gp120 related polypeptide' refers to a polypeptide comprising SEQ ID NO: 1 or to an immunogenic derivative or fragment of SEQ ID NO: 1 , or to a polypeptide comprising SEQ ID NO: 5 or to an immunogenic derivative or fragment of SEQ ID NO: 5.
  • the gp120 related polypeptide refers to a polypeptide consisting of SEQ ID NO: 1 or to an immunogenic derivative or fragment of SEQ ID NO: 1 , or to a polypeptide consisting of SEQ ID NO: 5 or to an immunogenic derivative or fragment of SEQ ID NO: 5.
  • derivative refers to a polypeptide that is modified relative to the reference sequence.
  • Immunogenic derivatives are sufficiently similar to the reference sequence to remain capable of eliciting an immune response against the V1V2 region of the reference sequence.
  • immunogenic derivatives are sufficiently similar to the reference sequence to retain other key immunogenic properties of the reference sequence such as avoiding the introduction of immunodominant epitopes.
  • a derivative may, for example, comprise a modified version of the reference sequence or alternatively may consist of a modified version of the reference sequence.
  • the gp120 related polypeptide comprises or consists of a gp120 polypeptide derived from HIV-1 or HIV-2, suitably from groups M, N, O or P of HIV-1 , suitably from subtype A, B, C, D, E, F, G, H, I, J or K of group M.
  • the gp120 related polypeptide comprises or consists of a gp120 polypeptide derived from HIV-1 , suitably from group M, more suitably from subtype B.
  • the gp120 related polypeptide comprises or consists of the gp120 polypeptide from a HIV-1 or HIV-2, suitably from an M, N, O or P group HIV-1 , suitably from a subtype A, B, C, D, E, F, G, H, I, J or K of group M HIV-1.
  • the gp120 related polypeptide comprises or consists of the gp120 polypeptide from an HIV-1 , suitably from an HIV-1 group M, more suitably from an HIV-1 group M subtype B.
  • an immunogenic derivative will contain substitutions of up to 20 residues (for example up to 5 residues) relative to the reference sequence.
  • Immunogenic derivatives may also include those wherein additional amino acids are inserted compared to the reference sequence.
  • additional amino acids are inserted compared to the reference sequence.
  • insertions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • an immunogenic derivative will contain additions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations) relative to the reference sequence.
  • One example of insertions includes a short stretch of histidine residues (e.g. 6 residues) to aid purification of the antigen in question.
  • Immunogenic derivatives include those wherein amino acids have been deleted compared to the reference sequence. Suitably such deletions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen. Suitably an immunogenic derivative will contain deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations) relative to the reference sequence.
  • the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of the V1V2 region of SEQ ID NO: 1 having a small number of deletions, insertions and/or substitutions, such as a derivative of the V1V2 region of SEQ ID NO: 1 having deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations), insertions of up to 5 residues (for example 1 or 2 residues) at 0-5 five locations (for example 0- 2 locations) and substitutions of up to 20 residues (for example up to 5 residues).
  • an immunogenic derivative of the V1V2 region of SEQ ID NO: 1 having a small number of deletions, insertions and/or substitutions, such as a derivative of the V1V2 region of SEQ ID NO: 1 having deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations), insertions of up to 5 residues (for example 1
  • the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of the V1V2 region of SEQ ID NO: 5 having a small number of deletions, insertions and/or substitutions, such as a derivative of the V1V2 region of SEQ ID NO: 5 having deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations), insertions of up to 5 residues (for example 1 or 2 residues) at 0-5 five locations (for example 0- 2 locations) and substitutions of up to 20 residues (for example up to 5 residues).
  • an immunogenic derivative of the V1V2 region of SEQ ID NO: 5 having a small number of deletions, insertions and/or substitutions, such as a derivative of the V1V2 region of SEQ ID NO: 5 having deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations), insertions of up to 5 residues (for example 1
  • the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 1 having a small number of deletions, insertions and/or substitutions, such as a derivative of SEQ ID NO: 1 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
  • the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 5 having a small number of deletions, insertions and/or substitutions, such as a derivative of SEQ ID NO: 5 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
  • the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ ID NO: 1.
  • the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 1.
  • the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ I D NO: 1.
  • the gp120 related polypeptide consists of the V1 V2 region of SEQ ID NO: 1.
  • the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ ID NO: 5.
  • the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 5.
  • the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ ID NO: 5.
  • the gp120 related polypeptide consists of the V1 V2 region of SEQ ID NO: 5.
  • the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 1.
  • the gp120 related polypeptide comprises SEQ ID NO: 1.
  • the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 1.
  • the gp120 related polypeptide consists of SEQ ID NO: 1.
  • the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 5.
  • the gp120 related polypeptide comprises SEQ ID NO: 5.
  • the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 5.
  • the gp120 related polypeptide consists of SEQ ID NO: 5.
  • identity in the context of two or more polypeptide sequences, refer to two or more sequences or sub-sequences that are the same or have a specified percentage of amino acid residues that are the same over a specified region, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. This definition also refers to the compliment of a test sequence.
  • identity exists over a region that is at least 300 amino acids in length, such as at least 400 amino acids or at least 500 amino acids. Most suitably, the comparison is performed over a window corresponding to the entire length of the reference sequence (as opposed to the derivative sequence).
  • sequence comparison For sequence comparison, one sequence acts as the reference sequence, to which the test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percentage sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a “comparison window”, as used herein, refers to a segment in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well- known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981 ), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci.
  • HSPs high scoring sequence pairs
  • Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
  • M forward score for a pair of matching residues; always > 0
  • N penalty score for mismatching residues; always ⁇ 0.
  • a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • W wordlength
  • E expectation
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • P(N) the smallest sum probability
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more suitably less than about 0.01 , and most suitably less than about 0.001 .
  • an "immunogenic fragment” will contain a contiguous sequence of amino acids from the gp120 related polypeptide of which it is a fragment.
  • the fragment contains at least 15 to 50 amino acids, at least 51 to 150, at least 300 amino acids, at least 350, at least 400, or at least 450 contiguous amino acids from SEQ ID NO: 1.
  • the fragment contains at least 15 to 50 amino acids, at least 51 to 150 amino acids, at least 300, at least 350, at least 400, or at least 450 contiguous amino acids from SEQ ID NO: 5.
  • the immunogenic fragment will remain capable of eliciting an immune response against the V1V2 region of the reference sequence.
  • “remain capable of eliciting an immune response against the V1V2 region of the reference sequence” is meant at least 50%, suitably at least 75% and suitably at least 90% activity of the reference sequence in an assay of the level of antibodies binding the gp120 V1V2 region (e.g. ELISA) produced at a given time point after immunisation with the gp120 related polypeptide.
  • the gp120 related polypeptide may for example contain 2000 amino acid residues or fewer, such as 1500 amino acid residues or fewer, in particular 1000 amino acid residues or fewer, especially 800 amino acid residues or fewer.
  • Fusion proteins are proteins created through the covalent linkage of two or more polypeptide sequences which are not joined in nature, such as through a peptide linkage.
  • the gp120 related polypeptide may be provided in the form of a fusion protein also comprising a second HIV antigen.
  • the dose of a gp120 related polypeptide is suitably able to produce an adequate immune response in a human while having an acceptable reactogenicity profile.
  • the immunogenic composition comprises around 1 to 200 ug of gp120 related polypeptide, suitably between 1 to 100 ug, suitably between 2 to 50 ug, such as between 3 to 30 ug, in particular between 5 to 15 ug or between 16 to 25 ug, between 9 to 1 1 ug or between 19 to 21 ug, most suitably 10 ug or 20 ug.
  • the immunogenic composition is provided in a volume which is suitable for administration to a human as a single dose. The volume which may be administered to a human is dependent on the method, route and/or location of administration.
  • the human dose is between 0.1 and 1 ml, more suitably between 0.3 and 0.75ml, such as between 0.45 and 0.55ml, in particular 0.5ml. Volumes of between 0.1 and 1 ml are particularly suitable for administration through routes such as subcutaneous and in particular intramuscular delivery. In another embodiment the human dose is between 0.05 and 0.2ml, suitably between 0.075 and 0.15ml, in particular 0.1 ml. Volumes of between 0.05 and 0.2ml are particularly suitable for administration through routes wherein a limited volume can be administered, such as intradermal delivery.
  • a gp120 polypeptide may be prepared by methods described in the art or methods analogous thereto.
  • the term 'a Nef related polypeptide' refers to the polypeptide provided in SEQ ID NO: 2, or to an immunogenic derivative or fragment thereof.
  • Tat related polypeptide' refers to the polypeptide provided in SEQ ID NO: 3, or to an immunogenic derivative or fragment thereof.
  • NefTat related polypeptide refers to the polypeptide provided in SEQ ID NO: 4, or to an immunogenic derivative or fragment thereof.
  • the Nef related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 2, optionally having a small number of deletions, insertions and/or substitutions.
  • An example is a derivative of SEQ ID NO: 2 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
  • the Tat related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 3, optionally having a small number of deletions, insertions and/or substitutions.
  • an example is a derivative of SEQ ID NO: 3 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
  • the NefTat related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 4, optionally having a small number of deletions, insertions and/or substitutions.
  • An example is a derivative of SEQ ID NO: 4 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
  • the Nef related polypeptide comprises SEQ ID NO: 2.
  • the Nef related polypeptide comprises a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 2.
  • the Tat related polypeptide comprises SEQ ID NO: 3.
  • the Tat related polypeptide comprises a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 3.
  • the NefTat related polypeptide comprises SEQ ID NO: 4.
  • the NefTat related polypeptide comprises a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 4.
  • the Nef related polypeptide consists of SEQ ID NO: 2.
  • Nef related polypeptide consists of a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 2.
  • the Tat related polypeptide consists of SEQ ID NO: 3.
  • the Tat related polypeptide consists of a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 3.
  • NefTat related polypeptide consists of SEQ ID NO: 4.
  • NefTat related polypeptide consists of a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 4.
  • a Nef related polypeptide is a NefTat related polypeptide.
  • a Tat related polypeptide is a NefTat related polypeptide.
  • Particular derivatives of a Nef related polypeptide, Tat related polypeptide or NefTat related polypeptide include those with additional His residues at the N-terminus (e.g. a polyhistidine tag of six His residues, which may be used for nickel affinity purification).
  • compositions of the present invention are substantially free of a Nef related polypeptide.
  • the compositions of the present invention contain a ratio of a Nef related polypeptide:gp120 related polypeptide of less than 1 :20, suitably less than 1 :25, suitably less than 1 :50, suitably less than 1 :100, suitably less than 1 :200, suitably less than 1 :500, more suitably less than 1 :1000 by weight.
  • compositions of the present invention contain a Nef related polypeptide at a level of less than 5ug, suitably less than 4ug, suitably less than 3ug, suitably less than 2ug, suitably less than 1 ug, suitably less than 0.5ug, suitably less than 0.2ug, suitably less than 0.1 ug, suitably less than 0.05ug, more suitably less than 0.01 ug per human dose.
  • compositions of the present invention are free of a Nef related polypeptide.
  • compositions of the present invention are substantially free of a Tat related polypeptide.
  • the compositions of the present invention contain a ratio of a Tat related polypeptide:gp120 related polypeptide of less than 1 :20, suitably less than 1 :25, suitably less than 1 :50, suitably less than 1 :100, suitably less than 1 :200, suitably less than 1 :500, more suitably less than 1 :1000 by weight.
  • compositions of the present invention contain a Tat related polypeptide at a level of less than 5ug, suitably less than 4ug, suitably less than 3ug, suitably less than 2ug, suitably less than 1 ug, suitably less than 0.5ug, suitably less than 0.2ug, suitably less than 0.1 ug, suitably less than 0.05ug, more suitably less than 0.01 ug per human dose.
  • compositions of the present invention are free of a Tat related polypeptide.
  • compositions of the present invention are substantially free of a NefTat related polypeptide.
  • the compositions of the present invention contain a ratio of a NefTat related polypeptide:gp120 related polypeptide of less than 1 :20, suitably less than 1 :25, suitably less than 1 :50, suitably less than 1 :100, suitably less than 1 :200, suitably less than 1 :500, more suitably less than 1 :1000 by weight.
  • compositions of the present invention contain a NefTat related polypeptide at a level of less than 5ug, suitably less than 4ug, suitably less than 3ug, suitably less than 2ug, suitably less than 1 ug, suitably less than 0.5ug, suitably less than 0.2ug, suitably less than 0.1 ug, suitably less than 0.05ug, more suitably less than 0.01 ug per human dose.
  • compositions of the present invention are free of a NefTat related polypeptide.
  • composition of the invention may comprise additional proteins which may be further products of the Env gene (such as gp160 and gp41 or a further gp120 related polypeptide) the products of the gag and pol genes (such as MA, CA, SP1 , NC, SP2 and P6; and RT, RNase H, IN and PR, respectively) and, other non-structural proteins such as Rev, Vif, Vpr and Vpu (or immunogenic derivatives or fragments thereof).
  • the HIV gag gene encodes a precursor protein p55, which can assemble spontaneously into immature virus-like particles (VLPs).
  • the precursor is proteolytically cleaved into the major structural proteins CA (capsid) and MA (matrix), and into several smaller proteins. Both the precursor protein p55 and its major derivatives CA and MA may be considered as appropriate vaccine antigens which may increase the efficacy of the composition of the invention.
  • the precursor p55 and the capsid protein CA may be used as VLPs or as monomeric proteins.
  • the composition of the present invention may comprise one or more of these proteins.
  • the composition of the present invention may comprise a polynucleotide encoding a polypeptide described above including for example a gp120 related polypeptide.
  • the polynucleotide may be in the form of plasmid DNA or in the form of a recombinant live vector.
  • the composition of the present invention does not comprise additional HIV antigens.
  • the composition comprises 1-5 additional HIV antigens, such as 1 or 2 additional HIV antigens. Additional HIV antigens may be provided in the form of proteins or polynucleotides encoding proteins.
  • the immunogenic composition comprises a total of around 1 to 500 ug of antigenic material, suitably between 1 to 200 ug, such as between 5 to 100 ug, most suitably between 5 to 50 ug.
  • the polypeptides and polynucleotides used in the present invention are isolated.
  • An "isolated" polypeptide or polynucleotide is one that is removed from its original environment.
  • a naturally-occurring protein is isolated if it is separated from some or all of the coexisting materials in the natural system.
  • such polypeptides are at least about 90% pure, more suitably at least about 95% pure and most suitably at least about 99% pure.
  • a polynucleotide is considered to be isolated if, for example, it is cloned into a vector that is not a part of its natural environment.
  • the immunogenic composition of the invention comprises an immunologically active saponin fraction ("a saponin") as an adjuvant or as a component of an adjuvant.
  • a saponin immunologically active saponin fraction
  • a particularly suitable saponin for use in the present invention is Quil A and its derivatives.
  • Quil A is a saponin preparation isolated from the South American tree Quillaja Saponaria Molina and was first described by Dalsgaard et al. in 1974 ("Saponin adjuvants", Archiv. fur dierare Virusforschung, Vol. 44, Springer Verlag, Berlin, p243-254) to have adjuvant activity.
  • QS-7 and QS-21 are natural saponin derived from the bark of Quillaja saponaria Molina, which induces CD8+ cytotoxic T cells (CTLs), Th1 cells and a predominant lgG2a antibody response and is a preferred saponin in the context of the present invention.
  • the saponin adjuvant within the immunogenic composition is a derivative of saponaria molina quil A, suitably an immunologically active fraction of Quil A, such as QS-7 or QS-21 , suitably QS-21 .
  • the compositions of the invention contain the immunologically active saponin fraction in substantially pure form.
  • the compositions of the invention contain QS-21 in substantially pure form, that is to say, the QS-21 is at least 90% pure, for example at least 95% pure, or at least 98% pure.
  • QS-21 is provided in a less reactogenic composition where it is quenched with an exogenous sterol, such as cholesterol for example.
  • an exogenous sterol such as cholesterol for example.
  • the saponin/sterol is in the form of a liposome structure (US6846489, Example 1 ).
  • the liposomes suitably contain a neutral lipid, for example phosphatidylcholine, which is suitably non-crystalline at room temperature, for example eggyolk phosphatidylcholine, dioleoyl phosphatidylcholine (DOPC) or dilauryl phosphatidylcholine.
  • the liposomes may also contain a charged lipid which increases the stability of the lipsome-QS-21 structure for liposomes composed of saturated lipids.
  • the amount of charged lipid is suitably 1-20% w/w, suitably 5-10%.
  • the ratio of sterol to phospholipid is 1 -50% (mol/mol), suitably 20-25%.
  • Suitable sterols include beta-sitosterol, stigmasterol, ergosterol, ergocalciferol and cholesterol.
  • the adjuvant composition comprises cholesterol as sterol.
  • These sterols are well known in the art, for example cholesterol is disclosed in the Merck Index, 1 1 th Edn., page 341 , as a naturally occurring sterol found in animal fat.
  • the sterol according to the invention is taken to mean an exogenous sterol, i.e. a sterol which is not endogenous to the organism from which the antigenic preparation is taken but is added to the antigen preparation or subsequently at the moment of formulation.
  • the sterol may be added during subsequent formulation of the antigen preparation with the saponin adjuvant, by using, for example, the saponin in its form wherein its lytic activity is quenched with the sterol.
  • the exogenous sterol is associated to the saponin adjuvant as described in US6846489.
  • the ratio of QS-21 : sterol will typically be in the order of 1 :100 to 1 :1 (w/w), suitably between 1 :10 to 1 : 1 (w/w), and suitably 1 :5 to 1 :1 (w/w). Suitably excess sterol is present, the ratio of QS-21 : sterol being at least 1 :2 (w/w). In one embodiment, the ratio of QS-21 : sterol is 1 :5 (w/w).
  • Sapoalbin from Gypsophilla struthium (R. Vochten et al., 1968, J Pharm Belg, 42, 213-226) has also been described in relation to ISCOM production for example.
  • Another useful saponin is those derived from the plant Gyophilla struthium.
  • the total amount of saponin in the immunogenic composition of the present invention is between 1-100ug.
  • an immunogenic composition comprising QS-21 at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug.
  • an immunogenic composition comprising QS-21 at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
  • an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises QS- 21 at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug.
  • an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises QS- 21 at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
  • the dose of QS-21 is suitably able to enhance an immune response to an antigen in a human.
  • a suitable QS-21 amount is that which improves the immunological potential of the composition compared to the unadjuvanted composition, or compared to the composition adjuvanted with another QS-21 amount, whilst being acceptable from a reactogenicity profile.
  • LPS Lipopolysaccharides
  • lipid A the innermost region which serves as the hydrophobic anchor, it comprises glucosamine disaccharide units which carry long chain fatty acids.
  • LPS The biological activities of LPS, such as lethal toxicity, pyrogenicity and adjuvanticity, have been shown to be related to the lipid A moiety. In contrast, immunogenicity is associated with the O-specific polysaccharide component (O-antigen).
  • O-antigen the O-specific polysaccharide component
  • Both LPS and lipid A have long been known for their strong adjuvant effects, but the high toxicity of these molecules has precluded their use in vaccine formulations. Significant effort has therefore been made towards reducing the toxicity of LPS or lipid A while maintaining their adjuvanticity.
  • the Salmonella minnesota mutant R595 was isolated in 1966 from a culture of the parent (smooth) strain (Luderitz et al. 1966 Ann N Y Acad Sci 133:349-374). The colonies selected were screened for their susceptibility to lysis by a panel of phages, and only those colonies that displayed a narrow range of sensitivity (susceptible to one or two phages only) were selected for further study. This effort led to the isolation of a deep rough mutant strain which is defective in LPS biosynthesis and referred to as S. minnesota R595.
  • the core region is very short - this characteristic increases the strain susceptibility to a variety of chemicals
  • the lipid A moiety is highly acylated with up to 7 fatty acids.
  • MPL 4'-monophosporyl lipid A
  • LPS 4'-monophosporyl lipid A
  • LPS is typically refluxed in mineral acid solutions of moderate strength (e.g. 0.1 M HCI) for a period of approximately 30 minutes. This process results in dephosphorylation at the 1 position, and decarbohydration at the 6' position, yielding MPL.
  • 3-O-deacylated monophosphoryl lipid A (3D-MPL), which may be obtained by mild alkaline hydrolysis of MPL, has a further reduced toxicity while again maintaining adjuvanticity, see US4912094 (Ribi Immunochemicals).
  • Alkaline hydrolysis is typically performed in organic solvent, such as a mixture of chloroform/methanol, by saturation with an aqueous solution of weak base, such as 0.5 M sodium carbonate at pH 10.5.
  • weak base such as 0.5 M sodium carbonate at pH 10.5.
  • composition further comprises an additional adjuvant which is a lipopolysaccharide, suitably a non-toxic derivative of lipid A, particularly monophosphoryl lipid A or more particularly 3-deacylated monophoshoryl lipid A (3D-MPL).
  • an additional adjuvant which is a lipopolysaccharide, suitably a non-toxic derivative of lipid A, particularly monophosphoryl lipid A or more particularly 3-deacylated monophoshoryl lipid A (3D-MPL).
  • 3D-MPL is sold under the name MPL by GlaxoSmithKline Biologicals N.A. and is referred throughout the document as MPL or 3D-MPL. see, for example, US4436727; US487761 1 ; US4866034 and US4912094.
  • 3D-MPL can be produced according to the methods disclosed in US4912094. Chemically it is a mixture of 3-deacylated monophosphoryl lipid A with 3, 4, 5 or 6 acylated chains.
