WO2014204724A1 - Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation - Google Patents
Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation Download PDFInfo
- Publication number
- WO2014204724A1 WO2014204724A1 PCT/US2014/041800 US2014041800W WO2014204724A1 WO 2014204724 A1 WO2014204724 A1 WO 2014204724A1 US 2014041800 W US2014041800 W US 2014041800W WO 2014204724 A1 WO2014204724 A1 WO 2014204724A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- tracr
- guide
- target
- crispr
- Prior art date
Links
- 238000000034 method Methods 0.000 title claims abstract description 286
- 239000000203 mixture Substances 0.000 title claims abstract description 100
- 238000012384 transportation and delivery Methods 0.000 title abstract description 74
- 238000005457 optimization Methods 0.000 title abstract description 15
- 108091033409 CRISPR Proteins 0.000 claims abstract description 304
- 239000013598 vector Substances 0.000 claims abstract description 192
- 230000000694 effects Effects 0.000 claims abstract description 69
- 238000010354 CRISPR gene editing Methods 0.000 claims abstract 27
- 108090000623 proteins and genes Proteins 0.000 claims description 294
- 210000004027 cell Anatomy 0.000 claims description 266
- 102000040430 polynucleotide Human genes 0.000 claims description 243
- 108091033319 polynucleotide Proteins 0.000 claims description 243
- 239000002157 polynucleotide Substances 0.000 claims description 243
- 102000004190 Enzymes Human genes 0.000 claims description 232
- 108090000790 Enzymes Proteins 0.000 claims description 232
- 230000014509 gene expression Effects 0.000 claims description 156
- 108020004414 DNA Proteins 0.000 claims description 138
- 102000004169 proteins and genes Human genes 0.000 claims description 120
- 108020005004 Guide RNA Proteins 0.000 claims description 102
- 230000035772 mutation Effects 0.000 claims description 91
- 238000003776 cleavage reaction Methods 0.000 claims description 88
- 230000007017 scission Effects 0.000 claims description 88
- 241000282414 Homo sapiens Species 0.000 claims description 85
- 125000003729 nucleotide group Chemical group 0.000 claims description 80
- 239000002773 nucleotide Substances 0.000 claims description 77
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 74
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 65
- 201000010099 disease Diseases 0.000 claims description 58
- 101000910035 Streptococcus pyogenes serotype M1 CRISPR-associated endonuclease Cas9/Csn1 Proteins 0.000 claims description 56
- 230000001105 regulatory effect Effects 0.000 claims description 54
- 230000004048 modification Effects 0.000 claims description 46
- 238000012986 modification Methods 0.000 claims description 46
- 230000001939 inductive effect Effects 0.000 claims description 39
- 108091092236 Chimeric RNA Proteins 0.000 claims description 37
- 239000013603 viral vector Substances 0.000 claims description 36
- 238000001727 in vivo Methods 0.000 claims description 34
- 238000009739 binding Methods 0.000 claims description 29
- 230000009870 specific binding Effects 0.000 claims description 29
- 230000027455 binding Effects 0.000 claims description 28
- 230000006870 function Effects 0.000 claims description 27
- 230000005782 double-strand break Effects 0.000 claims description 26
- 101710163270 Nuclease Proteins 0.000 claims description 24
- 230000030648 nucleus localization Effects 0.000 claims description 23
- 108010008532 Deoxyribonuclease I Proteins 0.000 claims description 21
- 102000007260 Deoxyribonuclease I Human genes 0.000 claims description 21
- 230000034431 double-strand break repair via homologous recombination Effects 0.000 claims description 20
- 102220605874 Cytosolic arginine sensor for mTORC1 subunit 2_D10A_mutation Human genes 0.000 claims description 19
- 210000001808 exosome Anatomy 0.000 claims description 18
- 239000002105 nanoparticle Substances 0.000 claims description 18
- 238000012217 deletion Methods 0.000 claims description 15
- 230000037430 deletion Effects 0.000 claims description 15
- 230000002829 reductive effect Effects 0.000 claims description 15
- 230000009467 reduction Effects 0.000 claims description 13
- 230000003197 catalytic effect Effects 0.000 claims description 11
- 239000003814 drug Substances 0.000 claims description 11
- 238000004519 manufacturing process Methods 0.000 claims description 11
- 230000008859 change Effects 0.000 claims description 10
- YAWWQIFONIPBKT-HXUWFJFHSA-N 2-[[(2r)-2-butyl-6,7-dichloro-2-cyclopentyl-1-oxo-3h-inden-5-yl]oxy]acetic acid Chemical compound C1([C@@]2(C(C3=C(Cl)C(Cl)=C(OCC(O)=O)C=C3C2)=O)CCCC)CCCC1 YAWWQIFONIPBKT-HXUWFJFHSA-N 0.000 claims description 8