  • small particle 3D- MPL is used.
  • Small particle 3D-MPL has a particle size such that it may be sterile-filtered through a 0.22um filter. Such preparations are described in US5776468.
  • the total amount of lipopolysaccharide in the immunogenic composition of the present invention, particularly in a human dose of the immunogenic composition of the present invention is between 1-100ug.
  • an immunogenic composition comprising 3D-MPL at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug.
  • an immunogenic composition comprising 3D-MPL at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
  • an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises 3D- MPL at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug.
  • an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises 3D- MPL at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
  • compositions of the invention are those wherein liposomes are initially prepared without MPL (as described in US6846489), and MPL is then added, suitably as small particles of below 100 nm particles or particles that are susceptible to sterile filtration through a 0.22 urn membrane.
  • MPL is therefore not contained within the vesicle membrane (known as MPL out).
  • Compositions where the MPL is contained within the vesicle membrane also form an aspect of the invention.
  • the antigen can be contained within the vesicle membrane or contained outside the vesicle membrane. Suitably soluble antigens are outside and hydrophobic or lipidated antigens are either contained inside or outside the membrane.
  • the invention comprises both lipopolysaccharide and immunologically active saponin.
  • the lipopolysaccharide is 3D-MPL and the immunologically active saponin is QS-21.
  • the composition comprises a lipopolysaccharide and immunologically active saponin in a liposomal formulation.
  • the composition comprises 3D-MPL and QS-21 , with optionally a sterol which is suitably cholesterol.
  • the adjuvant composition comprises in a liposomal formulation lipopolysaccharide and immunologically active saponin in combination with one or more further immunostimulants or adjuvants.
  • the lipopolysaccharide is 3D-MPL and the immunologically active saponin is QS-21 .
  • QS-21 and 3D-MPL are present in a weight ratio of between 1 :2 to 2:1 .
  • QS-21 and 3D-MPL are present in same final amount per human dose of the immunogenic composition.
  • a human dose of immunogenic composition comprises a final level of 50 ug of 3D-MPL and 50 ug of QS-21. In another aspect, a human dose of immunogenic composition comprises a final level of 25 ug of 3D-MPL and 25 ug of QS-21. In a further embodiment, a human dose of immunogenic composition comprises a final level of 10ug each of MPL and QS-21.
  • Vaccine preparation is generally described in New Trends and Developments in Vaccines, edited by Voller et al., University Park Press, Baltimore, Maryland, U.S.A. 1978.
  • Encapsulation within liposomes is described, for example, in US4235877.
  • Conjugation of proteins to macromolecules is disclosed, for example, in US4372945 and in US4474757.
  • antigens are sensitive to the presence of salts. Without being limited by theory, it is believed that these antigens are detrimentally impacted by a phenomenon known as "salting out” which may be defined as the precipitation of a protein from its solution by interaction with salts, such as sodium chloride. These antigens aggregate and precipitate at a concentration of sodium chloride as low as 150 mM. Consequently, the stability of immunogenic compositions comprising a gp120 related polypeptides may be improved by a reduction in the concentration of sodium chloride.
  • the immunogenic compositions of the invention will suitably be aqueous preparations.
  • the present invention provides an immunogenic composition comprising a gp120 related polypeptide, wherein the conductivity of the composition is 13 mS/cm or lower.
  • the present invention provides immunogenic compositions wherein the conductivity of the immunogenic composition is 12 mS/cm or lower, for example 10 mS/cm or lower, 8 mS/cm or lower, 6 mS/cm or lower, 5 mS/cm or lower, 4 mS/cm or lower, or 3 mS/cm or lower.
  • the conductivity of the immunogenic composition is 2.5 mS/cm or lower, such as 2.25 mS/cm or lower, or 2.0 mS/cm or lower.
  • the conductivity of the immunogenic composition is 1.5 to 2.5 mS/cm.
  • an immunogenic composition comprising a gp120 related polypeptide, wherein the concentration of salts in said composition is 130 mM or lower.
  • the present invention provides immunogenic compositions wherein the concentration of salts in said composition is 100 mM or lower, for example 90 mM or lower, 80 mM or lower, 70 mM or lower, 60 mM or lower, 50 mM or lower, or 40 mM or lower.
  • the concentration of salts in said composition is 35 mM or lower, such as 30 mM or lower, or 25 mM or lower.
  • the concentration of salts in said composition is 20 to 40 mM, such as 25 to 35 mM.
  • the present invention also provides an immunogenic composition comprising a gp120 related polypeptide, wherein the concentration of sodium chloride in said composition is 130 mM or lower.
  • the present invention provides immunogenic compositions wherein the concentration of sodium chloride is 100 mM or lower, for example 90 mM or lower, 80 mM or lower, 70 mM or lower, 60 mM or lower, 50 mM or lower, 40 mM or lower, 30 mM or lower, 20 mM or lower or 15 mM or lower.
  • the concentration of sodium chloride in the immunogenic composition is 10 mM or lower, such as 7.5 mM or lower.
  • the concentration of sodium chloride in the immunogenic composition is at or below 5 mM.
  • the immunogenic composition is essentially free of sodium chloride.
  • concentration of sodium chloride is at or very near to zero mM (such as 3 mM or less, 2 mM or less or 1 mM or less).
  • concentration of CaCI 2 in the immunogenic compositions will be 40 mM or lower, 30 mM or lower, 20 mM or lower, 15 mM or lower or 10 mM or lower.
  • the concentration of MgS0 4 in the immunogenic compositions will be 80 mM or lower, 60 mM or lower, 40 mM or lower, 30 mM or lower, 20 mM or lower or 10 mM or lower
  • the total concentration of NH 4 + , Mg 2+ and Ca 2+ ions in the immunogenic compositions will be 80 mM or lower, 60 mM or lower, 40 mM or lower, 30 mM or lower, 20 mM or lower or 10 mM or lower. It is well known that for parenteral administration solutions should have a pharmaceutically acceptable osmolality to avoid cell distortion or lysis. A pharmaceutically acceptable osmolality will generally mean that solutions will have an osmolality which is approximately isotonic or mildly hypertonic.
  • the immunogenic compositions of the present invention will have an osmolality in the range of 250 to 750 mOsm/kg, for example, the osmolality may be in the range of 250 to 550 mOsm/kg, such as in the range of 280 to 500 mOsm/kg.
  • Osmolality may be measured according to techniques known in the art, such as by the use of a commercially available osmometer, for example the Advanced® Model 2020 available from Advanced Instruments Inc. (USA).
  • An "isotonicity agent” is a compound that is physiologically tolerated and imparts a suitable tonicity to a formulation to prevent the net flow of water across cell membranes that are in contact with the formulation.
  • immunogenic compositions further comprising a non-ionic tonicity agent.
  • a non-ionic tonicity agent for use in an immunogenic composition will itself need to be pharmaceutically acceptable, e.g. suitable for use in humans, as well as being compatible with the gp120 related antigen and further compatible with other components such as the immunostimulant(s).
  • suitable non-ionic tonicity agents are polyols, sugars (in particular sucrose, fructose, dextrose or glucose) or amino acids such as glycine.
  • the polyol is a sugar alcohol, especially a C3-6 sugar alcohol.
  • Exemplary sugar alcohols include glycerol, erythritol, threitol, arabitol, xylitol, ribitol, sorbitol, mannitol, dulcitol and iditol.
  • a suitable non-ionic tonicity agent is sorbitol.
  • an appropriate osmolality may be attained through the use of a mixture of different tonicity agents.
  • the non-ionic tonicity agent in the compositions of the invention incorporates sucrose and/or sorbitol.
  • a suitable concentration of polyol within the immunogenic composition is between about 2.5 and about 15% (w/v), in particular between about 2.5 and about 10% (w/v) for example between about 3 and about 7% (w/v), such as between about 4 and about 6% (w/v).
  • the polyol is sorbitol.
  • the immunogenic composition comprises sucrose and sorbitol.
  • the immunogenic composition may suitably contain between about 2.5 and about 15% (w/v) of sucrose and between about 2.5 and about 15% (w/v) of sorbitol, in particular between about 2.5 and about 10% (w/v) of sucrose and between about 2.5 and about 10% (w/v) of sorbitol, for example, between about 3 and about 7% (w/v) of sucrose and between about 3 and about 7% (w/v) of sorbitol, such as between about 4 and about 6% (w/v) of sucrose and between about 4 and about 6% (w/v) of sorbitol.
  • the pH of the immunogenic compositions should be suitable for parenteral administration. Typically the pH will be in the range of 6.0 to 9.0. Suitably the pH will be in the range 7.0 to 9.0, especially 7.25 to 8.75, such as 7.5 to 8.5, in particular pH 7.75 to 8.25. A pH of about 8.0 is of particular interest.
  • the pH may be controlled by the use of buffers, including for example Tris or phosphate buffers.
  • the conductivity of an immunogenic composition of the invention can be measured using techniques known in the art, for example using a dedicated conductivity meter or other instrument with the capability to measure conductivity.
  • One suitable instrument is the Zetasizer Nano ZS from Malvern Instruments (UK).
  • the skilled person can readily test for the concentration of both sodium (Na + ) and chloride (CI " ) ions using known techniques and kits.
  • sodium can be determined using a kit such as the Sodium Enzymatic Assay Kit (Catalogue Number: BQ01 1 EAEL) from Biosupply.
  • Chloride can be determined using a kit such as Chloride Enzymatic Assay Kit (Catalogue Number: BQ006EAEL) from Biosupply.
  • the immunogenic composition is suitably capable of inducing humoral response in a mammal, such as a human, administered with the immunogenic composition.
  • Humoral responses can be detected using an appropriate antibody-based assay.
  • an immunoglobulin G (IgG) antibody response to a gp120 related polypeptide can be analyzed using ELISA.
  • IgG antibodies suitably IgG antibodies binding the V1V2 region of gp120, indicates the immunogenicity of the immunogenic compositions of the invention.
  • the immunogenic composition is capable of inducing an improved CD4 T-cell immune response.
  • improved CD4 T-cell immune response is meant that a higher CD4 response is obtained in a mammal, such as a human, after administration of the adjuvanted immunogenic composition.
  • said 'improved CD4 T-cell immune response' is obtained in an immunologically unprimed patient, i.e. a patient who is seronegative to HIV.
  • the improved CD4 T-cell immune response (which may be provided by 'polyfunctional' T cells) may be assessed by measuring the number of cells producing any of the following immune markers:
  • CD4 T cells that express at least one immune marker
  • cells producing at least two different immune markers e.g. CD40L, IL-2 and/or IFN- gamma, TNF-alpha
  • immune markers e.g. CD40L, IL-2 and/or IFN- gamma, TNF-alpha
  • CD40L cells producing at least CD40L and another immune marker (e.g. IL-2, TNF-gamma, and/or IFN-gamma)
  • another immune marker e.g. IL-2, TNF-gamma, and/or IFN-gamma
  • IL-2 cells producing at least IL-2 and another immune marker (e.g. CD40L, TNF-alpha and/or IFN-gamma)
  • another immune marker e.g. CD40L, TNF-alpha and/or IFN-gamma
  • IFN-gamma cells producing at least IFN-gamma and another immune marker (e.g. IL-2, TNF-alpha and/or CD40L)
  • another immune marker e.g. IL-2, TNF-alpha and/or CD40L
  • ⁇ cells producing at least TNF-alpha and another immune marker e.g. IL-2, CD40L and/or IFN-gamma
  • CD4 T-cell immune response when cells producing any of the above immune markers are in a higher amount following administration. Typically at least one, suitably two of the six conditions mentioned herein above will be fulfilled. In a particular embodiment, the cells producing all four immune markers will be present at a higher amount.
  • the improved CD4 T-cell immune response conferred by the gp120 composition of the present invention may be ideally obtained after one single administration.
  • the administration of said immunogenic composition induces an improved B-memory cell response in a mammal, such as a human, administered with the immunogenic composition.
  • An improved B-memory cell response is intended to mean an increased frequency of peripheral blood B lymphocytes capable of differentiation into antibody- secreting plasma cells upon antigen encounter as measured by stimulation of in-vitro differentiation.
  • the administration of said immunogenic composition induces at least two of the following responses: (i) an improved CD4 T-cell immune response, (ii) an improved B-memory cell response, (iii) an improved humoral response, against at least one of the component antigen(s) or antigenic composition compared to either immune response obtained with other compositions.
  • the magnitude of an immune response can also be expressed as the titre (or concentration) of antigen-specific antibodies induced by the immunogenic composition as determined by an appropriate serological test.
  • the magnitude of a T cell response can be expressed as the frequency (or number) of antigen-specific cells induced by the immunogenic composition among the total population of T cells, which can be monitored by cytokine production.
  • composition of the present invention elicits an immune response capable of cross- reactivity.
  • Cross-reactivity is herein taken to mean the ability of immune responses induced by an immunogenic composition of the invention to recognize strains of HIV-1 from subtypes that are not represented in the immunogenic composition.
  • an immunogenic composition of the invention comprising a gp120 related polypeptide comprising from a strain of HIV-1 from subtype B is considered cross-reactive if the HIV-specific immune response, such as HIV-specific antibody or CD4+ T cell response (in particular an antibody response to the V1V2 loop of gp120), induced by the composition reacted with one or more different strains of HIV-1 not in the composition, for example, with a strain of HIV-1 from a subtype other than subtype B.
  • cross-reactivity will be in respect of an HIV-1 strain from a different sub-type, in particular in respect of an HIV-1 strain from a different group.
  • the level of cross-reactivity observed is up to 10%, up to 15%, up to 20%, up to 25%, up to 30%, up to 35%, up to 40%, up to 45%, up to 50%, up to 55%, up to 60%, up to 65% up to 70%, up to 80%, up to 90% or up to 100% of antigen-specific cells induced by the immunogenic composition among the total population of T cells or titre (or concentration) of antigen-specific antibodies induced by the immunogenic composition.
  • a responder can respond to one or more epitopes on an antigen.
  • a responder can also respond to one or more polypeptides in an immunogenic composition of the invention and/or to one or more antigens in an immunogenic composition of the invention.
  • Immunological assays such as serological tests that can be used to analyse the percentage of responders or the magnitude of an immune response are known in the art. Examples of such assays are known to a person skilled in the art.
  • the level of cross-reactivity observed is up to 10%, up to 15%, up to 20%, up to 25%, up to 30%, up to 35%, up to 40%, up to 45%, up to 50%, up to 55%, up to 60%, up to 65% up to 70%, up to 80%, up to 90% or up to 100% of subjects in a sample are responders.
  • the immunogenic composition of the invention is for use in eliciting high and long-lasting numbers of HIV-1-specific antibodies in an individual not infected with HIV. In a further embodiment, the immunogenic composition of the invention is for use in eliciting high and long-lasting numbers of HIV-1-specific antibodies in an individual at risk of infection with an HIV-1 strain from one or more clades different from the one or more HIV-1 clades from which the gp120 related polypeptide in the immunogenic composition is derived. In an embodiment, the immunogenic composition of the invention is for use in controlling or reducing viremia in an individual infected with HIV.
  • the viral load of the subject remains below 100,000 copies/ml for at least four months after administration.
  • the viral load of the subject remains below 100,000 copies/ml of serum for at least six months, at least twelve months, at least eighteen months, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years.
  • the subject maintains a viral load below 50,000 copies/ml, below 10,000 copies/ml, below 5000 copies/ml, below 1000 copies/ml, or below 500 copies/ml.
  • viral load is maintained or reduced for at least six months, at least twelve months, at least eighteen months, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years after administration of the composition.
  • administration of the inventive composition results in a durable response.
  • a durable response is for example the ability to detect, in the serum of an individual, IgG antibody capable of binding to the V1V2 region of the gp120 related polypeptide of the composition at least 24 weeks, at least 48 weeks, at least 72 weeks, at least 96 weeks, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years after the only administration of the composition, or the first administration of the composition in a course of repeat administrations, to the individual.
  • antibody levels will be detected at a level of at least 5%, more suitably at least 10% and in particular at least 20% of the serum titre two weeks following the first administration.
  • the antibody will be detectable in at least 50% of individuals, more suitably at least 60% of individuals and in particular at least 75%.
  • a durable response is for example the ability to detect, in the serum of an individual, IgG antibody binding the V1V2 region of the gp120 related polypeptide of the composition at least 2 weeks, at least 6 months, at least 12 months, at least 18 months, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years after the final administration of the composition in a course of repeat administrations to the individual.
  • antibody levels will be detected at a level of at least 5%, more suitably at least 10% and in particular at least 20% of the serum titre two weeks following the final administration.
  • the antibody will be detectable in at least 50% of individuals, more suitably at least 60% of individuals and in particular at least 75%.
  • the present invention is capable of achieving a more durable immune response based on responder rates.
  • up to 10%, up to 15%, up to 20%, up to 25%, up to 30%, up to 35%, up to 40%, up to 45%, up to 50%, up to 55%, up to 60%, up to 65% up to 70%, up to 80%, up to 90% or up to 100% of vaccinated individuals mount an increased humoral response such as an increased serum level of IgG antibody binding the V1V2 region of the gp120 related polypeptide of the composition.
  • the immunogenic compositions of the invention may be administered by any suitable delivery route, such as intradermal, mucosal e.g. intranasal, oral, intramuscular or subcutaneous. Other delivery routes are well known in the art.
  • the intramuscular delivery route is preferred for the immunogenic composition.
  • Intradermal delivery is another suitable route. Any suitable device may be used for intradermal delivery, for example short needle devices such as those described in US4886499.
  • Intradermal vaccines may also be administered by devices which limit the effective penetration length of a needle into the skin.
  • jet injection devices which deliver liquid vaccines to the dermis via a liquid jet injector or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis.
  • Jet injection devices are described for example in US5480381 . Also suitable are ballistic powder/particle delivery devices which use compressed gas to accelerate vaccine in powder form through the outer layers of the skin to the dermis. Additionally, conventional syringes may be used in the classical mantoux method of intradermal administration.
  • Another suitable administration route is the subcutaneous route.
  • Any suitable device may be used for subcutaneous delivery, for example classical needle.
  • a needle-free jet injector service is used, such as that published in US6623446. More suitably said device is pre-filled with the liquid vaccine formulation.
  • the vaccine is administered intranasally.
  • the vaccine is administered locally to the nasopharyngeal area, suitably without being inhaled into the lungs. It is desirable to use an intranasal delivery device which delivers the vaccine formulation to the nasopharyngeal area, without or substantially without it entering the lungs.
  • the immunogenic composition may be given intramuscularly for the first administration, and a boosting composition may be administered through a different route, for example intradermal, subcutaneous or intranasal.
  • a schedule for vaccination with the immunogenic composition may comprise the sequential ("prime-boost"), concomitant or simultaneous administration of the immunogenic composition and DNA encoding any of the above-mentioned proteins.
  • the schedule for vaccination with the immunogenic composition consists of three to five (for example four) administrations of the immunogenic composition to an individual over a period of four to eight (for example five to seven) months.
  • the schedule for vaccination with the immunogenic composition consists of four administrations of the immunogenic composition to an individual over a period of five to seven months.
  • the gp120 related polypeptide of the invention may be substituted by a polynucleotide encoding the gp120 related polypeptide of the invention.
  • the polypeptide is codon- optimised.
  • the DNA may be delivered as plasmid DNA or in the form of a recombinant live vector, e.g. a poxvirus vector or any other suitable live vector such as retrovirus, lentivirus, adenovirus, adeno-associated virus and modified vaccinia ankara (MVA) virus.
  • a recombinant live vector e.g. a poxvirus vector or any other suitable live vector such as retrovirus, lentivirus, adenovirus, adeno-associated virus and modified vaccinia ankara (MVA) virus.
  • an adenovirus is used.
  • a canary pox virus may be used.
  • the immunogenic composition may be injected once or several times followed by one or more DNA administrations. DNA may be used first for one or more administrations followed by one or more immunisations with the immunogenic composition. Alternatively, the immunogenic composition may be injected once or several times in conjunction with DNA administrations
  • HIV is a retrovirus.
  • the conversion of its RNA to DNA is accomplished through the action of the enzyme reverse transcriptase.
  • Compounds that inhibit the function of reverse transcriptase inhibit replication of HIV in infected cells. Drugs incorporating such compounds are useful in the prevention or treatment of HIV infection in humans and may be utilised in conjunction with a composition of the present invention.
  • composition of the present invention may be administered in conjunction with (i.e. before, during or after administration of) antiretroviral therapy (ART) such as nucleoside or non- nucleoside reverse transcriptase inhibitors, protease inhibitors, fusion inhibitors, entry inhibitors, maturation inhibitors, cellular inhibitors and integrase strand transfer inhibitors.
  • ART antiretroviral therapy
  • Antiretroviral drugs include lamivudine and zidovudine, emtricitabine (FTC), zidovudine (ZDV), azidothymidine (AZT), lamivudine (3TC), zalcitabine, dideoxycytidine (ddC), tenofovir disoproxil fumarate (TDF), didanosine (ddl), stavudine (d4T), abacavir sulfate (ABC), etravirine, delavirdine (DLV), efavirenz (EFV), nevirapine (NVP), amprenavir (APV), tipranavir (TPV), indinavir (IDV), saquinavir, saquinavir mesylate (SQV), lopinavir (LPV), ritonavir (RTV), fosamprenavir calcium (FOS-APV), ritonavir, RTV, dar
  • ART drugs can also include antibodies, such as ibalizumab, targeting HIV proteins or cellular proteins associated with disease progression. Also included are immune-based therapies, such as IL-2, IL-12 and alpha-epibromide. Each of these drugs can be administered alone or in combination with any other ART drug.
  • ART drugs and their administration can be found many pharmacopeia, such as the United States Pharmacopeia (USP) or accessed online, such as at www.aidsmeds.com (accessed 5 September 2013)
  • commercial names of these drugs and combinations of these drugs include Atripla (efavirenz, emtricitabine and tenofovir disoproxil fumarate), Complera (emtricitabine, rilpivirine, and tenofovir disoproxil fumarate), Stribild (elvitegravir, cobicistat, emtricitabine, tenofovir disoproxil fumarate), Combivir (lamivudine and zidovudine), Emtriva (emtricitabine, FTC), Epivir (lamivudine, 3TC), Epzicom (abacavir and lamivudine), Hivid (zalcitabine, dideoxycytidine, ddC), Retrovir (zidovudin
  • the immunogenic composition is administered to a patient who is also taking antiretrovirals. In a further embodiment, the immunogenic composition is administered to a patient who has previously taken antiretrovirals. In a further embodiment, the immunogenic composition is administered to a patient who is not taking and has not previously taken antiretrovirals.
  • the immunogenic composition is administered to a patient having a CD4 count of 200 or more, suitably 500 or more, most suitably between 500-1700 cells per cubic millimetre of blood. In a further embodiment, the immunogenic composition is administered to a patient having a nadir CD4 count of 200 or more, more suitably 500 or more cells per cubic millimetre of blood.
  • the immunogenic composition is administered to a subject, such as a human, who is not infected with HIV. In one embodiment the immunogenic composition is administered to a subject, such as a human, who is infected with HIV.
  • a gp120 related protein for use in the manufacture of an immunogenic composition as described herein. Such as for the prophylaxis of HIV infection. Alternatively, the composition may be intended for the treatment of HIV infection.
  • a method for the prophylaxis of HIV infection by administration of an immunogenic composition as described herein to a mammal, such as a human. Such administration may reduce the risk of HIV infection and/or the severity of HIV infection.
  • immunogenic composition as described herein for use in the prophylaxis of HIV infection.
  • An immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome and wherein the composition is substantially free of a NefTat related polypeptide wherein the NefTat related polypeptide is a polypeptide consisting of SEQ ID NO: 4.
  • An immunogenic composition which is in the form of a human dose comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises between 10-40ug of a lipopolysaccharide and between 10-40ug of an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
  • An immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome wherein:
  • the conductivity of the composition is 13 mS/cm or lower;
  • the concentration of salts in said composition is 130 mM or lower;
  • Clause 8 The immunogenic composition according to any one of clause 1 or 4 to 7 wherein the NefTat related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 4.
  • Clause H The immunogenic composition according to clause 10 wherein the NefTat related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 4.
  • Clause 15 The immunogenic composition according to any one of clauses 1 , 4 or 12 to 14 wherein the Nef related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 2.
  • Clause 16 The immunogenic composition according to clause 15 wherein the Nef related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 2.
  • Clause 18 The immunogenic composition according to clause 17 wherein the Nef related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 2.
  • Clause 19 The immunogenic composition according to either clause 1 or 4, which contains a ratio of Tat related polypeptide:gp120 related polypeptide of less than 1 :20.
  • Clause 22 The immunogenic composition according to any one of clauses 1 , 4 or 19 to 21 wherein the Tat related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 3.
  • Clause 23 The immunogenic composition according to clause 22 wherein the Tat related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 3.
  • Clause 24 The immunogenic composition according to clause 23 wherein the Tat related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 3.
  • Clause 25 The immunogenic composition according to clause 24 wherein the Tat related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 3.
  • Clause 26 The immunogenic composition according to any one of clauses 1 or 3 to 25 wherein the lipopolysaccharide is present at a level of between 10-100ug.
  • Clause 27 The immunogenic composition according to clause 26 wherein the lipopolysaccharide is present at a level of between 15-80ug.
  • Clause 28 The immunogenic composition according to clause 27 wherein the lipopolysaccharide is present at a level of between 20-65ug.
  • Clause 32 The immunogenic composition according to any one of clauses 1 or 3 to 31 wherein the saponin is present at a level of between 10-100ug.
  • Clause 36 The immunogenic composition according to clause 35 wherein the saponin is present at a level of between 45-55ug.
  • Clause 37 The immunogenic composition according to clause 36 wherein the saponin is present at a level of 50ug.
  • Clause 41 The immunogenic composition according to any one of clauses 1 to 31 wherein the saponin is present at a level of between 15-35ug.
  • Clause 44 The immunogenic composition according to any one of clauses 1 to 43 wherein the lipopolysaccharide is 3D-MPL.
  • Clause 45 The immunogenic composition according to any one of clauses 1 to 44 wherein the saponin is QS-21.
  • the conductivity of the composition is 13 mS/cm or lower;
  • the concentration of salts in said composition is 130 mM or lower;
  • the concentration of sodium chloride in said composition is 130 mM or lower.
  • Clause 47 The immunogenic composition according to clause 46 wherein the conductivity of the composition is 13 mS/cm or lower.
  • Clause 48 The immunogenic composition according to clause 47 wherein the conductivity of the composition is 6 mS/cm or lower.
  • Clause 50 The immunogenic composition according to clause 46 wherein the concentration of salts in said composition is 130 mM or lower.
  • Clause 51 The immunogenic composition according to clause 50 wherein the concentration of salts in said composition is 60 mM or lower.
  • Clause 52 The immunogenic composition according to clause 51 wherein the concentration of salts in said composition is 20 to 40 mM.
  • Clause 53 The immunogenic composition according to clause 46 wherein the concentration of sodium chloride in said composition is 130 mM or lower.
  • Clause 54 The immunogenic composition according to clause 53 wherein the concentration of sodium chloride in said composition is 60 mM or lower.
  • Clause 55 The immunogenic composition according to clause 54 wherein the concentration of sodium chloride in said composition is 10 mM or lower.
  • Clause 56 The immunogenic composition according any one of clauses 1 to 55, wherein the concentration of CaCI 2 in the immunogenic composition is 30 mM or lower.
  • Clause 57 The immunogenic composition according any one of clauses 1 to 56, wherein the concentration of MgS0 4 in the immunogenic composition is 60 mM or lower.
  • Clause 58 The immunogenic composition according any one of clauses 1 to 57, total concentration of NH 4 + , Mg 2+ and Ca 2+ ions is 40 mM or lower.
  • Clause 60 The immunogenic composition according to any one of clauses 1 to 59 which is a single human dose.
  • Clause 61. The immunogenic composition according to any one of clauses 1 to 60 wherein the human dose is between 0.1 and 1 ml.
  • Clause 62 The immunogenic composition according to clause 61 wherein the human dose is between 0.3 and 0.75ml.
  • Clause 64 The immunogenic composition according to any one of clauses 1 to 60 wherein the human dose is between 0.05 and 0.2ml.
  • Clause 65 The immunogenic composition according to any one of clauses 1 to 64 wherein the osmolality is in the range of 250 to 750 mOsm/kg.
  • Clause 66 The immunogenic composition according to clause 65 wherein the osmolality is in the range of 250 to 550 mOsm/kg.
  • Clause 67 The immunogenic composition according to any one of clauses 1 to 66, comprising a non-ionic tonicity agent.
  • Clause 68 The immunogenic composition according to clause 67, wherein the non-ionic tonicity agent is a polyol.
  • Clause 70 The immunogenic composition according to clause 69, wherein the concentration of sorbitol is between about 4 and about 6% (w/v).
  • Clause 71 The immunogenic composition according to any one of clauses 1 to 70, wherein the concentration of sucrose is between about 4 and about 6% (w/v).
  • Clause 72 The immunogenic composition according to any one of clauses 1 to 71 wherein the pH is in the range of 6.0 to 9.0.
  • Clause 73 The immunogenic composition according to any one of clauses 1 to 72 wherein the composition comprises the gp120 related polypeptide at a level of around 1 to 100 ug.
  • Clause 74 The immunogenic composition according to clause 73 wherein the composition comprises the gp120 related polypeptide at a level of 3 to 30 ug.
  • Clause 75 The immunogenic composition according to clause 74 wherein the composition comprises the gp120 related polypeptide at a level of 5 to 15 ug.
  • Clause 76 The immunogenic composition according to clause 74 wherein the composition comprises the gp120 related polypeptide at a level of 16 to 25 ug.
  • Clause 77 The immunogenic composition according to any one of clauses 1 to 76 wherein the composition comprises 1 -5 additional HIV antigens.
  • Clause 78 The immunogenic composition according to clause 77 wherein the composition comprises additional HIV antigens selected from the list consisting of gp160, gp41 , MA, CA, SP1 , NC, SP2, P6, RT, RNase H, IN, PR, Rev, Vif, Vpr and Vpu.
  • Clause 79 The immunogenic composition according to any one of clauses 1 to 78 wherein the composition comprises a total of around 1 to 500 ug of antigenic material.
  • Clause 80 The composition according to any one of clauses 1 to 79 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1.
  • Clause 81 The composition according to clause 80 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1 group M.
  • Clause 82 The composition according to clause 81 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1 group M subtype C.
  • composition according to clause 82 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1 group M subtype B.
  • Clause 84 The composition according to any one of clauses 1 to 81 and 83 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 1.
  • composition according to clause 84 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 1.
  • Clause 86 The composition according to clause 85 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 1.
  • Clause 87 The composition according to clause 86 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 1.
  • Clause 88 The composition according to clause 87 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 1.
  • composition according to clause 88 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 1.
  • composition according to clause 89 wherein the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 1.
  • Clause 91 The composition according to any one of clauses 1 to 81 and 83 to 90 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with the V1 V2 region of SEQ ID NO: 1 .
  • Clause 92 The composition according to clause 91 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 1.
  • Clause 93 The composition according to clause 92 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 1.
  • Clause 94 The composition according to clause 93 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 1.
  • composition according to clause 94 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 1.
  • Clause 96 The composition according to clause 95 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 1.
  • Clause 97 The composition according to clause 96 wherein the gp120 related polypeptide consists of the V1V2 region of SEQ ID NO: 1.
  • Clause 98 The composition according to any one of clauses 1 to 81 and 83 to 97 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 1.
  • composition according to clause 98 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 1.
  • composition according to clause 99 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 1.
  • Clause 101 The composition according to clause 100 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with SEQ ID NO: 1.
  • Clause 102 The composition according to clause 101 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with SEQ ID NO: 1.
  • Clause 103 The composition according to clause 102 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 1.
  • Clause 104 The composition according to clause 103 wherein the gp120 related polypeptide comprises SEQ ID NO: 1.
  • Clause 105 The composition according to any one of clauses 1 to 81 and 83 to 104 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with SEQ ID NO: 1.
  • Clause 106 The composition according to clause 105 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with SEQ ID NO: 1.
  • Clause 107 The composition according to clause 106 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with SEQ ID NO: 1.
  • Clause 108 The composition according to clause 107 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with SEQ ID NO: 1.
  • Clause 109 The composition according to clause 108 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with SEQ ID NO: 1.
  • Clause 1 10. The composition according to clause 109 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with SEQ ID NO: 1.
  • Clause 1 1 1 .
  • the composition according to clause 1 10 wherein the gp120 related polypeptide consists of SEQ ID NO: 1 .
  • Clause 1 12. The composition according to any one of clauses 1 to 82 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 1 13 The composition according to clause 1 12 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 1 14 The composition according to clause 1 13 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 1 15 The composition according to clause 1 14 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 1 16 The composition according to clause 1 15 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 1 17 The composition according to clause 1 16 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 1 18 The composition according to clause 1 17 wherein the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 5.
  • Clause 1 19 The composition according to any one of clauses 1 to 82 and 1 12 to 1 18 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 120. The composition according to clause 1 19 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 121 The composition according to clause 120 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 122 The composition according to clause 121 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 123 The composition according to clause 122 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 124 The composition according to clause 123 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 5.
  • Clause 125 The composition according to clause 124 wherein the gp120 related polypeptide consists of the V1V2 region of SEQ ID NO: 5.
  • Clause 126 The composition according to any one of clauses 1 to 82 and 1 12 to 125 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 5.
  • Clause 127 The composition according to clause 126 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 5.
  • Clause 128 The composition according to clause 127 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 5.
  • Clause 129 The composition according to clause 128 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with SEQ ID NO: 5.
  • Clause 130 The composition according to clause 129 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with SEQ ID NO: 5.
  • Clause 131 The composition according to clause 130 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 5.
  • Clause 132 The composition according to clause 131 wherein the gp120 related polypeptide comprises SEQ ID NO: 5.
  • Clause 133 The composition according to any one of clauses 1 to 82 and 1 12 to 132 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with SEQ ID NO: 5.
  • Clause 134 The composition according to clause 133 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with SEQ ID NO: 5.
  • Clause 135. The composition according to clause 134 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with SEQ ID NO: 5.
  • Clause 136 The composition according to clause 135 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with SEQ ID NO: 5.
  • Clause 137 The composition according to clause 136 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with SEQ ID NO: 5.
  • Clause 138 The composition according to clause 137 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with SEQ ID NO: 5.
  • Clause 139 The composition according to clause 138 wherein the gp120 related polypeptide consists of SEQ ID NO: 5.
  • Clause 140 The immunogenic composition according to any one of clauses 1 to 139 wherein the composition further comprises a sterol, wherein the ratio of saponin:sterol is from 1 :1 to 1 :100 w/w.
  • Clause 141 The immunogenic composition according to clause 140 wherein the ratio of saponin:sterol is from 1 :1 to 1 :5 w/w.
  • Clause 144 The immunogenic composition according to any one of clauses 1 to 143, which is provided in presentation containing an overage of 1-50% to allow for wastage during administration.
  • Clause 145 The immunogenic composition according to any one of clauses 1 to 144, for use as a medicament.
  • Clause 146 The immunogenic composition according to clause 145, for use in the treatment or prevention of HIV-1 from group M, N, O or P.
  • gp120 related polypeptide is derived from a first HIV-1 subtype, for use in the treatment or prevention of HIV-1 infection by a second HIV-1 subtype.
  • the gp120 related polypeptide is derived from a first HIV-1 subtype, for use in the treatment or prevention of HIV-1 infection by a second HIV-1 subtype, wherein the first and second HIV-1 subtypes have different native gp120 polypeptide sequences.
  • Clause 150 The immunogenic composition according to clause 149, wherein the first HIV-1 subtype is selected from the list consisting of A, B, C, D, E, F, G, H, I, J or K; of HIV-1 group M.
  • Clause 151 The immunogenic composition of any one of clauses 1 to 150 for use in
  • Clause 152 The immunogenic composition according to any one of clauses 1 to 151 for use in eliciting antibodies against the V1 V2 loop of HIV-1 gp120.
  • Clause 153 A method of treatment or prophylaxis of HIV-1 infection comprising the step of administering a composition according to any one of clauses 1 to 152 to an individual.
  • Clause 155 The method of treatment or prophylaxis of HIV-1 infection according to either clause 153 or 154 wherein IgG antibody capable of binding to the V1V2 region of the gp120 related polypeptide of the composition is detectable in the serum of an individual at least 24 weeks after the only administration of the composition or the first administration of the composition in a course of repeat administrations to the individual.
  • the IgG antibody is detectable at least 48 weeks after the only administration of the composition or the first administration of the composition in a course of repeat administrations to the individual.
  • the IgG antibody is detectable at least 72 weeks after the only administration of the composition or the first administration of the composition in a course of repeat administrations to the individual.
  • the IgG antibody is detectable at least 6 months after the final administration of the composition in a course of repeat administrations to the individual.
  • the IgG antibody is detectable at least 12 months after the final administration of the composition in a course of repeat administrations to the individual.
  • the IgG antibody is detectable at least 18 months after the final administration of the composition in a course of repeat administrations to the individual.
  • Clause 163 The method of treatment or prophylaxis of HIV-1 infection according to any one of clauses 155 to 158 wherein antibody levels are detectable at at least 5% of the serum titre two weeks following the only administration.
  • Clause 164 The method of treatment or prophylaxis of HIV-1 infection according to any one of clauses 155 to 162 wherein antibody levels are detectable at at least 5% of the serum titre two weeks following the first administration.
  • Clause 165 The method of treatment or prophylaxis of HIV-1 infection according to any one of clauses 159 to 162 wherein antibody levels are detectable at at least 5% of the serum titre two weeks following the final administration.
  • Clause 166 The method of treatment or prophylaxis according to any one of clauses 155 to
  • the antibody will be detectable in at least 50% of individuals administered with the composition.
  • Clause 167 The method of treatment or prophylaxis according to clause 166 wherein the antibody will be detectable in at least 80% of individuals administered with the composition.
  • Clause 168 The method of treatment or prophylaxis according to any one of clauses 153 to
  • Clause 170 A method of reducing the risk of HIV transmission from an HIV-infected individual to a partner of said HIV-infected individual comprising the step of administering the immunogenic composition of any one of clauses 1 to 152 to the HIV-infected individual.
  • Clause 171 A method of making the composition according to any one of clauses 1 to 152, comprising adding a gp120 derived polypeptide to a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
  • Clause 172 A kit for making an immunogenic composition according to any one of clauses 1 to 152, comprising a first container and a second container, wherein the first container comprises a gp120 derived polypeptide and the second container comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
  • Clause 173 The kit according to clause 172, wherein the second container comprises an aqueous solution.
  • a viral vector comprising a polynucleotide encoding a polypeptide comprising the gp120 W 6iD polypeptide of SEQ ID No: 1.
  • Clause 175. The viral vector of clause 174 comprising a polynucleotide encoding a polypeptide consisting of the gp120 W 6iD polypeptide of SEQ ID No: 1.
  • a viral vector comprising a polynucleotide encoding a polypeptide comprising the gp120 Z Mi8 polypeptide of SEQ ID NO: 5.
  • Clause 177 The viral vector of clause 176 comprising a polynucleotide encoding a polypeptide consisting of the gp120 Z Mis polypeptide of SEQ ID NO: 5.
  • Clause 178 The viral vector of any one of clauses 174 to 177 which is an adenovirus, canary pox virus or MVA virus.
  • a first composition containing 2ug gp120 W 6iD and 50ul AS01 B and a second composition containing 2ug gp120 W 6iD > 50ul AS01 B and 2ug NefTat were prepared.
  • the first composition was administered intramuscularly (I M) to a first group of 25 CB6F1 mice and at the same three timepoints the second composition was administered IM to a second group of 25 CB6F1 mice.
  • the titre of anti-V1V2 antibodies in the sera of the mice in each group was compared at 14 days after the second administration and at 14 days after the third administration.
  • the HIV-1 subtype B case A2 gp120 V1V2 region scaffolded onto a murine gp70 protein was used in an Igtot ELISA binding antibody assay.
  • the CH58 the anti-V2 monoclonal antibody used in the RV144 trial
  • gp70 protein (not bound to a V1V2 region) was used as a negative control to assess specificity during development of the assay.
  • Example 2 PRO HIV-002 and RV144 trial analysis - anti-V1V2 IgG comparison
  • Anti-V1V2 IgG comparison Method Serum samples were obtained from 30 subjects from the PRO-HIV-002 trial who had been vaccinated with 20ug gp120 W 6iD, 20ug NefTat and AS01 B (liposome-based, 50ug MPL and 50ug QS-21 ) at 0, 1 , 3 and 6 months, according to the trial protocol. The serum had been collected at 9 different timepoints. These timepoints were baseline (the first of the four vaccinations, day 0), day 42 (2 weeks after the second vaccination), day 84, day 98 (2 weeks after the third vaccination), day 168, day 182 (2 weeks after the fourth vaccination), day 336, day 504 and day 672 (18 months after the fourth vaccination).
  • the HIV-1 subtype B case A2 gp120 V1V2 region scaffolded onto a murine gp70 protein was used in an IgG multiplex binding antibody assay, alongside a gp70 control and ConSgp140 (group M consensus gp140).
  • CH58 the anti-V2 monoclonal antibody used in the RV144 trial
  • Samples were run at a dilution of 1 :100.
  • the levels of anti-V1V2 clade B antibodies in the serum samples from the 30 subjects of the PRO-HIV-002 trial were compared to those of 205 vaccinees in the case-control group who remained uninfected in the RV144 trial.
  • the serum samples from the PRO-HIV-002 trial subjects contained a higher level of anti-V1V2 clade B antibodies than the serum samples from the RV144 trial subjects at 2 weeks after the last vaccination in both trials (see Figure 2).
  • the serum samples from the PRO-HIV-002 trial subjects showed a 100% response rate (average: 80.7ug/ml, median 62.2 ug/ml) compared to serum samples from the RV144 trial subjects showing a 64% response rate (average: 4.2 ug/ml, median 1.6 ug/ml).
  • the serum samples from the PRO-HIV-002 trial subjects all contained anti-V1V2 antibodies after the third injection of gp120/NefTat/AS01 B (see Figure 3).
  • the serum samples from the PRO-HIV-002 trial subjects had a different reactivity profile against varying subtypes of HIV-1 compared to serum samples from the RV144 trial subjects 2 weeks after the last vaccination in both trials (see Figure 4).
  • Native gp120 Z Mis polypeptide sequence contains underlined proline instead of threonine.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • Virology (AREA)
  • Veterinary Medicine (AREA)
  • Chemical & Material Sciences (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Molecular Biology (AREA)
  • AIDS & HIV (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