- 230000000087 stabilizing effect Effects 0.000 claims description 8
- 230000007547 defect Effects 0.000 claims description 5
- 229940046166 oligodeoxynucleotide Drugs 0.000 claims description 3
- 230000002265 prevention Effects 0.000 claims 2
- 101100026709 Mus musculus Nprl3 gene Proteins 0.000 claims 1
- 210000003527 eukaryotic cell Anatomy 0.000 abstract description 33
- 231100000419 toxicity Toxicity 0.000 abstract description 9
- 230000001988 toxicity Effects 0.000 abstract description 9
- 238000013461 design Methods 0.000 abstract description 8
- 210000001236 prokaryotic cell Anatomy 0.000 abstract description 8
- 230000009918 complex formation Effects 0.000 abstract description 3
- 229940088598 enzyme Drugs 0.000 description 227
- 235000018102 proteins Nutrition 0.000 description 114
- 150000007523 nucleic acids Chemical class 0.000 description 75
- 239000000047 product Substances 0.000 description 72
- 102000039446 nucleic acids Human genes 0.000 description 61
- 108020004707 nucleic acids Proteins 0.000 description 61
- 238000003556 assay Methods 0.000 description 42
- 230000008685 targeting Effects 0.000 description 41
- 108020004999 messenger RNA Proteins 0.000 description 35
- 235000001014 amino acid Nutrition 0.000 description 33
- 229940024606 amino acid Drugs 0.000 description 32
- 108020004705 Codon Proteins 0.000 description 31
- 241000196324 Embryophyta Species 0.000 description 31
- 150000001413 amino acids Chemical class 0.000 description 31
- -1 RecBCD Proteins 0.000 description 30
- 238000010362 genome editing Methods 0.000 description 30
- 210000001519 tissue Anatomy 0.000 description 30
- 241001465754 Metazoa Species 0.000 description 29
- 239000002245 particle Substances 0.000 description 28
- 230000008238 biochemical pathway Effects 0.000 description 27
- 230000011664 signaling Effects 0.000 description 27
- 239000013612 plasmid Substances 0.000 description 26
- 241000699666 Mus <mouse, genus> Species 0.000 description 24
- 238000009396 hybridization Methods 0.000 description 23
- 239000000523 sample Substances 0.000 description 23
- 241000701161 unidentified adenovirus Species 0.000 description 22
- 230000003612 virological effect Effects 0.000 description 22
- 108091028043 Nucleic acid sequence Proteins 0.000 description 21
- 241000193996 Streptococcus pyogenes Species 0.000 description 21
- 238000003780 insertion Methods 0.000 description 21
- 230000037431 insertion Effects 0.000 description 21
- 210000004940 nucleus Anatomy 0.000 description 21
- 238000013518 transcription Methods 0.000 description 21
- 230000035897 transcription Effects 0.000 description 21
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 20
- 241000700605 Viruses Species 0.000 description 20
- 239000013604 expression vector Substances 0.000 description 20
- 230000008569 process Effects 0.000 description 20
- 210000004556 brain Anatomy 0.000 description 19
- 230000001404 mediated effect Effects 0.000 description 19
- 208000009869 Neu-Laxova syndrome Diseases 0.000 description 18
- 230000008439 repair process Effects 0.000 description 18
- 238000011144 upstream manufacturing Methods 0.000 description 18
- 230000015572 biosynthetic process Effects 0.000 description 17
- 238000004806 packaging method and process Methods 0.000 description 17
- 125000006850 spacer group Chemical group 0.000 description 17
- 238000001890 transfection Methods 0.000 description 17
- 102000053602 DNA Human genes 0.000 description 16
- 241000191967 Staphylococcus aureus Species 0.000 description 16
- 238000013459 approach Methods 0.000 description 16
- 239000003795 chemical substances by application Substances 0.000 description 16
- 230000000295 complement effect Effects 0.000 description 16
- 239000000499 gel Substances 0.000 description 16
- 239000005090 green fluorescent protein Substances 0.000 description 16
- 108090000765 processed proteins & peptides Proteins 0.000 description 16
- 201000003883 Cystic fibrosis Diseases 0.000 description 15
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 15
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 15
- 241000894007 species Species 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 15
- 238000000338 in vitro Methods 0.000 description 14
- 102000004196 processed proteins & peptides Human genes 0.000 description 14
- 239000004055 small Interfering RNA Substances 0.000 description 14
- 238000012360 testing method Methods 0.000 description 14
- 241000124008 Mammalia Species 0.000 description 13
- 238000005516 engineering process Methods 0.000 description 13
- 238000001415 gene therapy Methods 0.000 description 13
- 230000001965 increasing effect Effects 0.000 description 13
- 210000002569 neuron Anatomy 0.000 description 13
- 230000010076 replication Effects 0.000 description 13
- 230000009261 transgenic effect Effects 0.000 description 13
- 239000013607 AAV vector Substances 0.000 description 12
- 101000931098 Homo sapiens DNA (cytosine-5)-methyltransferase 1 Proteins 0.000 description 12
- 108020004459 Small interfering RNA Proteins 0.000 description 12
- 238000004422 calculation algorithm Methods 0.000 description 12
- 230000004927 fusion Effects 0.000 description 12
- 230000010354 integration Effects 0.000 description 12
- 230000007018 DNA scission Effects 0.000 description 11
- 238000004458 analytical method Methods 0.000 description 11
- 230000003247 decreasing effect Effects 0.000 description 10
- 238000002744 homologous recombination Methods 0.000 description 10
- 230000006801 homologous recombination Effects 0.000 description 10
- 210000004962 mammalian cell Anatomy 0.000 description 10
- 230000006780 non-homologous end joining Effects 0.000 description 10
- 241000894006 Bacteria Species 0.000 description 9
- 108091079001 CRISPR RNA Proteins 0.000 description 9
- 108091026890 Coding region Proteins 0.000 description 9
- 239000000872 buffer Substances 0.000 description 9
- 238000006243 chemical reaction Methods 0.000 description 9
- 239000002502 liposome Substances 0.000 description 9
- 210000004185 liver Anatomy 0.000 description 9
- 229920001184 polypeptide Polymers 0.000 description 9
- 239000000126 substance Substances 0.000 description 9
- 102100036279 DNA (cytosine-5)-methyltransferase 1 Human genes 0.000 description 8
- 241000282412 Homo Species 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 8
- 230000003321 amplification Effects 0.000 description 8
- 238000009472 formulation Methods 0.000 description 8
- 102000037865 fusion proteins Human genes 0.000 description 8
- 108020001507 fusion proteins Proteins 0.000 description 8
- 230000002068 genetic effect Effects 0.000 description 8
- 229910052740 iodine Inorganic materials 0.000 description 8
- 238000003199 nucleic acid amplification method Methods 0.000 description 8
- 230000006798 recombination Effects 0.000 description 8
- 238000005215 recombination Methods 0.000 description 8
- 230000001603 reducing effect Effects 0.000 description 8
- 238000010361 transduction Methods 0.000 description 8
- 230000026683 transduction Effects 0.000 description 8
- 102100026008 Breakpoint cluster region protein Human genes 0.000 description 7
- 241000238631 Hexapoda Species 0.000 description 7
- 101000933320 Homo sapiens Breakpoint cluster region protein Proteins 0.000 description 7
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 7
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 7
- 125000003275 alpha amino acid group Chemical group 0.000 description 7
- 230000001580 bacterial effect Effects 0.000 description 7
- 230000008901 benefit Effects 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 230000001419 dependent effect Effects 0.000 description 7
- 238000001514 detection method Methods 0.000 description 7
- 208000035475 disorder Diseases 0.000 description 7
- 239000003623 enhancer Substances 0.000 description 7
- 210000005260 human cell Anatomy 0.000 description 7
- 239000011159 matrix material Substances 0.000 description 7
- 244000052769 pathogen Species 0.000 description 7
- 238000012216 screening Methods 0.000 description 7
- 238000012546 transfer Methods 0.000 description 7
- 241000701022 Cytomegalovirus Species 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 108091029865 Exogenous DNA Proteins 0.000 description 6
- 241000700159 Rattus Species 0.000 description 6
- 230000002159 abnormal effect Effects 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 125000000539 amino acid group Chemical group 0.000 description 6
- 239000012634 fragment Substances 0.000 description 6
- 238000001638 lipofection Methods 0.000 description 6
- 231100000350 mutagenesis Toxicity 0.000 description 6
- 230000003287 optical effect Effects 0.000 description 6
- 229920000642 polymer Polymers 0.000 description 6
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 230000001177 retroviral effect Effects 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 241001655883 Adeno-associated virus - 1 Species 0.000 description 5
- 241001634120 Adeno-associated virus - 5 Species 0.000 description 5
- 238000010453 CRISPR/Cas method Methods 0.000 description 5
- 108700010070 Codon Usage Proteins 0.000 description 5
- 241000702421 Dependoparvovirus Species 0.000 description 5