The present invention relates to particular immunogenic compositions comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a saponin and a lipopolysaccharide. Such compositions are substantially free of a NefTat related polypeptide, comprise between 10-40ug of a lipopolysaccharide and between 10-40ug of an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome or have a concentration of sodium chloride of 130 mM or lower.

Description

Novel compositions
FIELD OF THE INVENTION The present invention relates to particular immunogenic compositions comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a saponin and a lipopolysaccharide. Methods for the preparation of such immunogenic compositions and related kits are also provided. BACKGROUND OF THE INVENTION
HIV is the primary cause of acquired immune deficiency syndrome (AIDS) which is regarded as one of the world's major health problems. There were approximately 34 million people living with HIV in 201 1 (WHO HIV/AIDS Fact sheet number 360, June 2013) and over 4 million new infections are occurring every year. HIV has claimed more than 25 million lives over the past three decades. Although antiretroviral therapy is prolonging the lives of many people infected with HIV, to be effective antiretroviral therapy requires strict adherence to often complex multidrug administration regimes and does not cure the infection. New infections are greatly exceeding the number of people able to be treated through current global financial efforts. There is a need for a vaccine to prevent new infections but the development of a safe and effective HIV vaccine poses a significant challenge.
Two types of HIV have been characterized: HIV-1 and HIV-2. HIV-1 is highly virulent and infective and is the cause of the majority of HIV infections globally, whilst HIV-2 has a lower virulence and infectivity and is largely confined to West Africa (Gilbert et al., Stat In Med 22(4):573-593 (2003) and Reeves and Doms J Gen Vir 83:1253-1265 (2002)). There are many genetically distinct subtypes (also known as 'clades') of HIV-1 and the amino acid sequences of just the envelope glycoproteins (gp120 and gp41 ) can vary from 25-30% between subtypes (Kalish et al., AIDS 9:851 -857 (1995)). The genetic diversity of HIV-1 along with the high mutation rate are major obstacles for HIV-1 vaccine development.
Although extensive research throughout the world has been conducted to produce a vaccine, much work is still required. The HIV envelope glycoprotein gp120 and other HIV-1 proteins gp120 is the viral protein that is used for attachment to a host cell. This attachment is mediated by gp120 binding surface molecules of helper T cells and macrophages including one of the two chemokine receptors CCR-5 or CXCR-4. The gp120 protein is first expressed as a larger precursor molecule (gp160), which is then cleaved post-translationally to yield gp120 and gp41. The gp120 protein is retained on the surface of the virion, non-covalently associated with the gp41 molecule, which is inserted into the viral membrane. Three non- covalently associated envelope glycoprotein gp120 and gp41 heterodimers form the trimeric Env spike found on the surface of HIV-1.
Non-envelope proteins of HIV-1 have been described and include for example internal structural proteins such as other products of the Env gene (such as gp160 and gp41 ) the products of the gag and pol genes (such as MA, CA, SP1 , NC, SP2 and P6; and RT, RNase H, IN and PR, respectively) and other non-structural proteins such as Rev, Nef, Vif, Vpr, Vpu and Tat (Greene et al., New Eng J Med, 324, 5, 308 et seq (1991 ) and Bryant et al. (Ed. Pizzo), Pediatr Infect Dis J, 1 1 , 5, 390 et seq (1992)).
Previous work in the field gp120 was among the first targets of HIV vaccine research and was considered to be useful as an antigenic component in vaccines intended to elicit cell-mediated immune responses. The gp120 protein contains epitopes that are recognized by cytotoxic T lymphocytes (CTL). These effector cells are able to eliminate virus-infected cells, and therefore constitute an antiviral immune mechanism. Some CTL epitopes appear to be relatively conserved among different HIV strains. However, current CTL-based vaccines do not protect against infection in animal models of HIV (Amara et al., Science 292(5514):69-74 (2001 )). Furthermore, CTL-based vaccines studied to date in humans have not induced these intended responses in all recipients (Goepfert et al., J Infect Dis 192(7): 1249-1259 (2005)). Such CTL-based vaccines were not able to protect against infection, nor impact viral load post infection (the "HVTN-505 study").
The gp120 protein is a major target of neutralising antibodies (Pantophlet et al., Annu Rev Immunol 24:739-769 (2006)) and neutralising antibodies were previously thought to be a potential correlate of protection (Bruck et al., Vaccine 12(12):1 141-1 148 (1994) and Plotkin, Pediatr Infect Dis J 20:63-75 (2001 )). One region of the gp120 protein in particular, the V3 loop', is targeted by neutralising antibodies. Antibodies present in immune sera of infected individuals bind to V3 loop peptides (Spenlehauer et al., J Vir, 72(12):98559864 (1998)). Accordingly, much research was focussed on the V3 loop of the gp120 protein. However, the V3 loop is unfortunately highly variable and highly strain specific (Vaine et al., PLoS One, 5(1 1 ):e13916, (2010), Jones et al., J Infect Dis, 179:558-566 (1999) and McCormack et al., Vaccine 18(13): 1 166-1 177 (2000)).
It has been shown that vaccination with gp120 will not always induce neutralising antibodies against HIV and SHIV, and when neutralising antibodies are induced, these antibodies rarely confer protection against divergent viruses (Voss et al., J Vir 77(2): 1049-1058 (2003), Plotkin, Pediatr Infect Dis J 20:63-75 (2001 ), Wren and Kent, Hum Vacc 7(4):466-473 (201 1 )).
Use of recombinant HIV-1 NefTat, gp120W6iD and SIV Nef proteins formulated with the AS02A adjuvant system (50ug of QS-21 and 50ug of 3D-MPL in an oil-in-water emulsion) was shown to protect against AIDS in a rhesus macaque SHIV animal model system when animals were challenged with SIV/HIV strain SHIV89.6p- However, HIV-1 gp120W6iD formulated alone with AS02A did not provide protection. The lack of protection after immunisation with gp120W6iD formulated alone with AS02A was suggested to be related to the heterologous nature of the challenge virus (20.2% sequence difference for gp120), since HIV-1 gp120W6iD formulated in AS02A had previously been shown to induce sterile immunity against homologous SHIVW61D challenge (Voss et al., J Virol 77(2): 1049-1058 (2003) and Mooij et al., AIDS 12:F15-F22 (1998)). NefTat and gp120W6iD formulated in AS02A has been administered to HIV seronegative individuals in a safety and immunogenicity study. However, the neutralising antibodies elicited by this vaccine had poor cross-subtype reactivity (Leroux-Roels et al., Vaccine 28:7016-7024 (2010) - the "PRO HIV-002 trial"). Furthermore, gp120 had a negative impact on antibody and T cell responses (geometric mean antibody titre and lymphocyte proliferation) when comparing administration of NefTat and gp120 versus NefTat alone (Goepfert et al., Vaccine 25:510-518 (2007) - the "HVTN-041 " study). Accordingly, it was found that (i) a vaccine comprising gp120 with an adjuvant comprising QS-21 and 3D-MPL had poor cross-subtype reactivity and (ii) it appears that gp120 may have a detrimental impact on previously accepted potential markers of efficacy for HIV vaccines containing other antigens. In light of the findings illustrated above, the use of gp120 as a vaccine antigen to elicit humoral responses (particularly when administered with an adjuvant comprising QS-21 and 3D-MPL) was thought to be of limited use for a broadly protective vaccine and, consequently, interest in this protein has reduced.
The RV144 HIV-1 vaccine trial was the first to demonstrate evidence of protection against HIV- 1 infection, with an estimated vaccine efficacy of 31.2% (Rerks-Ngarm et al, N Engl J Med 361 :2209-2220 (2009)). The protocol consisted of four priming injections of ALVAC-HIV (vCP1521 ), and two booster injections of AIDSVAX B/E. ALVAC-HIV was administered at baseline (day 0), 4 weeks, 12 weeks and 24 weeks. AIDSVAX B/E was administered at weeks 12 and 24. ALVAC-HIV (vCP1521 ) is a recombinant canary pox viral vector containing gp120 from HIV-1 subtype E (CRF01_AE) strain 92TH023, linked to the transmembrane-anchoring portion of gp41 (carrying a deletion in the immunodominant region) from HIV-1 subtype B strain LAI . The vector also contained H IVLAI gag and pol genes. AI DSVAX B/E is a preparation of recombinant HIV-1 subtype B MN gp120, CM244 subtype E A244 gp120 and an alum adjuvant.
In order to identify correlates of risk of HIV-1 infection in RV144, plasma specimens from RV144 study participants were analysed (Haynes et al., N Engl J Med 366:1275-1286 (2012)). Assays were performed on samples, obtained two weeks after final immunisation, from 41 vaccinees who became infected and 205 uninfected vaccinees. These assays examined the roles of T-cell, IgG antibody and IgA antibody responses in the modulation of infection risk. It was found that levels of antibodies specific for gp70-V1V2 (a scaffolded protein carrying the first and second variable regions of HIV-1 gp120 fused to murine leukemia virus gp70 - see Pinter et al., Vaccine 16(19): 1803-181 1 (1998)) were correlated with a lower risk of infection and the binding of plasma IgA antibodies to envelope proteins correlated a higher risk of infection. Furthermore, since this analysis was performed, it has been found that V2 antibodies induced in the RV144 trial cross-react with multiple HIV-1 subtypes (Zolla-Pazner et al., PlosOne, 8(1 ):e53629 (2013)). Accordingly, for the above reasons, it was concluded that vaccines which induce higher levels of V1V2 antibodies may have improved efficacy against HIV-1 infection.
To produce an HIV vaccine, it is therefore highly desirable to identify a composition capable of eliciting a high level of antibodies specific for the V1 V2 region of gp120.
To summarise, previous work in the field has demonstrated that: • gp120 in AS02A adjuvant (QS-21 and 3D-MPL oil-in-water emulsion) did not provide protection against challenge with heterologous virus in a primate model,
• gp120 may have a detrimental impact on markers of vaccine efficacy and
• antibodies against the V1V2 region of gp120 are a correlate of HIV-1 protection.
Immunogenic compositions of the present invention may have one or more of the following advantages compared to compositions of the prior art:
(i) achieve a stronger humoral immune response, for example a higher serum titre of antibodies binding the V1V2 region of gp120,
(ii) achieve a stronger cellular immune response, for example proliferation of and cytokine release by polyfunctional T cells,
(iii) achieve a broader humoral immune response, for example a achieving a titre of antibodies binding the V1 V2 region of gp120 in a larger proportion of vacinees,
(iv) achieve a broader cellular immune response, for example proliferation of and cytokine release by polyfunctional T cells in a larger proportion of vacinees,
(v) achieve a stronger humoral immune response against a particular subtype of HIV-1 ,
(vi) achieve a stronger cellular immune response against a particular subtype of HIV-1 ,
(vii) require fewer components,
(viii) require non-live components,
(ix) involve a more simple dosage regime,
(x) be simpler to produce,
(xi) be more easily stored,
(xii) be of utility in the treatment or prevention of HIV-1 infection,
(xiii) be of utility in the treatment or prevention of HIV-1 infection by a first HIV-1 subtype when the gp120 related polypeptide of the composition is derived from a second HIV-1 subtype,
(xiv) achieve a more durable immune response, for example based on magnitude of response and/or responder rates,
(xv) achieve a greater reduction in viral load,
(xvi) induce a higher level of protection against infection.
SUMMARY OF THE INVENTION The present inventors administered compositions containing either (a) gp120W6iD and AS01 B or (b) gp120W6iD, AS01 B and NefTat to mice and analysed the serological response of the mice.
The present inventors found that, surprisingly, mice administered with gp120W6iD and AS01 B (without NefTat) had a higher mean level of anti-V1V2 antibodies in their serum compared to mice administered with gp120W6iD, AS01 B and NefTat. The present inventors analysed serum from 30 subjects who had previously taken part in the "PRO HIV-002" trial and had been vaccinated with gp120, NefTat and AS01 B adjuvant (QS-21 and 3D-MPL in liposomal form).
The present inventors found that, surprisingly, subjects from the PRO HIV-002 trial had a high level of anti-V1V2 antibodies in their serum, which showed high persistence and exceeded the level of anti-V1V2 antibodies in serum from subjects of the RV144 trial.
It may be expected that the claimed immunogenic compositions elicit a high level of anti-V1V2 antibodies, and have utility the in the prophylaxis of HIV infection.
The present invention provides an immunogenic composition which is in the form of a human dose comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises between 10-40ug of a lipopolysaccharide and between 10-40ug of an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
Also provided is an immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome wherein:
(i) the conductivity of the composition is 13 mS/cm or lower; and/or
(ii) the concentration of salts in said composition is 130 mM or lower; and/or
(iii) the concentration of sodium chloride in said composition is 130 mM or lower.
Further provided is an immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome and wherein the composition is substantially free of a NefTat related polypeptide wherein the NefTat related polypeptide is a polypeptide consisting of SEQ ID NO: 4.
DESCRIPTION OF THE FIGURES
Figure 1 : Mouse anti-V1V2 serology comparison
Figure 2: PRO HIV-002 and RV144 trial analysis: anti-V1V2 IgG comparison
Figure 3: PRO HIV-002 anti-V1V2 IgG responder rates
Figure 4: PRO HIV-002 anti-V1V2 IgG cross-subtype reactivity as compared to
Figure 5: PRO HIV-002 anti-V1V2 IgG durability
DESCRIPTION OF THE SEQUENCES
Figure imgf000008_0001
SEQ ID NO: 2 Nef
SEQ ID NO: 3 Tat
SEQ ID NO: 4 NefTat
Figure imgf000008_0002
SEQ ID NO: 6 polynucleotide sequence encoding gp1 20ZMis
SEQ ID NO: 7 native gp1 20ZMi8
SEQ ID NO: 8 polynucleotide sequence encoding native gp1 20ZMis DETAILED DESCRIPTION OF THE INVENTION
Polypeptides
As used herein, the term 'a gp120 related polypeptide' refers to a polypeptide comprising the V1 V2 region of SEQ ID NO: 1 or to an immunogenic derivative or fragment of the V1 V2 region of SEQ ID NO: 1 , or to a polypeptide comprising the V1V2 region of SEQ ID NO: 5 or to an immunogenic derivative or fragment of the V1V2 region of SEQ ID NO: 5. Suitably, the gp120 related polypeptide refers to a polypeptide consisting of the V1 V2 region of SEQ ID NO: 1 or to an immunogenic derivative or fragment of the V1V2 region of SEQ ID NO: 1 , or to a polypeptide consisting of the V1 V2 region of SEQ ID NO: 5 or to an immunogenic derivative or fragment of the V1V2 region of SEQ ID NO: 5. The V1V2 region of a gp120 related polypeptide is the stretch of residues defined by two particular cysteine residues which form a disulphide bridge in the folded state of the polypeptide. The V1V2 region itself excludes these cysteine residues. An example of the V1V2 region in the case of the gp120W6iD polypeptide (SEQ ID NO: 1 ) is the stretch of residues from residue 90 to 184. The skilled person will appreciate that the position of these cysteine residues and therefore the position of the V1V2 region within a given gp120 related polypeptide can vary. This is illustrated by another gp120 related polypeptide, gp120ZMis (SEQ ID NO: 5) wherein the V1V2 region is the stretch of residues from residue 90 to 172.
Suitably, the term 'a gp120 related polypeptide' refers to a polypeptide comprising SEQ ID NO: 1 or to an immunogenic derivative or fragment of SEQ ID NO: 1 , or to a polypeptide comprising SEQ ID NO: 5 or to an immunogenic derivative or fragment of SEQ ID NO: 5. Suitably, the gp120 related polypeptide refers to a polypeptide consisting of SEQ ID NO: 1 or to an immunogenic derivative or fragment of SEQ ID NO: 1 , or to a polypeptide consisting of SEQ ID NO: 5 or to an immunogenic derivative or fragment of SEQ ID NO: 5.
As used herein, the term "derivative" refers to a polypeptide that is modified relative to the reference sequence. Immunogenic derivatives are sufficiently similar to the reference sequence to remain capable of eliciting an immune response against the V1V2 region of the reference sequence. Suitably, immunogenic derivatives are sufficiently similar to the reference sequence to retain other key immunogenic properties of the reference sequence such as avoiding the introduction of immunodominant epitopes. A derivative may, for example, comprise a modified version of the reference sequence or alternatively may consist of a modified version of the reference sequence.
Suitably, the gp120 related polypeptide comprises or consists of a gp120 polypeptide derived from HIV-1 or HIV-2, suitably from groups M, N, O or P of HIV-1 , suitably from subtype A, B, C, D, E, F, G, H, I, J or K of group M. Suitably, the gp120 related polypeptide comprises or consists of a gp120 polypeptide derived from HIV-1 , suitably from group M, more suitably from subtype B. For example, the gp120 related polypeptide comprises or consists of the gp120 polypeptide from a HIV-1 or HIV-2, suitably from an M, N, O or P group HIV-1 , suitably from a subtype A, B, C, D, E, F, G, H, I, J or K of group M HIV-1. Suitably, the gp120 related polypeptide comprises or consists of the gp120 polypeptide from an HIV-1 , suitably from an HIV-1 group M, more suitably from an HIV-1 group M subtype B. The skilled person will recognise that individual substitutions, deletions or additions to the gp120 related polypeptide which alter, add or delete a single amino acid or a small percentage of amino acids is an "immunogenic derivative" where the alteration(s) results in the substitution/deletion/addition of residues which do not substantially impact the immunogenic function. By "not substantially impact the immunogenic function" is meant at least 50%, suitably at least 75% and suitably at least 90% activity of the reference sequence in an assay of the level of antibodies binding the gp120 V1 V2 region (e.g. ELISA) produced at a given time point after immunisation with the gp120 related polypeptide. Conservative substitution tables providing functionally similar amino acids are well known in the art. In general, such conservative substitutions will fall within one of the amino-acid groupings specified below, though in some circumstances other substitutions may be possible without substantially affecting the immunogenic properties of the antigen. The following eight groups each contain amino acids that are typically conservative substitutions for one another:
1 ) Alanine (A), Glycine (G);
2) Aspartic acid (D), Glutamic acid (E);
3) Asparagine (N), Glutamine (Q);
4) Arginine (R), Lysine (K);
5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V);
6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);
7) Serine (S), Threonine (T); and
8) Cysteine (C), Methionine (M)
(see, e.g., Creighton, Proteins 1984).
Suitably such substitutions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen. Suitably an immunogenic derivative will contain substitutions of up to 20 residues (for example up to 5 residues) relative to the reference sequence.
Immunogenic derivatives may also include those wherein additional amino acids are inserted compared to the reference sequence. Suitably such insertions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen. Suitably an immunogenic derivative will contain additions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations) relative to the reference sequence. One example of insertions includes a short stretch of histidine residues (e.g. 6 residues) to aid purification of the antigen in question.
Immunogenic derivatives include those wherein amino acids have been deleted compared to the reference sequence. Suitably such deletions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen. Suitably an immunogenic derivative will contain deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations) relative to the reference sequence. Suitably the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of the V1V2 region of SEQ ID NO: 1 having a small number of deletions, insertions and/or substitutions, such as a derivative of the V1V2 region of SEQ ID NO: 1 having deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations), insertions of up to 5 residues (for example 1 or 2 residues) at 0-5 five locations (for example 0- 2 locations) and substitutions of up to 20 residues (for example up to 5 residues).
Alternatively, the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of the V1V2 region of SEQ ID NO: 5 having a small number of deletions, insertions and/or substitutions, such as a derivative of the V1V2 region of SEQ ID NO: 5 having deletions of up to 5 residues (for example 1 or 2 residues) at 0-5 locations (for example 0-2 locations), insertions of up to 5 residues (for example 1 or 2 residues) at 0-5 five locations (for example 0- 2 locations) and substitutions of up to 20 residues (for example up to 5 residues).
Suitably the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 1 having a small number of deletions, insertions and/or substitutions, such as a derivative of SEQ ID NO: 1 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
Alternatively, the gp120 related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 5 having a small number of deletions, insertions and/or substitutions, such as a derivative of SEQ ID NO: 5 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
Suitably, the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ ID NO: 1. Suitably the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 1.
Suitably, the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ I D NO: 1. Suitably, the gp120 related polypeptide consists of the V1 V2 region of SEQ ID NO: 1. Alternatively, the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ ID NO: 5. Suitably the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 5.
Suitably, the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with the V1V2 region of SEQ ID NO: 5. Suitably the gp120 related polypeptide consists of the V1 V2 region of SEQ ID NO: 5.
Suitably, the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 1. Suitably, the gp120 related polypeptide comprises SEQ ID NO: 1.
Suitably, the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 1. Suitably, the gp120 related polypeptide consists of SEQ ID NO: 1.
Alternatively, the gp120 related polypeptide comprises a polypeptide with at least 70% identity, more suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 5. Suitably, the gp120 related polypeptide comprises SEQ ID NO: 5.
Suitably, the gp120 related polypeptide consists of a polypeptide with at least 70% identity, suitably at least 80% identity, more suitably at least 85% identity, more suitably at least 90% identity, more suitably at least 95% identity, more suitably at least 98% identity, more suitably at least 99% identity with SEQ ID NO: 5. Suitably, the gp120 related polypeptide consists of SEQ ID NO: 5. The terms "identical" or "% identity," in the context of two or more polypeptide sequences, refer to two or more sequences or sub-sequences that are the same or have a specified percentage of amino acid residues that are the same over a specified region, when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. This definition also refers to the compliment of a test sequence. Optionally, the identity exists over a region that is at least 300 amino acids in length, such as at least 400 amino acids or at least 500 amino acids. Most suitably, the comparison is performed over a window corresponding to the entire length of the reference sequence (as opposed to the derivative sequence).
For sequence comparison, one sequence acts as the reference sequence, to which the test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percentage sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
A "comparison window", as used herein, refers to a segment in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well- known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981 ), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerised implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wl), or by manual alignment and visual inspection (see, e.g., Curr Pro Mol Biol (Ausubel et al., eds. 1995 supplement)). An example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al., J. Mol. Biol. 215:403-410 (1990), respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (website at www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighbourhood word score threshold (Altschul et al., supra). These initial neighbourhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always < 0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 1 1 , an expectation (E) or 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more suitably less than about 0.01 , and most suitably less than about 0.001 .
An "immunogenic fragment" will contain a contiguous sequence of amino acids from the gp120 related polypeptide of which it is a fragment. Suitably, the fragment contains at least 15 to 50 amino acids, at least 51 to 150, at least 300 amino acids, at least 350, at least 400, or at least 450 contiguous amino acids from SEQ ID NO: 1.
Alternatively the fragment contains at least 15 to 50 amino acids, at least 51 to 150 amino acids, at least 300, at least 350, at least 400, or at least 450 contiguous amino acids from SEQ ID NO: 5.
The immunogenic fragment will remain capable of eliciting an immune response against the V1V2 region of the reference sequence. By "remain capable of eliciting an immune response against the V1V2 region of the reference sequence" is meant at least 50%, suitably at least 75% and suitably at least 90% activity of the reference sequence in an assay of the level of antibodies binding the gp120 V1V2 region (e.g. ELISA) produced at a given time point after immunisation with the gp120 related polypeptide. The gp120 related polypeptide may for example contain 2000 amino acid residues or fewer, such as 1500 amino acid residues or fewer, in particular 1000 amino acid residues or fewer, especially 800 amino acid residues or fewer.
Fusion proteins (also known as chimeric proteins) are proteins created through the covalent linkage of two or more polypeptide sequences which are not joined in nature, such as through a peptide linkage. For example, the gp120 related polypeptide may be provided in the form of a fusion protein also comprising a second HIV antigen.
The dose of a gp120 related polypeptide is suitably able to produce an adequate immune response in a human while having an acceptable reactogenicity profile.
Suitably the immunogenic composition comprises around 1 to 200 ug of gp120 related polypeptide, suitably between 1 to 100 ug, suitably between 2 to 50 ug, such as between 3 to 30 ug, in particular between 5 to 15 ug or between 16 to 25 ug, between 9 to 1 1 ug or between 19 to 21 ug, most suitably 10 ug or 20 ug. Suitably, the immunogenic composition is provided in a volume which is suitable for administration to a human as a single dose. The volume which may be administered to a human is dependent on the method, route and/or location of administration. In one embodiment the human dose is between 0.1 and 1 ml, more suitably between 0.3 and 0.75ml, such as between 0.45 and 0.55ml, in particular 0.5ml. Volumes of between 0.1 and 1 ml are particularly suitable for administration through routes such as subcutaneous and in particular intramuscular delivery. In another embodiment the human dose is between 0.05 and 0.2ml, suitably between 0.075 and 0.15ml, in particular 0.1 ml. Volumes of between 0.05 and 0.2ml are particularly suitable for administration through routes wherein a limited volume can be administered, such as intradermal delivery.
A gp120 polypeptide may be prepared by methods described in the art or methods analogous thereto. As used herein, the term 'a Nef related polypeptide' refers to the polypeptide provided in SEQ ID NO: 2, or to an immunogenic derivative or fragment thereof.
As used herein, the term 'a Tat related polypeptide' refers to the polypeptide provided in SEQ ID NO: 3, or to an immunogenic derivative or fragment thereof.
As used herein, the term 'a NefTat related polypeptide' refers to the polypeptide provided in SEQ ID NO: 4, or to an immunogenic derivative or fragment thereof.