- 241000588724 Escherichia coli Species 0.000 description 5
- 102100027581 Forkhead box protein P3 Human genes 0.000 description 5
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 5
- 101000861452 Homo sapiens Forkhead box protein P3 Proteins 0.000 description 5
- 102100021244 Integral membrane protein GPR180 Human genes 0.000 description 5
- 108091092195 Intron Proteins 0.000 description 5
- 102100033819 Nuclear pore complex protein Nup214 Human genes 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- 108020004566 Transfer RNA Proteins 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 238000001994 activation Methods 0.000 description 5
- 210000003855 cell nucleus Anatomy 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 239000003153 chemical reaction reagent Substances 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 229940079593 drug Drugs 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 239000001257 hydrogen Substances 0.000 description 5
- 230000005847 immunogenicity Effects 0.000 description 5
- 230000011987 methylation Effects 0.000 description 5
- 238000007069 methylation reaction Methods 0.000 description 5
- 230000009437 off-target effect Effects 0.000 description 5
- 230000037361 pathway Effects 0.000 description 5
- 238000013519 translation Methods 0.000 description 5
- 241001430294 unidentified retrovirus Species 0.000 description 5
- 238000001262 western blot Methods 0.000 description 5
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 4
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 4
- 102000009027 Albumins Human genes 0.000 description 4
- 108010088751 Albumins Proteins 0.000 description 4
- 102100025399 Breast cancer type 2 susceptibility protein Human genes 0.000 description 4
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 4
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 4
- 108010077544 Chromatin Proteins 0.000 description 4
- 241000195493 Cryptophyta Species 0.000 description 4
- 101710195240 Cysteine-rich venom protein Proteins 0.000 description 4
- 102100026234 Cytokine receptor common subunit gamma Human genes 0.000 description 4
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 4
- 102100022630 Glutamate receptor ionotropic, NMDA 2B Human genes 0.000 description 4
- 108010070675 Glutathione transferase Proteins 0.000 description 4
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 4
- 108010033040 Histones Proteins 0.000 description 4
- 101000797762 Homo sapiens C-C motif chemokine 5 Proteins 0.000 description 4
- 101001055227 Homo sapiens Cytokine receptor common subunit gamma Proteins 0.000 description 4
- 101000972850 Homo sapiens Glutamate receptor ionotropic, NMDA 2B Proteins 0.000 description 4
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 4
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 4
- 102100031014 Phosphatidylinositol-binding clathrin assembly protein Human genes 0.000 description 4
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 4
- 102000001435 Synapsin Human genes 0.000 description 4
- 108050009621 Synapsin Proteins 0.000 description 4
- 102100033019 Tyrosine-protein phosphatase non-receptor type 11 Human genes 0.000 description 4
- 230000000692 anti-sense effect Effects 0.000 description 4
- 229960002685 biotin Drugs 0.000 description 4
- 239000011616 biotin Substances 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 230000003915 cell function Effects 0.000 description 4
- 210000003483 chromatin Anatomy 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 238000004590 computer program Methods 0.000 description 4
- 210000003618 cortical neuron Anatomy 0.000 description 4
- 238000012350 deep sequencing Methods 0.000 description 4
- 208000037765 diseases and disorders Diseases 0.000 description 4
- 230000001973 epigenetic effect Effects 0.000 description 4
- 238000003209 gene knockout Methods 0.000 description 4
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 150000002632 lipids Chemical class 0.000 description 4
- 210000001161 mammalian embryo Anatomy 0.000 description 4
- 239000003550 marker Substances 0.000 description 4
- 239000002679 microRNA Substances 0.000 description 4
- 238000002703 mutagenesis Methods 0.000 description 4
- 239000013600 plasmid vector Substances 0.000 description 4
- 238000003259 recombinant expression Methods 0.000 description 4
- 238000011160 research Methods 0.000 description 4
- 230000002441 reversible effect Effects 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 210000000130 stem cell Anatomy 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 230000002103 transcriptional effect Effects 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 241000701447 unidentified baculovirus Species 0.000 description 4