Suitably the Nef related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 2, optionally having a small number of deletions, insertions and/or substitutions. An example is a derivative of SEQ ID NO: 2 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues. Suitably the Tat related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 3, optionally having a small number of deletions, insertions and/or substitutions. An example is a derivative of SEQ ID NO: 3 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues. Suitably the NefTat related polypeptide will comprise, such as consist of, an immunogenic derivative of SEQ ID NO: 4, optionally having a small number of deletions, insertions and/or substitutions. An example is a derivative of SEQ ID NO: 4 having deletions of up to 5 residues at 0-5 locations, insertions of up to 5 residues at 0-5 five locations and substitutions of up to 20 residues.
Suitably, the Nef related polypeptide comprises SEQ ID NO: 2. Suitably the Nef related polypeptide comprises a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 2.
Suitably, the Tat related polypeptide comprises SEQ ID NO: 3. Suitably the Tat related polypeptide comprises a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 3.
Suitably, the NefTat related polypeptide comprises SEQ ID NO: 4. Suitably the NefTat related polypeptide comprises a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 4. Suitably, the Nef related polypeptide consists of SEQ ID NO: 2. Suitably the Nef related polypeptide consists of a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 2.
Suitably, the Tat related polypeptide consists of SEQ ID NO: 3. Suitably the Tat related polypeptide consists of a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 3. Suitably, NefTat related polypeptide consists of SEQ ID NO: 4. Suitably the NefTat related polypeptide consists of a polypeptide with at least 99% identity, suitably at least 98% identity, more suitably at least 95% identity, more suitably at least 90% identity, more suitably at least 85% identity, more suitably at least 80% identity, more suitably at least 75% identity, more suitably at least 70% identity with SEQ ID NO: 4.
In one embodiment a Nef related polypeptide is a NefTat related polypeptide. In another embodiment a Tat related polypeptide is a NefTat related polypeptide. Particular derivatives of a Nef related polypeptide, Tat related polypeptide or NefTat related polypeptide include those with additional His residues at the N-terminus (e.g. a polyhistidine tag of six His residues, which may be used for nickel affinity purification).
Suitably the compositions of the present invention are substantially free of a Nef related polypeptide. Suitably, the compositions of the present invention contain a ratio of a Nef related polypeptide:gp120 related polypeptide of less than 1 :20, suitably less than 1 :25, suitably less than 1 :50, suitably less than 1 :100, suitably less than 1 :200, suitably less than 1 :500, more suitably less than 1 :1000 by weight. Suitably the compositions of the present invention contain a Nef related polypeptide at a level of less than 5ug, suitably less than 4ug, suitably less than 3ug, suitably less than 2ug, suitably less than 1 ug, suitably less than 0.5ug, suitably less than 0.2ug, suitably less than 0.1 ug, suitably less than 0.05ug, more suitably less than 0.01 ug per human dose. Most suitably the compositions of the present invention are free of a Nef related polypeptide.
Suitably the compositions of the present invention are substantially free of a Tat related polypeptide. Suitably, the compositions of the present invention contain a ratio of a Tat related polypeptide:gp120 related polypeptide of less than 1 :20, suitably less than 1 :25, suitably less than 1 :50, suitably less than 1 :100, suitably less than 1 :200, suitably less than 1 :500, more suitably less than 1 :1000 by weight.
Suitably the compositions of the present invention contain a Tat related polypeptide at a level of less than 5ug, suitably less than 4ug, suitably less than 3ug, suitably less than 2ug, suitably less than 1 ug, suitably less than 0.5ug, suitably less than 0.2ug, suitably less than 0.1 ug, suitably less than 0.05ug, more suitably less than 0.01 ug per human dose. Most suitably the compositions of the present invention are free of a Tat related polypeptide.
Suitably the compositions of the present invention are substantially free of a NefTat related polypeptide. Suitably, the compositions of the present invention contain a ratio of a NefTat related polypeptide:gp120 related polypeptide of less than 1 :20, suitably less than 1 :25, suitably less than 1 :50, suitably less than 1 :100, suitably less than 1 :200, suitably less than 1 :500, more suitably less than 1 :1000 by weight. Suitably the compositions of the present invention contain a NefTat related polypeptide at a level of less than 5ug, suitably less than 4ug, suitably less than 3ug, suitably less than 2ug, suitably less than 1 ug, suitably less than 0.5ug, suitably less than 0.2ug, suitably less than 0.1 ug, suitably less than 0.05ug, more suitably less than 0.01 ug per human dose. Most suitably the compositions of the present invention are free of a NefTat related polypeptide.
The presence of further HIV proteins may increase the efficacy of the composition of the invention. Suitably the composition of the invention may comprise additional proteins which may be further products of the Env gene (such as gp160 and gp41 or a further gp120 related polypeptide) the products of the gag and pol genes (such as MA, CA, SP1 , NC, SP2 and P6; and RT, RNase H, IN and PR, respectively) and, other non-structural proteins such as Rev, Vif, Vpr and Vpu (or immunogenic derivatives or fragments thereof). The HIV gag gene encodes a precursor protein p55, which can assemble spontaneously into immature virus-like particles (VLPs). The precursor is proteolytically cleaved into the major structural proteins CA (capsid) and MA (matrix), and into several smaller proteins. Both the precursor protein p55 and its major derivatives CA and MA may be considered as appropriate vaccine antigens which may increase the efficacy of the composition of the invention. The precursor p55 and the capsid protein CA may be used as VLPs or as monomeric proteins. Suitably the composition of the present invention may comprise one or more of these proteins.
Suitably, the composition of the present invention may comprise a polynucleotide encoding a polypeptide described above including for example a gp120 related polypeptide. The polynucleotide may be in the form of plasmid DNA or in the form of a recombinant live vector. In one embodiment, the composition of the present invention does not comprise additional HIV antigens. In a second embodiment of the invention the composition comprises 1-5 additional HIV antigens, such as 1 or 2 additional HIV antigens. Additional HIV antigens may be provided in the form of proteins or polynucleotides encoding proteins.
Suitably, the immunogenic composition comprises a total of around 1 to 500 ug of antigenic material, suitably between 1 to 200 ug, such as between 5 to 100 ug, most suitably between 5 to 50 ug. Suitably, the polypeptides and polynucleotides used in the present invention are isolated. An "isolated" polypeptide or polynucleotide is one that is removed from its original environment. For example, a naturally-occurring protein is isolated if it is separated from some or all of the coexisting materials in the natural system. Preferably, such polypeptides are at least about 90% pure, more suitably at least about 95% pure and most suitably at least about 99% pure. A polynucleotide is considered to be isolated if, for example, it is cloned into a vector that is not a part of its natural environment.
Adjuvant Saponins
The immunogenic composition of the invention comprises an immunologically active saponin fraction ("a saponin") as an adjuvant or as a component of an adjuvant. A particularly suitable saponin for use in the present invention is Quil A and its derivatives. Quil A is a saponin preparation isolated from the South American tree Quillaja Saponaria Molina and was first described by Dalsgaard et al. in 1974 ("Saponin adjuvants", Archiv. fur die gesamte Virusforschung, Vol. 44, Springer Verlag, Berlin, p243-254) to have adjuvant activity. Purified fragments of Quil A have been isolated by HPLC which retain adjuvant activity without the toxicity associated with Quil A (US5604106), for example QS-7 and QS-21 (also known as QA7 and QA21 ). QS-21 is a natural saponin derived from the bark of Quillaja saponaria Molina, which induces CD8+ cytotoxic T cells (CTLs), Th1 cells and a predominant lgG2a antibody response and is a preferred saponin in the context of the present invention.
In a suitable form of the present invention, the saponin adjuvant within the immunogenic composition is a derivative of saponaria molina quil A, suitably an immunologically active fraction of Quil A, such as QS-7 or QS-21 , suitably QS-21 . In one embodiment the compositions of the invention contain the immunologically active saponin fraction in substantially pure form. Suitably the compositions of the invention contain QS-21 in substantially pure form, that is to say, the QS-21 is at least 90% pure, for example at least 95% pure, or at least 98% pure.
In a specific embodiment, QS-21 is provided in a less reactogenic composition where it is quenched with an exogenous sterol, such as cholesterol for example. Several particular forms of less reactogenic compositions wherein the lytic activity of QS-21 is quenched with an exogenous cholesterol exist. In a specific embodiment, the saponin/sterol is in the form of a liposome structure (US6846489, Example 1 ). In this embodiment the liposomes suitably contain a neutral lipid, for example phosphatidylcholine, which is suitably non-crystalline at room temperature, for example eggyolk phosphatidylcholine, dioleoyl phosphatidylcholine (DOPC) or dilauryl phosphatidylcholine. The liposomes may also contain a charged lipid which increases the stability of the lipsome-QS-21 structure for liposomes composed of saturated lipids. In these cases the amount of charged lipid is suitably 1-20% w/w, suitably 5-10%. The ratio of sterol to phospholipid is 1 -50% (mol/mol), suitably 20-25%.
Suitable sterols include beta-sitosterol, stigmasterol, ergosterol, ergocalciferol and cholesterol. In one particular embodiment, the adjuvant composition comprises cholesterol as sterol. These sterols are well known in the art, for example cholesterol is disclosed in the Merck Index, 1 1 th Edn., page 341 , as a naturally occurring sterol found in animal fat.
The sterol according to the invention is taken to mean an exogenous sterol, i.e. a sterol which is not endogenous to the organism from which the antigenic preparation is taken but is added to the antigen preparation or subsequently at the moment of formulation. Typically, the sterol may be added during subsequent formulation of the antigen preparation with the saponin adjuvant, by using, for example, the saponin in its form wherein its lytic activity is quenched with the sterol. Suitably the exogenous sterol is associated to the saponin adjuvant as described in US6846489.
Where the active saponin fraction is QS-21 , the ratio of QS-21 : sterol will typically be in the order of 1 :100 to 1 :1 (w/w), suitably between 1 :10 to 1 : 1 (w/w), and suitably 1 :5 to 1 :1 (w/w). Suitably excess sterol is present, the ratio of QS-21 : sterol being at least 1 :2 (w/w). In one embodiment, the ratio of QS-21 : sterol is 1 :5 (w/w). Other saponins which have been described in the literature include Escin, which has been described in the Merck index (12th ed: entry 3737) as a mixture of saponins occurring in the seed of the horse chestnut tree, Lat: Aesculus hippocastanum. Its isolation is described by chromatography and purification (Fiedler, Arzneimittel-Forsch. 4, 213 (1953)), and by ion- exchange resins (Erbring et al., US 3,238,190). Fractions of escin have been purified and shown to be biologically active (Yoshikawa M, et al. (Chem Pharm Bull (Tokyo) 1996 44(8): 1454-1464)). Sapoalbin from Gypsophilla struthium (R. Vochten et al., 1968, J Pharm Belg, 42, 213-226) has also been described in relation to ISCOM production for example. Another useful saponin is those derived from the plant Gyophilla struthium.
Suitably, the total amount of saponin in the immunogenic composition of the present invention, particularly in a human dose of the immunogenic composition of the present invention, is between 1-100ug. In one embodiment, there is provided an immunogenic composition comprising QS-21 at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug.
In a further embodiment, there is provided an immunogenic composition comprising QS-21 at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
In another embodiment, there is provided an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises QS- 21 at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug.
In another embodiment, there is provided an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises QS- 21 at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
The dose of QS-21 is suitably able to enhance an immune response to an antigen in a human. In particular a suitable QS-21 amount is that which improves the immunological potential of the composition compared to the unadjuvanted composition, or compared to the composition adjuvanted with another QS-21 amount, whilst being acceptable from a reactogenicity profile. Lipopolysaccharide adjuvants
Lipopolysaccharides (LPS) are the major surface molecule of, and occur exclusively in, the external leaflet of the outer membrane of gram-negative bacteria. LPS impede destruction of bacteria by serum complements and phagocytic cells, and are involved in adherence for colonisation. LPS are a group of structurally related complex molecules of approximately 10,000 Daltons in size and consist of three covalently linked regions: (i) an O-specific polysaccharide chain (O-antigen) at the outer region
(ii) a core oligosaccharide central region
(iii) lipid A - the innermost region which serves as the hydrophobic anchor, it comprises glucosamine disaccharide units which carry long chain fatty acids. The biological activities of LPS, such as lethal toxicity, pyrogenicity and adjuvanticity, have been shown to be related to the lipid A moiety. In contrast, immunogenicity is associated with the O-specific polysaccharide component (O-antigen). Both LPS and lipid A have long been known for their strong adjuvant effects, but the high toxicity of these molecules has precluded their use in vaccine formulations. Significant effort has therefore been made towards reducing the toxicity of LPS or lipid A while maintaining their adjuvanticity.
The Salmonella minnesota mutant R595 was isolated in 1966 from a culture of the parent (smooth) strain (Luderitz et al. 1966 Ann N Y Acad Sci 133:349-374). The colonies selected were screened for their susceptibility to lysis by a panel of phages, and only those colonies that displayed a narrow range of sensitivity (susceptible to one or two phages only) were selected for further study. This effort led to the isolation of a deep rough mutant strain which is defective in LPS biosynthesis and referred to as S. minnesota R595.
In comparison to other LPS, those produced by the mutant S. minnesota R595 have a relatively simple structure.
(i) they contain no O-specific region - a characteristic which is responsible for the shift from the wild type smooth phenotype to the mutant rough phenotype and results in a loss of virulence
(ii) the core region is very short - this characteristic increases the strain susceptibility to a variety of chemicals (iii) the lipid A moiety is highly acylated with up to 7 fatty acids.
4'-monophosporyl lipid A (MPL), which may be obtained by the acid hydrolysis of LPS extracted from a deep rough mutant strain of gram-negative bacteria, retains the adjuvant properties of LPS while demonstrating a toxicity which is reduced by a factor of more than 1000 (as measured by lethal dose in chick embryo eggs) (Johnson et al. 1987 Rev Infect Dis 9 Suppl:S512-S516). LPS is typically refluxed in mineral acid solutions of moderate strength (e.g. 0.1 M HCI) for a period of approximately 30 minutes. This process results in dephosphorylation at the 1 position, and decarbohydration at the 6' position, yielding MPL.
3-O-deacylated monophosphoryl lipid A (3D-MPL), which may be obtained by mild alkaline hydrolysis of MPL, has a further reduced toxicity while again maintaining adjuvanticity, see US4912094 (Ribi Immunochemicals). Alkaline hydrolysis is typically performed in organic solvent, such as a mixture of chloroform/methanol, by saturation with an aqueous solution of weak base, such as 0.5 M sodium carbonate at pH 10.5. Further information on the preparation of 3D-MPL is available in, for example, US4912094 (Corixa Corporation).
The composition further comprises an additional adjuvant which is a lipopolysaccharide, suitably a non-toxic derivative of lipid A, particularly monophosphoryl lipid A or more particularly 3-deacylated monophoshoryl lipid A (3D-MPL).
3D-MPL is sold under the name MPL by GlaxoSmithKline Biologicals N.A. and is referred throughout the document as MPL or 3D-MPL. see, for example, US4436727; US487761 1 ; US4866034 and US4912094. 3D-MPL can be produced according to the methods disclosed in US4912094. Chemically it is a mixture of 3-deacylated monophosphoryl lipid A with 3, 4, 5 or 6 acylated chains. Suitably in the compositions of the present invention small particle 3D- MPL is used. Small particle 3D-MPL has a particle size such that it may be sterile-filtered through a 0.22um filter. Such preparations are described in US5776468. Suitably, the total amount of lipopolysaccharide in the immunogenic composition of the present invention, particularly in a human dose of the immunogenic composition of the present invention, is between 1-100ug.
In one embodiment, there is provided an immunogenic composition comprising 3D-MPL at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug. In a further embodiment, there is provided an immunogenic composition comprising 3D-MPL at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
In another embodiment, there is provided an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises 3D- MPL at a level of around 50 ug, for example between 38-100 ug, suitably between 40-75 ug or between 45-60 ug, more suitably 49-51 , most suitably 50 ug.
In another embodiment, there is provided an immunogenic composition in a volume which is suitable for a human dose which human dose of the immunogenic composition comprises 3D- MPL at a level of around 25 ug, for example between 10-37 ug, suitably between 15-30 ug or between 20-27 ug, more suitably 24-26, more suitably 25 ug.
Suitable compositions of the invention are those wherein liposomes are initially prepared without MPL (as described in US6846489), and MPL is then added, suitably as small particles of below 100 nm particles or particles that are susceptible to sterile filtration through a 0.22 urn membrane. The MPL is therefore not contained within the vesicle membrane (known as MPL out). Compositions where the MPL is contained within the vesicle membrane (known as MPL in) also form an aspect of the invention. The antigen can be contained within the vesicle membrane or contained outside the vesicle membrane. Suitably soluble antigens are outside and hydrophobic or lipidated antigens are either contained inside or outside the membrane. The invention comprises both lipopolysaccharide and immunologically active saponin. In a specific embodiment of the invention, the lipopolysaccharide is 3D-MPL and the immunologically active saponin is QS-21. In an embodiment of the invention, the composition comprises a lipopolysaccharide and immunologically active saponin in a liposomal formulation. Suitably in one form of these embodiments, the composition comprises 3D-MPL and QS-21 , with optionally a sterol which is suitably cholesterol.
In a further embodiment of the invention, the adjuvant composition comprises in a liposomal formulation lipopolysaccharide and immunologically active saponin in combination with one or more further immunostimulants or adjuvants. Suitably in one form of this embodiment the lipopolysaccharide is 3D-MPL and the immunologically active saponin is QS-21 . In a specific embodiment, QS-21 and 3D-MPL are present in a weight ratio of between 1 :2 to 2:1 . Suitably QS-21 and 3D-MPL are present in same final amount per human dose of the immunogenic composition. In one aspect of this embodiment, a human dose of immunogenic composition comprises a final level of 50 ug of 3D-MPL and 50 ug of QS-21. In another aspect, a human dose of immunogenic composition comprises a final level of 25 ug of 3D-MPL and 25 ug of QS-21. In a further embodiment, a human dose of immunogenic composition comprises a final level of 10ug each of MPL and QS-21.
Vaccine preparation is generally described in New Trends and Developments in Vaccines, edited by Voller et al., University Park Press, Baltimore, Maryland, U.S.A. 1978. Encapsulation within liposomes is described, for example, in US4235877. Conjugation of proteins to macromolecules is disclosed, for example, in US4372945 and in US4474757.
Salt concentration
Some antigens are sensitive to the presence of salts. Without being limited by theory, it is believed that these antigens are detrimentally impacted by a phenomenon known as "salting out" which may be defined as the precipitation of a protein from its solution by interaction with salts, such as sodium chloride. These antigens aggregate and precipitate at a concentration of sodium chloride as low as 150 mM. Consequently, the stability of immunogenic compositions comprising a gp120 related polypeptides may be improved by a reduction in the concentration of sodium chloride.
The immunogenic compositions of the invention will suitably be aqueous preparations.
Accordingly, the present invention provides an immunogenic composition comprising a gp120 related polypeptide, wherein the conductivity of the composition is 13 mS/cm or lower. In particular, the present invention provides immunogenic compositions wherein the conductivity of the immunogenic composition is 12 mS/cm or lower, for example 10 mS/cm or lower, 8 mS/cm or lower, 6 mS/cm or lower, 5 mS/cm or lower, 4 mS/cm or lower, or 3 mS/cm or lower. In a particular embodiment the conductivity of the immunogenic composition is 2.5 mS/cm or lower, such as 2.25 mS/cm or lower, or 2.0 mS/cm or lower. In a further specific embodiment the conductivity of the immunogenic composition is 1.5 to 2.5 mS/cm. Additionally provided is an immunogenic composition comprising a gp120 related polypeptide, wherein the concentration of salts in said composition is 130 mM or lower. In particular, the present invention provides immunogenic compositions wherein the concentration of salts in said composition is 100 mM or lower, for example 90 mM or lower, 80 mM or lower, 70 mM or lower, 60 mM or lower, 50 mM or lower, or 40 mM or lower. In a particular embodiment the concentration of salts in said composition is 35 mM or lower, such as 30 mM or lower, or 25 mM or lower. In a further specific embodiment the concentration of salts in said composition is 20 to 40 mM, such as 25 to 35 mM.
The present invention also provides an immunogenic composition comprising a gp120 related polypeptide, wherein the concentration of sodium chloride in said composition is 130 mM or lower. In particular, the present invention provides immunogenic compositions wherein the concentration of sodium chloride is 100 mM or lower, for example 90 mM or lower, 80 mM or lower, 70 mM or lower, 60 mM or lower, 50 mM or lower, 40 mM or lower, 30 mM or lower, 20 mM or lower or 15 mM or lower. In a particular embodiment the concentration of sodium chloride in the immunogenic composition is 10 mM or lower, such as 7.5 mM or lower. Suitably the concentration of sodium chloride in the immunogenic composition is at or below 5 mM. In a further specific embodiment, the immunogenic composition is essentially free of sodium chloride. By essentially free is meant that the concentration of sodium chloride is at or very near to zero mM (such as 3 mM or less, 2 mM or less or 1 mM or less). Suitably, the concentration of CaCI2 in the immunogenic compositions will be 40 mM or lower, 30 mM or lower, 20 mM or lower, 15 mM or lower or 10 mM or lower.
Suitably, the concentration of MgS04 in the immunogenic compositions will be 80 mM or lower, 60 mM or lower, 40 mM or lower, 30 mM or lower, 20 mM or lower or 10 mM or lower
Suitably, the total concentration of NH4 +, Mg2+ and Ca2+ ions in the immunogenic compositions will be 80 mM or lower, 60 mM or lower, 40 mM or lower, 30 mM or lower, 20 mM or lower or 10 mM or lower. It is well known that for parenteral administration solutions should have a pharmaceutically acceptable osmolality to avoid cell distortion or lysis. A pharmaceutically acceptable osmolality will generally mean that solutions will have an osmolality which is approximately isotonic or mildly hypertonic. Suitably the immunogenic compositions of the present invention will have an osmolality in the range of 250 to 750 mOsm/kg, for example, the osmolality may be in the range of 250 to 550 mOsm/kg, such as in the range of 280 to 500 mOsm/kg. Osmolality may be measured according to techniques known in the art, such as by the use of a commercially available osmometer, for example the Advanced® Model 2020 available from Advanced Instruments Inc. (USA). An "isotonicity agent" is a compound that is physiologically tolerated and imparts a suitable tonicity to a formulation to prevent the net flow of water across cell membranes that are in contact with the formulation.
In a particular embodiment there are provided immunogenic compositions further comprising a non-ionic tonicity agent. A non-ionic tonicity agent for use in an immunogenic composition will itself need to be pharmaceutically acceptable, e.g. suitable for use in humans, as well as being compatible with the gp120 related antigen and further compatible with other components such as the immunostimulant(s). In one embodiment of the present invention, suitable non-ionic tonicity agents are polyols, sugars (in particular sucrose, fructose, dextrose or glucose) or amino acids such as glycine. In one embodiment the polyol is a sugar alcohol, especially a C3-6 sugar alcohol. Exemplary sugar alcohols include glycerol, erythritol, threitol, arabitol, xylitol, ribitol, sorbitol, mannitol, dulcitol and iditol. In a specific example of this embodiment, a suitable non-ionic tonicity agent is sorbitol. The skilled person will recognise that an appropriate osmolality may be attained through the use of a mixture of different tonicity agents. In a particular embodiment of the invention the non-ionic tonicity agent in the compositions of the invention incorporates sucrose and/or sorbitol. In one embodiment, a suitable concentration of polyol within the immunogenic composition is between about 2.5 and about 15% (w/v), in particular between about 2.5 and about 10% (w/v) for example between about 3 and about 7% (w/v), such as between about 4 and about 6% (w/v). In a specific example of this embodiment, the polyol is sorbitol. In another embodiment, the immunogenic composition comprises sucrose and sorbitol. In such circumstances the immunogenic composition may suitably contain between about 2.5 and about 15% (w/v) of sucrose and between about 2.5 and about 15% (w/v) of sorbitol, in particular between about 2.5 and about 10% (w/v) of sucrose and between about 2.5 and about 10% (w/v) of sorbitol, for example, between about 3 and about 7% (w/v) of sucrose and between about 3 and about 7% (w/v) of sorbitol, such as between about 4 and about 6% (w/v) of sucrose and between about 4 and about 6% (w/v) of sorbitol. The pH of the immunogenic compositions should be suitable for parenteral administration. Typically the pH will be in the range of 6.0 to 9.0. Suitably the pH will be in the range 7.0 to 9.0, especially 7.25 to 8.75, such as 7.5 to 8.5, in particular pH 7.75 to 8.25. A pH of about 8.0 is of particular interest.
The pH may be controlled by the use of buffers, including for example Tris or phosphate buffers. The conductivity of an immunogenic composition of the invention can be measured using techniques known in the art, for example using a dedicated conductivity meter or other instrument with the capability to measure conductivity. One suitable instrument is the Zetasizer Nano ZS from Malvern Instruments (UK). The skilled person can readily test for the concentration of both sodium (Na+) and chloride (CI") ions using known techniques and kits. For example, sodium can be determined using a kit such as the Sodium Enzymatic Assay Kit (Catalogue Number: BQ01 1 EAEL) from Biosupply. Chloride can be determined using a kit such as Chloride Enzymatic Assay Kit (Catalogue Number: BQ006EAEL) from Biosupply.
Immunogenic properties of the immunogenic composition of the present invention
In the present invention the immunogenic composition is suitably capable of inducing humoral response in a mammal, such as a human, administered with the immunogenic composition.
Humoral responses can be detected using an appropriate antibody-based assay. For example, the presence or absence in serum of an immunoglobulin G (IgG) antibody response to a gp120 related polypeptide can be analyzed using ELISA. The induction of humoral responses such as IgG antibodies, suitably IgG antibodies binding the V1V2 region of gp120, indicates the immunogenicity of the immunogenic compositions of the invention.
In a further embodiment, the immunogenic composition is capable of inducing an improved CD4 T-cell immune response. By "improved CD4 T-cell immune response" is meant that a higher CD4 response is obtained in a mammal, such as a human, after administration of the adjuvanted immunogenic composition. In particular but not exclusively, said 'improved CD4 T-cell immune response' is obtained in an immunologically unprimed patient, i.e. a patient who is seronegative to HIV.
The improved CD4 T-cell immune response (which may be provided by 'polyfunctional' T cells) may be assessed by measuring the number of cells producing any of the following immune markers:
CD4 T cells that express at least one immune marker
cells producing at least two different immune markers (e.g. CD40L, IL-2 and/or IFN- gamma, TNF-alpha)
cells producing at least CD40L and another immune marker (e.g. IL-2, TNF-gamma, and/or IFN-gamma)
cells producing at least IL-2 and another immune marker (e.g. CD40L, TNF-alpha and/or IFN-gamma)
cells producing at least IFN-gamma and another immune marker (e.g. IL-2, TNF-alpha and/or CD40L)
· cells producing at least TNF-alpha and another immune marker (e.g. IL-2, CD40L and/or IFN-gamma)
There will be an improved CD4 T-cell immune response when cells producing any of the above immune markers are in a higher amount following administration. Typically at least one, suitably two of the six conditions mentioned herein above will be fulfilled. In a particular embodiment, the cells producing all four immune markers will be present at a higher amount.
The improved CD4 T-cell immune response conferred by the gp120 composition of the present invention may be ideally obtained after one single administration.
In another embodiment, the administration of said immunogenic composition induces an improved B-memory cell response in a mammal, such as a human, administered with the immunogenic composition. An improved B-memory cell response is intended to mean an increased frequency of peripheral blood B lymphocytes capable of differentiation into antibody- secreting plasma cells upon antigen encounter as measured by stimulation of in-vitro differentiation. In a specific embodiment, the administration of said immunogenic composition induces at least two of the following responses: (i) an improved CD4 T-cell immune response, (ii) an improved B-memory cell response, (iii) an improved humoral response, against at least one of the component antigen(s) or antigenic composition compared to either immune response obtained with other compositions.
The magnitude of an immune response can also be expressed as the titre (or concentration) of antigen-specific antibodies induced by the immunogenic composition as determined by an appropriate serological test. The magnitude of a T cell response can be expressed as the frequency (or number) of antigen-specific cells induced by the immunogenic composition among the total population of T cells, which can be monitored by cytokine production.
Suitably the composition of the present invention elicits an immune response capable of cross- reactivity. Cross-reactivity is herein taken to mean the ability of immune responses induced by an immunogenic composition of the invention to recognize strains of HIV-1 from subtypes that are not represented in the immunogenic composition. For example, an immunogenic composition of the invention comprising a gp120 related polypeptide comprising from a strain of HIV-1 from subtype B is considered cross-reactive if the HIV-specific immune response, such as HIV-specific antibody or CD4+ T cell response (in particular an antibody response to the V1V2 loop of gp120), induced by the composition reacted with one or more different strains of HIV-1 not in the composition, for example, with a strain of HIV-1 from a subtype other than subtype B. Suitably, cross-reactivity will be in respect of an HIV-1 strain from a different sub-type, in particular in respect of an HIV-1 strain from a different group.
Suitably, the level of cross-reactivity observed is up to 10%, up to 15%, up to 20%, up to 25%, up to 30%, up to 35%, up to 40%, up to 45%, up to 50%, up to 55%, up to 60%, up to 65% up to 70%, up to 80%, up to 90% or up to 100% of antigen-specific cells induced by the immunogenic composition among the total population of T cells or titre (or concentration) of antigen-specific antibodies induced by the immunogenic composition.
When measuring cross-reactivity in terms of the percentage of responders to the strains of HIV-1 from different subtypes, the number or percentage of vaccinated individuals that show a positive response in an immunological assay after subsequent challenge can be measured. A responder can respond to one or more epitopes on an antigen. A responder can also respond to one or more polypeptides in an immunogenic composition of the invention and/or to one or more antigens in an immunogenic composition of the invention.
Immunological assays such as serological tests that can be used to analyse the percentage of responders or the magnitude of an immune response are known in the art. Examples of such assays are known to a person skilled in the art.
Suitably, the level of cross-reactivity observed is up to 10%, up to 15%, up to 20%, up to 25%, up to 30%, up to 35%, up to 40%, up to 45%, up to 50%, up to 55%, up to 60%, up to 65% up to 70%, up to 80%, up to 90% or up to 100% of subjects in a sample are responders.
In an embodiment, the immunogenic composition of the invention is for use in eliciting high and long-lasting numbers of HIV-1-specific antibodies in an individual not infected with HIV. In a further embodiment, the immunogenic composition of the invention is for use in eliciting high and long-lasting numbers of HIV-1-specific antibodies in an individual at risk of infection with an HIV-1 strain from one or more clades different from the one or more HIV-1 clades from which the gp120 related polypeptide in the immunogenic composition is derived. In an embodiment, the immunogenic composition of the invention is for use in controlling or reducing viremia in an individual infected with HIV.
Suitably, after administration of the composition, the viral load of the subject remains below 100,000 copies/ml for at least four months after administration. In a further embodiment, the viral load of the subject remains below 100,000 copies/ml of serum for at least six months, at least twelve months, at least eighteen months, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years. In another embodiment, the subject maintains a viral load below 50,000 copies/ml, below 10,000 copies/ml, below 5000 copies/ml, below 1000 copies/ml, or below 500 copies/ml. Suitably, viral load is maintained or reduced for at least six months, at least twelve months, at least eighteen months, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years after administration of the composition. Suitably, administration of the inventive composition results in a durable response. A durable response is for example the ability to detect, in the serum of an individual, IgG antibody capable of binding to the V1V2 region of the gp120 related polypeptide of the composition at least 24 weeks, at least 48 weeks, at least 72 weeks, at least 96 weeks, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years after the only administration of the composition, or the first administration of the composition in a course of repeat administrations, to the individual. Suitably, antibody levels will be detected at a level of at least 5%, more suitably at least 10% and in particular at least 20% of the serum titre two weeks following the first administration. Suitably the antibody will be detectable in at least 50% of individuals, more suitably at least 60% of individuals and in particular at least 75%.
Suitably, a durable response is for example the ability to detect, in the serum of an individual, IgG antibody binding the V1V2 region of the gp120 related polypeptide of the composition at least 2 weeks, at least 6 months, at least 12 months, at least 18 months, at least two years, at least three years, at least four years, at least five years, at least six years, at least seven years, at least eight years, at least nine years, or at least ten years after the final administration of the composition in a course of repeat administrations to the individual. Suitably, antibody levels will be detected at a level of at least 5%, more suitably at least 10% and in particular at least 20% of the serum titre two weeks following the final administration. Suitably the antibody will be detectable in at least 50% of individuals, more suitably at least 60% of individuals and in particular at least 75%.
Suitably, the present invention is capable of achieving a more durable immune response based on responder rates. Suitably, up to 10%, up to 15%, up to 20%, up to 25%, up to 30%, up to 35%, up to 40%, up to 45%, up to 50%, up to 55%, up to 60%, up to 65% up to 70%, up to 80%, up to 90% or up to 100% of vaccinated individuals mount an increased humoral response such as an increased serum level of IgG antibody binding the V1V2 region of the gp120 related polypeptide of the composition.
Vaccination means
The immunogenic compositions of the invention may be administered by any suitable delivery route, such as intradermal, mucosal e.g. intranasal, oral, intramuscular or subcutaneous. Other delivery routes are well known in the art. The intramuscular delivery route is preferred for the immunogenic composition. Intradermal delivery is another suitable route. Any suitable device may be used for intradermal delivery, for example short needle devices such as those described in US4886499. Intradermal vaccines may also be administered by devices which limit the effective penetration length of a needle into the skin. Also suitable are jet injection devices which deliver liquid vaccines to the dermis via a liquid jet injector or via a needle which pierces the stratum corneum and produces a jet which reaches the dermis. Jet injection devices are described for example in US5480381 . Also suitable are ballistic powder/particle delivery devices which use compressed gas to accelerate vaccine in powder form through the outer layers of the skin to the dermis. Additionally, conventional syringes may be used in the classical mantoux method of intradermal administration.
Another suitable administration route is the subcutaneous route. Any suitable device may be used for subcutaneous delivery, for example classical needle. Suitably, a needle-free jet injector service is used, such as that published in US6623446. More suitably said device is pre-filled with the liquid vaccine formulation.
Alternatively the vaccine is administered intranasally. Typically, the vaccine is administered locally to the nasopharyngeal area, suitably without being inhaled into the lungs. It is desirable to use an intranasal delivery device which delivers the vaccine formulation to the nasopharyngeal area, without or substantially without it entering the lungs.
In a specific aspect of the present invention, the immunogenic composition may be given intramuscularly for the first administration, and a boosting composition may be administered through a different route, for example intradermal, subcutaneous or intranasal.
In one aspect of the invention a schedule for vaccination with the immunogenic composition may comprise the sequential ("prime-boost"), concomitant or simultaneous administration of the immunogenic composition and DNA encoding any of the above-mentioned proteins. In one embodiment the schedule for vaccination with the immunogenic composition consists of three to five (for example four) administrations of the immunogenic composition to an individual over a period of four to eight (for example five to seven) months. Suitably, the schedule for vaccination with the immunogenic composition consists of four administrations of the immunogenic composition to an individual over a period of five to seven months. Suitably, the gp120 related polypeptide of the invention may be substituted by a polynucleotide encoding the gp120 related polypeptide of the invention. Suitably, the polypeptide is codon- optimised. The DNA may be delivered as plasmid DNA or in the form of a recombinant live vector, e.g. a poxvirus vector or any other suitable live vector such as retrovirus, lentivirus, adenovirus, adeno-associated virus and modified vaccinia ankara (MVA) virus. Suitably, an adenovirus is used. Alternatively a canary pox virus may be used. The immunogenic composition may be injected once or several times followed by one or more DNA administrations. DNA may be used first for one or more administrations followed by one or more immunisations with the immunogenic composition. Alternatively, the immunogenic composition may be injected once or several times in conjunction with DNA administrations. Antiretrovirals
HIV is a retrovirus. The conversion of its RNA to DNA is accomplished through the action of the enzyme reverse transcriptase. Compounds that inhibit the function of reverse transcriptase inhibit replication of HIV in infected cells. Drugs incorporating such compounds are useful in the prevention or treatment of HIV infection in humans and may be utilised in conjunction with a composition of the present invention.
The composition of the present invention may be administered in conjunction with (i.e. before, during or after administration of) antiretroviral therapy (ART) such as nucleoside or non- nucleoside reverse transcriptase inhibitors, protease inhibitors, fusion inhibitors, entry inhibitors, maturation inhibitors, cellular inhibitors and integrase strand transfer inhibitors.
Antiretroviral drugs include lamivudine and zidovudine, emtricitabine (FTC), zidovudine (ZDV), azidothymidine (AZT), lamivudine (3TC), zalcitabine, dideoxycytidine (ddC), tenofovir disoproxil fumarate (TDF), didanosine (ddl), stavudine (d4T), abacavir sulfate (ABC), etravirine, delavirdine (DLV), efavirenz (EFV), nevirapine (NVP), amprenavir (APV), tipranavir (TPV), indinavir (IDV), saquinavir, saquinavir mesylate (SQV), lopinavir (LPV), ritonavir (RTV), fosamprenavir calcium (FOS-APV), ritonavir, RTV, darunavir, atazanavir sulfate (ATV), nelfinavir mesylate (NFV), enfuvirtide, T-20, maraviroc, dolutegravir and raltegravir. ART drugs can also include antibodies, such as ibalizumab, targeting HIV proteins or cellular proteins associated with disease progression. Also included are immune-based therapies, such as IL-2, IL-12 and alpha-epibromide. Each of these drugs can be administered alone or in combination with any other ART drug. Information about ART drugs and their administration can be found many pharmacopeia, such as the United States Pharmacopeia (USP) or accessed online, such as at www.aidsmeds.com (accessed 5 September 2013) Commercial names of these drugs and combinations of these drugs include Atripla (efavirenz, emtricitabine and tenofovir disoproxil fumarate), Complera (emtricitabine, rilpivirine, and tenofovir disoproxil fumarate), Stribild (elvitegravir, cobicistat, emtricitabine, tenofovir disoproxil fumarate), Combivir (lamivudine and zidovudine), Emtriva (emtricitabine, FTC), Epivir (lamivudine, 3TC), Epzicom (abacavir and lamivudine), Hivid (zalcitabine, dideoxycytidine, ddC), Retrovir (zidovudine, azidothymidine, AZT, ZDV), Trizivir (abacavir, zidovudine, and lamivudine), Truvada (tenofovir disoproxil fumarate and emtricitabine), Videx EC (enteric coated didanosine, ddl EC), Videx (didanosine, dideoxyinosine, ddl), Viread (tenofovir disoproxil fumarate, TDF), Zerit (stavudine, d4T), Ziagen (abacavir sulfate, ABC), rilpivirine, etravirine, Rescriptor (delavirdine, DLV), Sustiva (efavirenz, EFV), Viramune (nevirapine, NVP), Agenerase (amprenavir, APV), Aptivus (tipranavir, TPV), saquinavir, Invirase (saquinavir mesylate, SQV), Kaletra (lopinavir and ritonavir, LPV/RTV), Lexiva (Fosamprenavir Calcium, FOS-APV), Norvir (ritonavir, RTV), darunavir, Reyataz (atazanavir sulfate, ATV), Viracept (nelfinavir mesylate, NFV), Fuzeon (enfuvirtide, T-20), maraviroc, raltegravir, dolutegravir. In one embodiment, the immunogenic composition is administered to a patient who is also taking antiretrovirals. In a further embodiment, the immunogenic composition is administered to a patient who has previously taken antiretrovirals. In a further embodiment, the immunogenic composition is administered to a patient who is not taking and has not previously taken antiretrovirals.
In one embodiment, the immunogenic composition is administered to a patient having a CD4 count of 200 or more, suitably 500 or more, most suitably between 500-1700 cells per cubic millimetre of blood. In a further embodiment, the immunogenic composition is administered to a patient having a nadir CD4 count of 200 or more, more suitably 500 or more cells per cubic millimetre of blood.
In one embodiment the immunogenic composition is administered to a subject, such as a human, who is not infected with HIV. In one embodiment the immunogenic composition is administered to a subject, such as a human, who is infected with HIV. In one aspect of the invention, there is provided a gp120 related protein for use in the manufacture of an immunogenic composition as described herein. Such as for the prophylaxis of HIV infection. Alternatively, the composition may be intended for the treatment of HIV infection.
In a further aspect there is provided a method for the prophylaxis of HIV infection by administration of an immunogenic composition as described herein to a mammal, such as a human. Such administration may reduce the risk of HIV infection and/or the severity of HIV infection.
In a further aspect there is provided a method for the treatment of HIV infection by administration of an immunogenic composition as described herein to a mammal infected with HIV, such as a human. Such administration may reduce the severity of HIV infection. In a further aspect there is provided a method for reducing the risk of HIV transmission from an HIV-infected individual to a partner of said HIV-infected individual, by administration of an immunogenic composition as described herein to the HIV-infected individual.
There is also provided an immunogenic composition as described herein for use in the prophylaxis of HIV infection.
There is also provided an immunogenic composition as described herein for use in the treatment of HIV infection. The invention is illustrated by way of the following clauses:
Clause 1 . An immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome and wherein the composition is substantially free of a NefTat related polypeptide wherein the NefTat related polypeptide is a polypeptide consisting of SEQ ID NO: 4.
Clause 2. An immunogenic composition which is in the form of a human dose comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises between 10-40ug of a lipopolysaccharide and between 10-40ug of an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
Clause 3. An immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome wherein:
(i) the conductivity of the composition is 13 mS/cm or lower; and/or
(ii) the concentration of salts in said composition is 130 mM or lower; and/or
(iii) the concentration of sodium chloride in said composition is 130 mM or lower. Clause 4. The immunogenic composition according to either clause 2 or 3, which is substantially free of a NefTat related polypeptide wherein the NefTat related polypeptide is a polypeptide consisting of SEQ ID NO: 4.
Clause 5. The immunogenic composition according to either clause 1 or 4, which contains a ratio of NefTat related polypeptide:gp120 related polypeptide of less than 1 :20.
Clause 6. The immunogenic composition according to either clause 1 or 4, which contains less than 1 ug of NefTat related polypeptide.
Clause 7. The immunogenic composition according to either clause 5 or 6 wherein the composition is free of NefTat related polypeptide.
Clause 8. The immunogenic composition according to any one of clause 1 or 4 to 7 wherein the NefTat related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 4.
Clause 9. The immunogenic composition according to clause 8 wherein the NefTat related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 4.
Clause 10. The immunogenic composition according to clause 9 wherein the NefTat related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 4.
Clause H . The immunogenic composition according to clause 10 wherein the NefTat related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 4.
Clause 12. The immunogenic composition according to either clausel or 4, which contains a ratio of Nef related polypeptide:gp120 related polypeptide of less than 1 :20.
Clause 13. The immunogenic composition according to either clause 1 or 4, which contains less than 1 ug of Nef related polypeptide. The immunogenic composition according to either clause 12 or 13 wherein the composition is free of Nef related polypeptide.
Clause 15. The immunogenic composition according to any one of clauses 1 , 4 or 12 to 14 wherein the Nef related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 2.
Clause 16. The immunogenic composition according to clause 15 wherein the Nef related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 2.
Clause 17. The immunogenic composition according to clause 16 wherein the Nef related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 2.
Clause 18. The immunogenic composition according to clause 17 wherein the Nef related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 2.
Clause 19. The immunogenic composition according to either clause 1 or 4, which contains a ratio of Tat related polypeptide:gp120 related polypeptide of less than 1 :20.
Clause 20. The immunogenic composition according to either clause 1 or 4, which contains less than 1 ug of Tat related polypeptide.
Clause 21. The immunogenic composition according to either clause 19 or 20 wherein the composition is free of Tat related polypeptide.
Clause 22. The immunogenic composition according to any one of clauses 1 , 4 or 19 to 21 wherein the Tat related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 3.
Clause 23. The immunogenic composition according to clause 22 wherein the Tat related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 3.
Clause 24. The immunogenic composition according to clause 23 wherein the Tat related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 3.
Clause 25. The immunogenic composition according to clause 24 wherein the Tat related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 3.
Clause 26. The immunogenic composition according to any one of clauses 1 or 3 to 25 wherein the lipopolysaccharide is present at a level of between 10-100ug. Clause 27. The immunogenic composition according to clause 26 wherein the lipopolysaccharide is present at a level of between 15-80ug.
Clause 28. The immunogenic composition according to clause 27 wherein the lipopolysaccharide is present at a level of between 20-65ug.
Clause 29. The immunogenic composition according to clause 28 wherein the lipopolysaccharide is present at a level of between 30-60ug.
Clause 30. The immunogenic composition according to clause 29 wherein the lipopolysaccharide is present at a level of between 45-55ug.
Clause 31. The immunogenic composition according to clause 30 wherein the lipopolysaccharide is present at a level of 50ug.
Clause 32. The immunogenic composition according to any one of clauses 1 or 3 to 31 wherein the saponin is present at a level of between 10-100ug.
Clause 33. The immunogenic composition according to clause 32 wherein the saponin is present at a level of between 15-80ug.
Clause 34. The immunogenic composition according to clause 33 wherein the saponin is present at a level of between 20-65ug.
Clause 35. The immunogenic composition according to clause 34 wherein the saponin is present at a level of between 30-60ug.
Clause 36 The immunogenic composition according to clause 35 wherein the saponin is present at a level of between 45-55ug.
Clause 37 The immunogenic composition according to clause 36 wherein the saponin is present at a level of 50ug.
Clause 38. The immunogenic composition according to any one of clauses 1 to 25 wherein the lipopolysaccharide is present at a level of between 15-35ug.
Clause 39. The immunogenic composition according to clause 38 wherein the lipopolysaccharide is present at a level of between 20-30ug.
Clause 40. The immunogenic composition according to clause 39 wherein the lipopolysaccharide is present at a level of 25ug.
Clause 41 The immunogenic composition according to any one of clauses 1 to 31 wherein the saponin is present at a level of between 15-35ug.
Clause 42 The immunogenic composition according to clause 41 wherein the saponin is present at a level of between 20-30ug.
Clause 43. The immunogenic composition according to clause 42 wherein the saponin is present at a level of 25ug.
Clause 44. The immunogenic composition according to any one of clauses 1 to 43 wherein the lipopolysaccharide is 3D-MPL. Clause 45. The immunogenic composition according to any one of clauses 1 to 44 wherein the saponin is QS-21.
Clause 46. The immunogenic composition according to any one of clauses 1 , 2 or 4 to 45 wherein:
(i) the conductivity of the composition is 13 mS/cm or lower; and/or
(ii) the concentration of salts in said composition is 130 mM or lower; and/or
(iii) the concentration of sodium chloride in said composition is 130 mM or lower.
Clause 47 The immunogenic composition according to clause 46 wherein the conductivity of the composition is 13 mS/cm or lower.
Clause 48 The immunogenic composition according to clause 47 wherein the conductivity of the composition is 6 mS/cm or lower.
Clause 49. The immunogenic composition according to clause 48 wherein the conductivity of the composition is 1.5 to 2.5 mS/cm.
Clause 50. The immunogenic composition according to clause 46 wherein the concentration of salts in said composition is 130 mM or lower.
Clause 51. The immunogenic composition according to clause 50 wherein the concentration of salts in said composition is 60 mM or lower.
Clause 52 The immunogenic composition according to clause 51 wherein the concentration of salts in said composition is 20 to 40 mM.
Clause 53 The immunogenic composition according to clause 46 wherein the concentration of sodium chloride in said composition is 130 mM or lower.
Clause 54. The immunogenic composition according to clause 53 wherein the concentration of sodium chloride in said composition is 60 mM or lower.
Clause 55. The immunogenic composition according to clause 54 wherein the concentration of sodium chloride in said composition is 10 mM or lower.
Clause 56. The immunogenic composition according any one of clauses 1 to 55, wherein the concentration of CaCI2 in the immunogenic composition is 30 mM or lower.
Clause 57 The immunogenic composition according any one of clauses 1 to 56, wherein the concentration of MgS04 in the immunogenic composition is 60 mM or lower. Clause 58 The immunogenic composition according any one of clauses 1 to 57, total concentration of NH4 +, Mg2+ and Ca2+ ions is 40 mM or lower.
Clause 59. The immunogenic composition according to any one of clauses 1 to 58 which is an aqueous solution.
Clause 60. The immunogenic composition according to any one of clauses 1 to 59 which is a single human dose. Clause 61. The immunogenic composition according to any one of clauses 1 to 60 wherein the human dose is between 0.1 and 1 ml.
Clause 62. The immunogenic composition according to clause 61 wherein the human dose is between 0.3 and 0.75ml.
Clause 63. The immunogenic composition according to clause 62 wherein the human dose is 0.5ml.
Clause 64. The immunogenic composition according to any one of clauses 1 to 60 wherein the human dose is between 0.05 and 0.2ml.
Clause 65. The immunogenic composition according to any one of clauses 1 to 64 wherein the osmolality is in the range of 250 to 750 mOsm/kg.
Clause 66. The immunogenic composition according to clause 65 wherein the osmolality is in the range of 250 to 550 mOsm/kg.
Clause 67. The immunogenic composition according to any one of clauses 1 to 66, comprising a non-ionic tonicity agent.
Clause 68. The immunogenic composition according to clause 67, wherein the non-ionic tonicity agent is a polyol.
Clause 69. The immunogenic composition according to clause 68, wherein the polyol is sorbitol.
Clause 70 The immunogenic composition according to clause 69, wherein the concentration of sorbitol is between about 4 and about 6% (w/v).
Clause 71 The immunogenic composition according to any one of clauses 1 to 70, wherein the concentration of sucrose is between about 4 and about 6% (w/v).
Clause 72. The immunogenic composition according to any one of clauses 1 to 71 wherein the pH is in the range of 6.0 to 9.0.
Clause 73. The immunogenic composition according to any one of clauses 1 to 72 wherein the composition comprises the gp120 related polypeptide at a level of around 1 to 100 ug.
Clause 74. The immunogenic composition according to clause 73 wherein the composition comprises the gp120 related polypeptide at a level of 3 to 30 ug.
Clause 75. The immunogenic composition according to clause 74 wherein the composition comprises the gp120 related polypeptide at a level of 5 to 15 ug.
Clause 76. The immunogenic composition according to clause 74 wherein the composition comprises the gp120 related polypeptide at a level of 16 to 25 ug.
Clause 77. The immunogenic composition according to any one of clauses 1 to 76 wherein the composition comprises 1 -5 additional HIV antigens. Clause 78. The immunogenic composition according to clause 77 wherein the composition comprises additional HIV antigens selected from the list consisting of gp160, gp41 , MA, CA, SP1 , NC, SP2, P6, RT, RNase H, IN, PR, Rev, Vif, Vpr and Vpu.
Clause 79. The immunogenic composition according to any one of clauses 1 to 78 wherein the composition comprises a total of around 1 to 500 ug of antigenic material.
Clause 80. The composition according to any one of clauses 1 to 79 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1.
Clause 81. The composition according to clause 80 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1 group M.
Clause 82. The composition according to clause 81 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1 group M subtype C.
Clause 83. The composition according to clause 82 wherein the gp120 related polypeptide comprises a gp120 polypeptide derived from HIV-1 group M subtype B.
Clause 84. The composition according to any one of clauses 1 to 81 and 83 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 1.
Clause 85. The composition according to clause 84 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 1.
Clause 86. The composition according to clause 85 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 1.
Clause 87. The composition according to clause 86 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 1.
Clause 88. The composition according to clause 87 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 1.
Clause 89. The composition according to clause 88 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 1.
Clause 90. The composition according to clause 89 wherein the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 1.
Clause 91. The composition according to any one of clauses 1 to 81 and 83 to 90 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with the V1 V2 region of SEQ ID NO: 1 . Clause 92. The composition according to clause 91 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 1.
Clause 93. The composition according to clause 92 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 1.
Clause 94. The composition according to clause 93 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 1.
Clause 95. The composition according to clause 94 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 1.
Clause 96. The composition according to clause 95 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 1.
Clause 97. The composition according to clause 96 wherein the gp120 related polypeptide consists of the V1V2 region of SEQ ID NO: 1.
Clause 98. The composition according to any one of clauses 1 to 81 and 83 to 97 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 1.
Clause 99. The composition according to clause 98 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 1.
Clause 100. The composition according to clause 99 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 1.
Clause 101 . The composition according to clause 100 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with SEQ ID NO: 1.
Clause 102. The composition according to clause 101 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with SEQ ID NO: 1.
Clause 103. The composition according to clause 102 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 1.
Clause 104. The composition according to clause 103 wherein the gp120 related polypeptide comprises SEQ ID NO: 1.
Clause 105. The composition according to any one of clauses 1 to 81 and 83 to 104 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with SEQ ID NO: 1. Clause 106. The composition according to clause 105 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with SEQ ID NO: 1.
Clause 107. The composition according to clause 106 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with SEQ ID NO: 1.
Clause 108. The composition according to clause 107 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with SEQ ID NO: 1.
Clause 109. The composition according to clause 108 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with SEQ ID NO: 1.
Clause 1 10. The composition according to clause 109 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with SEQ ID NO: 1.
Clause 1 1 1 . The composition according to clause 1 10 wherein the gp120 related polypeptide consists of SEQ ID NO: 1 .
Clause 1 12. The composition according to any one of clauses 1 to 82 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 5.
Clause 1 13. The composition according to clause 1 12 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 5.
Clause 1 14. The composition according to clause 1 13 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 5.
Clause 1 15. The composition according to clause 1 14 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 5.
Clause 1 16. The composition according to clause 1 15 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 5.
Clause 1 17. The composition according to clause 1 16 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 5.
Clause 1 18. The composition according to clause 1 17 wherein the gp120 related polypeptide comprises the V1V2 region of SEQ ID NO: 5.
Clause 1 19. The composition according to any one of clauses 1 to 82 and 1 12 to 1 18 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 5. Clause 120. The composition according to clause 1 19 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with the V1V2 region of SEQ ID NO: 5.
Clause 121 . The composition according to clause 120 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with the V1V2 region of SEQ ID NO: 5.
Clause 122. The composition according to clause 121 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with the V1V2 region of SEQ ID NO: 5.
Clause 123. The composition according to clause 122 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with the V1V2 region of SEQ ID NO: 5.
Clause 124. The composition according to clause 123 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with the V1V2 region of SEQ ID NO: 5.
Clause 125. The composition according to clause 124 wherein the gp120 related polypeptide consists of the V1V2 region of SEQ ID NO: 5.
Clause 126. The composition according to any one of clauses 1 to 82 and 1 12 to 125 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 5.
Clause 127. The composition according to clause 126 wherein the gp120 related polypeptide comprises a polypeptide with at least 80% identity with SEQ ID NO: 5.
Clause 128. The composition according to clause 127 wherein the gp120 related polypeptide comprises a polypeptide with at least 90% identity with SEQ ID NO: 5.
Clause 129. The composition according to clause 128 wherein the gp120 related polypeptide comprises a polypeptide with at least 95% identity with SEQ ID NO: 5.
Clause 130. The composition according to clause 129 wherein the gp120 related polypeptide comprises a polypeptide with at least 98% identity with SEQ ID NO: 5.
Clause 131 . The composition according to clause 130 wherein the gp120 related polypeptide comprises a polypeptide with at least 99% identity with SEQ ID NO: 5.
Clause 132. The composition according to clause 131 wherein the gp120 related polypeptide comprises SEQ ID NO: 5.
Clause 133. The composition according to any one of clauses 1 to 82 and 1 12 to 132 wherein the gp120 related polypeptide consists of a polypeptide with at least 70% identity with SEQ ID NO: 5. Clause 134. The composition according to clause 133 wherein the gp120 related polypeptide consists of a polypeptide with at least 80% identity with SEQ ID NO: 5.
Clause 135. The composition according to clause 134 wherein the gp120 related polypeptide consists of a polypeptide with at least 90% identity with SEQ ID NO: 5.
Clause 136. The composition according to clause 135 wherein the gp120 related polypeptide consists of a polypeptide with at least 95% identity with SEQ ID NO: 5.
Clause 137. The composition according to clause 136 wherein the gp120 related polypeptide consists of a polypeptide with at least 98% identity with SEQ ID NO: 5.
Clause 138. The composition according to clause 137 wherein the gp120 related polypeptide consists of a polypeptide with at least 99% identity with SEQ ID NO: 5.
Clause 139. The composition according to clause 138 wherein the gp120 related polypeptide consists of SEQ ID NO: 5.
Clause 140. The immunogenic composition according to any one of clauses 1 to 139 wherein the composition further comprises a sterol, wherein the ratio of saponin:sterol is from 1 :1 to 1 :100 w/w.
Clause 141 . The immunogenic composition according to clause 140 wherein the ratio of saponin:sterol is from 1 :1 to 1 :5 w/w.
Clause 142. The immunogenic composition according to either clause 140 or 141 wherein said sterol is cholesterol.
Clause 143. The immunogenic composition according to any one of clauses 1 to 142, which is provided in a multi-dose presentation.
Clause 144. The immunogenic composition according to any one of clauses 1 to 143, which is provided in presentation containing an overage of 1-50% to allow for wastage during administration.
Clause 145. The immunogenic composition according to any one of clauses 1 to 144, for use as a medicament.
Clause 146. The immunogenic composition according to clause 145, for use in the treatment or prevention of HIV-1 from group M, N, O or P.
Clause 147. The immunogenic composition according to clause 146, for use in the treatment or prevention of HIV-1 group M subtype A, B, C, D, E, F, G, H, I, J or K.
Clause 148. The immunogenic composition according to any one of clauses 1 to 147,
wherein the gp120 related polypeptide is derived from a first HIV-1 subtype, for use in the treatment or prevention of HIV-1 infection by a second HIV-1 subtype.
Clause 149. The immunogenic composition according to any one of clauses 1 to 148,
wherein the gp120 related polypeptide is derived from a first HIV-1 subtype, for use in the treatment or prevention of HIV-1 infection by a second HIV-1 subtype, wherein the first and second HIV-1 subtypes have different native gp120 polypeptide sequences.
Clause 150. The immunogenic composition according to clause 149, wherein the first HIV-1 subtype is selected from the list consisting of A, B, C, D, E, F, G, H, I, J or K; of HIV-1 group M.
Clause 151 . The immunogenic composition of any one of clauses 1 to 150 for use in
inducing a humoral immune response against HIV-1 strains from one or more subtypes different from the HIV-1 subtype from which the gp120 related polypeptide of the composition is derived.
Clause 152. The immunogenic composition according to any one of clauses 1 to 151 for use in eliciting antibodies against the V1 V2 loop of HIV-1 gp120.
Clause 153. A method of treatment or prophylaxis of HIV-1 infection comprising the step of administering a composition according to any one of clauses 1 to 152 to an individual.
Clause 154. The method of treatment or prophylaxis of HIV-1 infection according to clause
153 further comprising concomitant administration of an antiretroviral drug.
Clause 155. The method of treatment or prophylaxis of HIV-1 infection according to either clause 153 or 154 wherein IgG antibody capable of binding to the V1V2 region of the gp120 related polypeptide of the composition is detectable in the serum of an individual at least 24 weeks after the only administration of the composition or the first administration of the composition in a course of repeat administrations to the individual.
Clause 156. The method of treatment or prophylaxis of HIV-1 infection according to clause
155 wherein the IgG antibody is detectable at least 48 weeks after the only administration of the composition or the first administration of the composition in a course of repeat administrations to the individual.
Clause 157. The method of treatment or prophylaxis of HIV-1 infection according to clause
156 wherein the IgG antibody is detectable at least 72 weeks after the only administration of the composition or the first administration of the composition in a course of repeat administrations to the individual.
Clause 158. The method of treatment or prophylaxis of HIV-1 infection according to clause
157 wherein the IgG antibody is detectable at least 96 weeks after the only administration of the composition or the first administration of the composition in a course of repeat administrations to the individual. Clause 159. The method of treatment or prophylaxis of HIV-1 infection according to either clause 153 or 154 wherein IgG antibody capable of binding to the V1V2 region of the gp120 related polypeptide of the composition is detectable in the serum of an individual at least 2 weeks after the final administration of the composition in a course of repeat administrations to the individual.
Clause 160. The method of treatment or prophylaxis of HIV-1 infection according to clause
159 wherein the IgG antibody is detectable at least 6 months after the final administration of the composition in a course of repeat administrations to the individual.
Clause 161 . The method of treatment or prophylaxis of HIV-1 infection according to clause
160 wherein the IgG antibody is detectable at least 12 months after the final administration of the composition in a course of repeat administrations to the individual.
Clause 162. The method of treatment or prophylaxis of HIV-1 infection according to clause
161 wherein the IgG antibody is detectable at least 18 months after the final administration of the composition in a course of repeat administrations to the individual.
Clause 163. The method of treatment or prophylaxis of HIV-1 infection according to any one of clauses 155 to 158 wherein antibody levels are detectable at at least 5% of the serum titre two weeks following the only administration.
Clause 164. The method of treatment or prophylaxis of HIV-1 infection according to any one of clauses 155 to 162 wherein antibody levels are detectable at at least 5% of the serum titre two weeks following the first administration.
Clause 165. The method of treatment or prophylaxis of HIV-1 infection according to any one of clauses 159 to 162 wherein antibody levels are detectable at at least 5% of the serum titre two weeks following the final administration.
Clause 166. The method of treatment or prophylaxis according to any one of clauses 155 to
165 wherein the antibody will be detectable in at least 50% of individuals administered with the composition.
Clause 167. The method of treatment or prophylaxis according to clause 166 wherein the antibody will be detectable in at least 80% of individuals administered with the composition.
Clause 168. The method of treatment or prophylaxis according to any one of clauses 153 to
167 wherein a polynucleotide encoding a gp120 related polypeptide is administered to the individual and subsequently the composition according to any one of clauses 1 to 152 is administered to the individual. Clause 169. The method of treatment or prophylaxis according to any one of clauses 153 to 167 wherein the composition according to any one of clauses 1 to 152 is administered to the individual and subsequently a polynucleotide encoding a gp120 related polypeptide is administered to the individual.
Clause 170. A method of reducing the risk of HIV transmission from an HIV-infected individual to a partner of said HIV-infected individual comprising the step of administering the immunogenic composition of any one of clauses 1 to 152 to the HIV-infected individual.
Clause 171 . A method of making the composition according to any one of clauses 1 to 152, comprising adding a gp120 derived polypeptide to a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
Clause 172. A kit for making an immunogenic composition according to any one of clauses 1 to 152, comprising a first container and a second container, wherein the first container comprises a gp120 derived polypeptide and the second container comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
Clause 173 The kit according to clause 172, wherein the second container comprises an aqueous solution.
Clause 174 A viral vector comprising a polynucleotide encoding a polypeptide comprising the gp120W6iD polypeptide of SEQ ID No: 1.
Clause 175. The viral vector of clause 174 comprising a polynucleotide encoding a polypeptide consisting of the gp120W6iD polypeptide of SEQ ID No: 1.
Clause 176. A viral vector comprising a polynucleotide encoding a polypeptide comprising the gp120ZMi8 polypeptide of SEQ ID NO: 5.
Clause 177. The viral vector of clause 176 comprising a polynucleotide encoding a polypeptide consisting of the gp120ZMis polypeptide of SEQ ID NO: 5.
Clause 178. The viral vector of any one of clauses 174 to 177 which is an adenovirus, canary pox virus or MVA virus.
The present invention will now be further described by means of the following non-limiting examples. EXAMPLES
Example 1 : Serology comparison Method
A first composition containing 2ug gp120W6iD and 50ul AS01 B and a second composition containing 2ug gp120W6iD> 50ul AS01 B and 2ug NefTat were prepared. At three timepoints (days 0, 14 and 28), the first composition was administered intramuscularly (I M) to a first group of 25 CB6F1 mice and at the same three timepoints the second composition was administered IM to a second group of 25 CB6F1 mice.
The titre of anti-V1V2 antibodies in the sera of the mice in each group was compared at 14 days after the second administration and at 14 days after the third administration. To evaluate the quantity of anti-V1V2 IgG antibodies present in each serum sample, the HIV-1 subtype B case A2 gp120 V1V2 region scaffolded onto a murine gp70 protein was used in an Igtot ELISA binding antibody assay. During the development of the assay, the CH58 (the anti-V2 monoclonal antibody used in the RV144 trial) was used as a positive control to detect successful binding of serum Igtot antibodies to scaffolded V1V2. In addition, gp70 protein (not bound to a V1V2 region) was used as a negative control to assess specificity during development of the assay.
Results On both timepoints tested, a trend for a higher anti-V1V2 antibody response was observed in serum samples from mice which had been administered with the composition which did not contain NefTat as compared to serum samples from mice which had been administered with the composition containing NefTat. This was particularly notable at 14 days after the third administration (see Figure 1 ).
Example 2: PRO HIV-002 and RV144 trial analysis - anti-V1V2 IgG comparison
Background: The PRO-HIV-002 trial This was a study aimed to determine the safety and immunogenicity of a gp120/NefTat candidate HIV-1 vaccine formulated with one of three different adjuvant systems (AS02A, AS02V and AS01 B) in healthy HIV-seronegative adults. See Leroux-Roels et al., Vaccine 28:7016-7024 (2010) for further details.
Background: The RV144 trial
This was a study aimed to evaluate the efficacy of four priming injections of a recombinant canarypox vector vaccine (ALVAC-HIV [vCP1521 ]) plus two booster injections of a recombinant gp120 subunit vaccine (AIDSVAX B/E) at preventing HIV-1 infection in healthy adults. See Rerks-Ngarm et al, N Engl J Med 361 :2209-2220 (2009) for further details.
Anti-V1V2 IgG comparison Method Serum samples were obtained from 30 subjects from the PRO-HIV-002 trial who had been vaccinated with 20ug gp120W6iD, 20ug NefTat and AS01 B (liposome-based, 50ug MPL and 50ug QS-21 ) at 0, 1 , 3 and 6 months, according to the trial protocol. The serum had been collected at 9 different timepoints. These timepoints were baseline (the first of the four vaccinations, day 0), day 42 (2 weeks after the second vaccination), day 84, day 98 (2 weeks after the third vaccination), day 168, day 182 (2 weeks after the fourth vaccination), day 336, day 504 and day 672 (18 months after the fourth vaccination).
To evaluate the quantity of anti-V1V2 IgG antibodies present in each serum sample, the HIV-1 subtype B case A2 gp120 V1V2 region scaffolded onto a murine gp70 protein was used in an IgG multiplex binding antibody assay, alongside a gp70 control and ConSgp140 (group M consensus gp140). CH58 (the anti-V2 monoclonal antibody used in the RV144 trial) was used to detect successful binding of serum IgG antibodies to scaffolded V1 V2. Samples were run at a dilution of 1 :100. The levels of anti-V1V2 clade B antibodies in the serum samples from the 30 subjects of the PRO-HIV-002 trial were compared to those of 205 vaccinees in the case-control group who remained uninfected in the RV144 trial.
Results The serum samples from the PRO-HIV-002 trial subjects contained a higher level of anti-V1V2 clade B antibodies than the serum samples from the RV144 trial subjects at 2 weeks after the last vaccination in both trials (see Figure 2). The serum samples from the PRO-HIV-002 trial subjects showed a 100% response rate (average: 80.7ug/ml, median 62.2 ug/ml) compared to serum samples from the RV144 trial subjects showing a 64% response rate (average: 4.2 ug/ml, median 1.6 ug/ml).
It was found that anti-V1V2 clade B antibodies in the serum samples from the PRO-HIV-002 trial subjects persisted (87% responders) at 18 months after the fourth priming injection of gp120/NefTat/AS01 B (see Figure 2 and Figure 3). In the RV144 trial, responses to the gp120 V2 loop was reduced 6 months after the final vaccination (Excler et al., Poster TUP231 - IAS 2013 - Kuala Lumpur, Malaysia).
The serum samples from the PRO-HIV-002 trial subjects all contained anti-V1V2 antibodies after the third injection of gp120/NefTat/AS01 B (see Figure 3).
The serum samples from the PRO-HIV-002 trial subjects had a different reactivity profile against varying subtypes of HIV-1 compared to serum samples from the RV144 trial subjects 2 weeks after the last vaccination in both trials (see Figure 4).
All references referred to in this application, including patent and patent applications, are incorporated herein by reference to the fullest extent possible.
Throughout the specification and the claims which follow, unless the context requires otherwise, the word 'comprise', and variations such as 'comprises' and 'comprising', will be understood to imply the inclusion of a stated integer, step, group of integers or group of steps but not to the exclusion of any other integer, step, group of integers or group of steps.
The application of which this description and claims forms part may be used as a basis for priority in respect of any subsequent application. The claims of such subsequent application may be directed to any feature or combination of features described herein. They may take the form of product, composition, process, or use claims and may include, by way of example and without limitation, the following claims.
SEQUENCE LISTING
SEQ ID NO: 1 - qp120Wfi n
AEQLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLGNVTEYFNMWKNNM VDQMHEDI ISLWDQSLKPCVKLTPLCVTLDCDDVNTTNSTTTTSNGWTGEIRKGEIKNCSFNITTSIRDK VQKEYALFYNLDWPIDDDNATTKNKTTRNFRLIHCNSSVMTQACPKVSFEPIPIHYCAPAGFAILKCNN KTFDGKGLCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSDNFMDNTKTI IVQLNESVAI CTRPN NNTRKGIHIGPGRAFYAARKIIGDIRQAHCNLSRAQWNNTLKQIVIKLREHFGNKTIKFNQSSGGDPEIV RHSFNCGGEFFYCDTTQLFNSTWNGTEGNNTEGNSTITLPCRIKQI I MWQEVGKAMYAPPIGGQIRCSS NITGLLLTRDGGTEGNGTENETEIFRPGGGDMRDNWRSELYKYKWKVEPLGVAPTRAKRRVVQR
V1V2 region underlined. SEQ ID NO: 2 - Nef
MGGKWSKSSVVGWPTVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAATNAACAWLEAQEEEEVGFPV TPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFG WCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC
SEQ ID NO: 3 - Tat
EPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSK QPTSQSRGDPTGPKE SEQ ID NO: 4 - NefTat
MGGKWSKSSVVGWPTVRERMRRAEPAADGVGAASRDLEKHGAITSSNTAATNAACAWLEAQEEEEVGFPV TPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFG WCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC|TS]E PVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQ PTSQSRGDPTGPKE
Nef portion: amino acids 1-206
Tat portion: amino acids 209-293 (underlined)
Box: additional linking amino acids introduced in fusion protein
SEQ ID NO: 5 - αο120
GDNLWVTVYYGVPVWKEAKTTLFCASDAKAYEREVHNVWATHACVPTDPNPQEIVLGNVTENFNMWKNDM VDQMHEDI IRLWDQSLKPCVKLTPLCVTLECGNVNVTHENSTKGEMKNCSFNATTELKDKKQRVYALFYK LDIVPLNENNNSSEDSSEYRLINCNTSAITQACPKVTLDPIPIHYCAPAGYAILKCNNKTFNGTGPCHNV STVQCTHGIKPVVSTQLLLNGSLAEEEI IIRSENLTNNAKTI IVHLNESVEIVCTRPSNNTRKSIRIGPG QAFYATGGIIG IRQAHCNISKENWNKTLQKVGKKLAEHFPNKTIKFDQHSGGDLEITTHSFNCRGEFFY CNTSNLFNSTYKPNDTNSTYNPNDTITLPCRIKQIINMWQGVGQAMYAPPIAG ITCKS ITGLLLTRDG GSNDTTNTETFRPGGGDMRDNWRSELYKYKWEIKTLGIAPTAAKRRVVETR
V1V2 region underlined. SEQ ID NO: 6 - polynucleotide sequence encoding qp1207M «
ggagacaacttgtgggtcacagtctattatggggtacctgtgtggaaagaagcaaaaactactttattct gtgcatcagatgctaaagcatatgagagagaagtgcataatgtctgggctacacatgcctgtgtacccac agaccccaacccacaagaaatagttttgggaaatgtaacagaaaattttaacatgtggaaaaatgacatg gtggatcagatgcatgaggatataatcaggttatgggatcaaagcttaaagccatgtgtaaagttgaccc cactctgtgtcactttagaatgtggaaatgttaatgttacccatgagaatagcacgaagggggaaatgaa aaattgctctttcaatgcaaccacagaactaaaagataaaaaacagagagtgtatgcacttttttataaa cttgatatagtaccacttaatgagaataacaactctagtgaggactctagtgagtatagattaataaatt gtaatacctcagccataacacaagcctgtccaaaggtcactttggacccaattcctatacattattgtgc tccagctggatatgcgattctaaagtgtaataataagacattcaatgggacaggaccatgccataatgtc agcacagtacaatgtacacacggaatcaagccagtggtatcaactcaactactgttaaatggtagcctag cagaagaagagataataattaggtctgaaaatctaacaaacaatgccaaaacaataatagtacatcttaa tgaatctgtagaaattgtgtgtacaagacccagcaataatacaagaaaaagtataaggataggaccagga caagcattctatgcaacaggtggcataataggaaacataagacaagcacattgtaacattagtaaagaga actggaataaaactttacaaaaggtaggaaaaaaattagcagagcacttccctaataaaacaataaaatt tgaccaacactcaggaggggacctagaaattacaacacatagctttaattgtagaggagaatttttctat tgcaatacatcaaacctgtttaatagtacatataagcctaatgatacaaatagtacatataatcctaatg atacaatcacactcccatgcagaataaaacaaattataaacatgtggcagggggtaggacaagcaatgta tgcccctcccattgcaggaaacataacatgtaaatcaaatatcacaggactactattgacacgggatgga gggtcaaatgataccacaaacacagagacattcagacctggaggaggagatatgagggacaattggagaa gtgaactatataaatataaagtggtagaaattaaaacattgggcatagcacccactgcggcaaaaaggag agtggtggagacgagataa
SEQ ID NO: 7 - native gp1207M «
GDNLWVTVYYGVPVWKEAKTTLFCASDAKAYEREVHNVWATHACVPTDPNPQEIVLGNVTENFNMWKNDM VDQMHEDI IRLWDQSLKPCVKLTPLCVTLECGNVNVTHENSTKGEMKNCSFNATTELKDKKQRVYALFYK LDIVPLNENNNSSEDSSEYRLINCNTSAITQACPKVTLDPIPIHYCAPAGYAILKCNNKTFNGTGPCHNV STVQCTHGIKPVVSTQLLLNGSLAEEEI IIRSENLTNNAKTI IVHLNESVEIVCTRPSNNTRKSIRIGPG QAFYATGGIIG IRQAHCNISKENWNKTLQKVGKKLAEHFPNKTIKFDQHSGGDLEITTHSFNCRGEFFY CNTSNLFNSTYKPNDTNSTYNPNDTITLPCRIKQIINMWQGVGQAMYAPPIAG ITCKS ITGLLLTRDG GSNDTTNTETFRPGGGDMRDNWRSELYKYKWEIKPLGIAPTAAKRRVVETR
Native gp120ZMis polypeptide sequence contains underlined proline instead of threonine.
SEQ ID NO: 8 - polynucleotide sequence encoding native gp120 M «
ggagacaacttgtgggtcacagtctattatggggtacctgtgtggaaagaagcaaaaactactttattct gtgcatcagatgctaaagcatatgagagagaagtgcataatgtctgggctacacatgcctgtgtacccac agaccccaacccacaagaaatagttttgggaaatgtaacagaaaattttaacatgtggaaaaatgacatg gtggatcagatgcatgaggatataatcaggttatgggatcaaagcttaaagccatgtgtaaagttgaccc cactctgtgtcactttagaatgtggaaatgttaatgttacccatgagaatagcacgaagggggaaatgaa aaattgctctttcaatgcaaccacagaactaaaagataaaaaacagagagtgtatgcacttttttataaa cttgatatagtaccacttaatgagaataacaactctagtgaggactctagtgagtatagattaataaatt gtaatacctcagccataacacaagcctgtccaaaggtcactttggatccaattcctatacattattgtgc tccagctggatatgcgattctaaagtgtaataataagacattcaatgggacaggaccatgccataatgtc agcacagtacaatgtacacacggaatcaagccagtggtatcaactcaactactgttaaatggtagcctag cagaagaagagataataattaggtctgaaaatctaacaaacaatgccaaaacaataatagtacatcttaa tgaatctgtagaaattgtgtgtacaagacccagcaataatacaagaaaaagtataaggataggaccagga caagcattctatgcaacaggtggcataataggaaacataagacaagcacattgtaacattagtaaagaga actggaataaaactttacaaaaggtaggaaaaaaattagcagagcacttccctaataaaacaataaaatt tgaccaacactcaggaggggacctagaaattacaacacatagctttaattgtagaggagaatttttctat tgcaatacatcaaacctgtttaatagtacatataagcctaatgatacaaatagtacatataatcctaatg atacaatcacactcccatgcagaataaaacaaattataaacatgtggcagggggtaggacaagcaatgta tgcccctcccattgcaggaaacataacatgtaaatcaaatatcacaggactactattgacacgggatgga gggtcaaatgataccacaaacacagagacattcagacctggaggaggagatatgagggacaattggagaa gtgaactatataaatataaagtggtagaaattaaaccattgggcatagcacccactgcggcaaaaaggag agtggtggagacgagataa
To produce the gp120ZMi8 polynucleotide sequence from the native gp120ZMi8 polynucleotide sequence:
a) one silent point mutation is introduced (C instead of T at position 597 (underlined).
b) one non-silent point mutation A instead of C is introduced, at position 1426 (underlined) modifying the CCA native codon (proline) for the ACA codon (threonine).

Claims

1. An immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome and wherein the composition is substantially free of a NefTat related polypeptide wherein the NefTat related polypeptide is a polypeptide consisting of SEQ ID NO: 4.
2. An immunogenic composition which is in the form of a human dose comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises between 10-40ug of a lipopolysaccharide and between 10-40ug of an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
3. An immunogenic composition comprising a gp120 related polypeptide and an adjuvant, wherein the adjuvant comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome wherein:
(i) the conductivity of the composition is 13 mS/cm or lower; and/or
(ii) the concentration of salts in said composition is 130 mM or lower; and/or
(iii) the concentration of sodium chloride in said composition is 130 mM or lower.
4. The immunogenic composition according to either claim 2 or 3, which is substantially free of a NefTat related polypeptide wherein the NefTat related polypeptide is a polypeptide consisting of SEQ ID NO: 4.
5. The immunogenic composition according to any one of claims 1 , 3 or 4 wherein the lipopolysaccharide is present at a level of between 10-100ug.
6. The immunogenic composition according to any one of claims 1 or 3 to 5 wherein the saponin is present at a level of between 10-100ug.
7. The immunogenic composition according to any one of claims 1 to 6 wherein the lipopolysaccharide is 3D-MPL.
8. The immunogenic composition according to any one of claims 1 to 7 wherein the saponin is QS-21 .
9. The immunogenic composition according to any one of claims 1 , 2 or 4 to 8 wherein:
(i) the conductivity of the composition is 13 mS/cm or lower; and/or
(ii) the concentration of salts in said composition is 130 mM or lower; and/or
(iii) the concentration of sodium chloride in said composition is 130 mM or lower.
10. The immunogenic composition according to any one of claims 1 to 9 which is an aqueous solution.
1 1 . The immunogenic composition according to any one of claims 1 to 10 which is a single human dose.
12. The immunogenic composition according to any one of claims 1 to 1 1 wherein the human dose is between 0.1 and 1 ml.
13. The immunogenic composition according to any one of claims 1 to 12, comprising a non-ionic tonicity agent.
14. The immunogenic composition according to any one of claims 1 to 13 wherein the composition comprises the gp120 related polypeptide at a level of around 1 to 100 ug.
15. The immunogenic composition according to any one of claims 1 to 14 wherein the composition comprises 1-5 additional HIV antigens.
16. The composition according to any one of claims 1 to 15 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 1.
17. The composition according to any one of claims 1 to 16 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 1 .
18. The composition according to any one of claims 1 to 15 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with the V1V2 region of SEQ ID NO: 5.
19. The composition according to any one of claims 1 to 16 wherein the gp120 related polypeptide comprises a polypeptide with at least 70% identity with SEQ ID NO: 5.
20. The immunogenic composition according to any one of claims 1 to 19 wherein the composition further comprises a sterol, wherein the ratio of saponin:sterol is from 1 :1 to 1 :100 w/w.
21 . The immunogenic composition according to any one of claims 1 to 20, for use in the treatment or prevention of HIV-1 from group M, N, O or P.
22. The immunogenic composition according to any one of claims 1 to 20, for use in the treatment or prevention of HIV-1 group M subtype A, B, C, D, E, F, G, H, I, J or K.
23. The immunogenic composition according to any one of claims 1 to 22, wherein the gp120 related polypeptide is derived from a first HIV-1 subtype, for use in the treatment or prevention of HIV-1 infection by a second HIV-1 subtype, wherein the first and second HIV-1 subtypes have different native gp120 polypeptide sequences.
24. The immunogenic composition according to any one of claims 1 to 23 for use in eliciting antibodies against the V1V2 loop of HIV-1 gp120.
25. The immunogenic composition according to any one of claims 1 to 23 for use in the treatment or prophylaxis of HIV infection wherein a polynucleotide encoding a gp120 related polypeptide is administered to the individual and subsequently the composition according to any one of claims 1 to 24 is administered to the individual.
26. The immunogenic composition according to any one of claims 1 to 23 for use in the treatment or prophylaxis of HIV infection wherein the composition according to any one of claims 1 to 23 is administered to the individual and subsequently a polynucleotide encoding a gp120 related polypeptide is administered to the individual.
27. A method of treatment or prophylaxis of HIV-1 infection comprising the step of
administering a composition according to any one of claims 1 to 26 to an individual. A method of reducing the risk of HIV transmission from an HIV-infected individual to a partner of said HIV-infected individual comprising the step of administering the immunogenic composition of any one of claims 1 to 26 to the HIV-infected individual.
A method of making the composition according to any one of claims 1 to 26, comprising adding a gp120 derived polypeptide to a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
A kit for making an immunogenic composition according to any one of claims 1 to 26, comprising a first container and a second container, wherein the first container comprises a gp120 derived polypeptide and the second container comprises a lipopolysaccharide and an immunologically active saponin fraction derived from the bark of Quillaja Saponaria Molina presented in the form of a liposome.
A viral vector comprising a polynucleotide encoding a polypeptide comprising the gp120w6iD polypeptide of SEQ ID No: 1.
32. A viral vector comprising a polynucleotide encoding a polypeptide comprising the gp120ZMi8 polypeptide of SEQ ID NO: 5.
PCT/EP2013/073365 2013-09-16 2013-11-08 Novel compositions Ceased WO2015036062A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CA2851871A CA2851871A1 (en) 2013-09-16 2014-05-08 Novel compositions

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GB1316464.5 2013-09-16
GBGB1316464.5A GB201316464D0 (en) 2013-09-16 2013-09-16 Novel compositions

Publications (1)

Publication Number Publication Date
WO2015036062A1 true WO2015036062A1 (en) 2015-03-19

Family

ID=49552736

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/073365 Ceased WO2015036062A1 (en) 2013-09-16 2013-11-08 Novel compositions

Country Status (5)

Country Link
BE (1) BE1021327B1 (en)
CA (1) CA2851871A1 (en)
GB (1) GB201316464D0 (en)
IE (1) IE86613B1 (en)
WO (1) WO2015036062A1 (en)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005035555A1 (en) * 2003-10-10 2005-04-21 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Hiv/siv env chimeras that promote trimerization and maintain targets of neutralizing antibodies
WO2010023260A1 (en) * 2008-09-01 2010-03-04 Glaxosmithkline Biologicals S.A. Vaccine compositions
WO2011117408A1 (en) * 2010-03-26 2011-09-29 Glaxosmithkline Biologicals S.A. Hiv vaccine

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005035555A1 (en) * 2003-10-10 2005-04-21 The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Hiv/siv env chimeras that promote trimerization and maintain targets of neutralizing antibodies
WO2010023260A1 (en) * 2008-09-01 2010-03-04 Glaxosmithkline Biologicals S.A. Vaccine compositions
WO2011117408A1 (en) * 2010-03-26 2011-09-29 Glaxosmithkline Biologicals S.A. Hiv vaccine

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
BARNA DEY ET AL: "Structure-Based Stabilization of HIV-1 gp120 Enhances Humoral Immune Responses to the Induced Co-Receptor Binding Site", PLOS PATHOGENS, vol. 5, no. 5, 1 May 2009 (2009-05-01), pages e1000445 - e1000445, XP055045259, ISSN: 1553-7366, DOI: 10.1371/journal.ppat.1000445 *
BEDDOWS SIMON ET AL: "Comparison of the antibody repertoire generated in healthy volunteers following immunization with a monomeric recombinant gp120 construct derived from a CCR5/CXCR4-using human immunodeficiency virus type 1 isolate with sera from naturally infected individuals", JOURNAL OF VIROLOGY, vol. 73, no. 2, February 1999 (1999-02-01), pages 1740 - 1745, XP002718160, ISSN: 0022-538X *
EVA VAN BRAECKEL ET AL: "An adjuvanted polyprotein HIV-1 vaccine induces polyfunctional cross-reactive CD4+ T cell responses in seronegative volunteers", CLINICAL INFECTIOUS DISEASES, THE UNIVERSITY OF CHICAGO PRESS, CHICAGO, IL, US, vol. 52, no. 4, 15 February 2011 (2011-02-15), pages 522 - 531, XP002639982, ISSN: 1058-4838, [retrieved on 20110105], DOI: 10.1093/CID/CIQ160 *
LEROUX-ROELS I ET AL: "Strong and persistent CD4<+> T-cell response in healthy adults immunized with a candidate HIV-1 vaccine containing gp120, Nef and Tat antigens formulated in three Adjuvant Systems", VACCINE, ELSEVIER LTD, GB, vol. 28, no. 43, 8 October 2010 (2010-10-08), pages 7016 - 7024, XP027392051, ISSN: 0264-410X, [retrieved on 20100820] *
LI Y ET AL: "Characterization of antibody responses elicited by human immunodeficiency virus type 1 primary isolate trimeric and monomeric envelope glycoproteins in selected adjuvants", JOURNAL OF VIROLOGY, THE AMERICAN SOCIETY FOR MICROBIOLOGY, US, vol. 80, no. 3, 1 February 2006 (2006-02-01), pages 1414 - 1426, XP009115093, ISSN: 0022-538X, DOI: 10.1128/JVI.80.3.1414 1426.2006 *
MCCORMACK S ET AL: "A phase I trial in HIV negative healthy volunteers evaluating the effect of potent adjuvants on immunogenicity of a recombinant gp120W61D derived from dual tropic R5X4 HIV-1ACH320", VACCINE, vol. 18, no. 13, January 2000 (2000-01-01), pages 1166 - 1177, XP002718159, ISSN: 0264-410X *
VANDEPAPELIERE ET AL: "Vaccine Adjuvant Systems containing monophosphoryl lipid A and QS21 induce strong and persistent humoral and T cell responses against hepatitis B surface antigen in healthy adult volunteers", VACCINE, ELSEVIER LTD, GB, vol. 26, no. 10, 14 January 2008 (2008-01-14), pages 1375 - 1386, XP022492632, ISSN: 0264-410X, DOI: 10.1016/J.VACCINE.2007.12.038 *

Also Published As

Publication number Publication date
GB201316464D0 (en) 2013-10-30
CA2851871A1 (en) 2015-03-16
IE20130343A1 (en) 2015-03-25
BE1021327B1 (en) 2015-10-29
IE86613B1 (en) 2016-01-13

Similar Documents

Publication Publication Date Title
CA2505583C (en) Polyvalent, primary hiv-1 glycoprotein dna vaccines and vaccination methods
Courtney et al. Alpha-galactosylceramide is an effective mucosal adjuvant for repeated intranasal or oral delivery of HIV peptide antigens
US20140234399A1 (en) Hiv vaccine
US10729762B2 (en) HIV immune stimulating compositions comprising recombinantly expressed pili on bacteria and methods related thereto
Vajdy et al. Mucosal and systemic anti-HIV responses in rhesus macaques following combinations of intranasal and parenteral immunizations
WO2015036061A1 (en) Novel compositions
US20210138062A1 (en) Compositions and methods to treat aids
US20070253979A1 (en) Immunogenic Hiv Compositions and Related Methods
CN116212012A (en) Complex adjuvant and vaccine formulation comprising the same
WO2015036062A1 (en) Novel compositions
CA2851852A1 (en) Novel compositions
US9682137B2 (en) Mutant human and simian immunodeficiency virus ENV proteins with reduced immunosuppressive properties
BR102014011184A2 (en) immunogenic composition, methods of treatment or prophylaxis of infection, to reduce the risk of HIV transmission, and to produce a viral composition, kit, and vector
JP2009536653A (en) HIV-1 immunogenic composition
Fresneda-Mora et al. Relevancia del antígeno Gag para el desarrollo de candidatos vacunales contra el VIH-1
Fresneda-Mora et al. Relevance of the Gag antigen for developing vaccine candidates against HIV-1
US20130149323A1 (en) Mutated lentiviral env proteins and their use as drugs
Buglione-Corbett Adjuvant-Specific Serum Cytokine Profiles in the Context of a DNA Prime-Protein Boost HIV-1 Vaccine: A Dissertation
KR20070019635A (en) Immunogenic HIV Compositions and Related Methods
HK1159485A1 (en) Vaccine composition containing synthetic adjuvant
HK1159485B (en) Vaccine composition containing synthetic adjuvant

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13789769

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 13789769

Country of ref document: EP

Kind code of ref document: A1