- 241001529453 unidentified herpesvirus Species 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- KCYOZNARADAZIZ-CWBQGUJCSA-N 2-[(2e,4e,6e,8e,10e,12e,14e)-15-(4,4,7a-trimethyl-2,5,6,7-tetrahydro-1-benzofuran-2-yl)-6,11-dimethylhexadeca-2,4,6,8,10,12,14-heptaen-2-yl]-4,4,7a-trimethyl-2,5,6,7-tetrahydro-1-benzofuran-6-ol Chemical compound O1C2(C)CC(O)CC(C)(C)C2=CC1C(\C)=C\C=C\C(\C)=C\C=C\C=C(/C)\C=C\C=C(/C)C1C=C2C(C)(C)CCCC2(C)O1 KCYOZNARADAZIZ-CWBQGUJCSA-N 0.000 description 3
- 206010003805 Autism Diseases 0.000 description 3
- 208000020706 Autistic disease Diseases 0.000 description 3
- 102100032937 CD40 ligand Human genes 0.000 description 3
- 101000909256 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) DNA polymerase I Proteins 0.000 description 3
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 3
- 102100026735 Coagulation factor VIII Human genes 0.000 description 3
- KCYOZNARADAZIZ-PPBBKLJYSA-N Cryptochrome Natural products O[C@@H]1CC(C)(C)C=2[C@@](C)(O[C@H](/C(=C\C=C\C(=C/C=C/C=C(\C=C\C=C(\C)/[C@H]3O[C@@]4(C)C(C(C)(C)CCC4)=C3)/C)\C)/C)C=2)C1 KCYOZNARADAZIZ-PPBBKLJYSA-N 0.000 description 3
- 108010037139 Cryptochromes Proteins 0.000 description 3
- 230000004568 DNA-binding Effects 0.000 description 3
- 101710096438 DNA-binding protein Proteins 0.000 description 3
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 3
- 102100028554 Dual specificity tyrosine-phosphorylation-regulated kinase 1A Human genes 0.000 description 3
- 102100031690 Erythroid transcription factor Human genes 0.000 description 3
- 241000206602 Eukaryota Species 0.000 description 3
- 102100027280 Fanconi anemia group A protein Human genes 0.000 description 3
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 description 3
- 101000934858 Homo sapiens Breast cancer type 2 susceptibility protein Proteins 0.000 description 3
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 description 3
- 101000911390 Homo sapiens Coagulation factor VIII Proteins 0.000 description 3
- 101000907783 Homo sapiens Cystic fibrosis transmembrane conductance regulator Proteins 0.000 description 3
- 101000838016 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 1A Proteins 0.000 description 3
- 101000891683 Homo sapiens Fanconi anemia group D2 protein Proteins 0.000 description 3
- 101000852815 Homo sapiens Insulin receptor Proteins 0.000 description 3
- 101000677891 Homo sapiens Iron-sulfur clusters transporter ABCB7, mitochondrial Proteins 0.000 description 3
- 101000996563 Homo sapiens Nuclear pore complex protein Nup214 Proteins 0.000 description 3
- 101000932478 Homo sapiens Receptor-type tyrosine-protein kinase FLT3 Proteins 0.000 description 3
- 101000927774 Homo sapiens Rho guanine nucleotide exchange factor 12 Proteins 0.000 description 3
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 3
- 101000671676 Homo sapiens U3 small nucleolar RNA-associated protein 4 homolog Proteins 0.000 description 3
- 241000725303 Human immunodeficiency virus Species 0.000 description 3
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 3
- 102100034349 Integrase Human genes 0.000 description 3
- 102000013691 Interleukin-17 Human genes 0.000 description 3
- 108050003558 Interleukin-17 Proteins 0.000 description 3
- 102100021504 Iron-sulfur clusters transporter ABCB7, mitochondrial Human genes 0.000 description 3
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 206010028980 Neoplasm Diseases 0.000 description 3
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 3
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 3
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 3
- 108010043958 Peptoids Proteins 0.000 description 3
- 241000288906 Primates Species 0.000 description 3
- 101000902592 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) DNA polymerase Proteins 0.000 description 3
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 3
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 102100033193 Rho guanine nucleotide exchange factor 12 Human genes 0.000 description 3
- 241000714474 Rous sarcoma virus Species 0.000 description 3
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 3
- 102100040072 U3 small nucleolar RNA-associated protein 4 homolog Human genes 0.000 description 3
- 102100037111 Uracil-DNA glycosylase Human genes 0.000 description 3
- 241000700618 Vaccinia virus Species 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 206010002022 amyloidosis Diseases 0.000 description 3
- KCYOZNARADAZIZ-XZOHMNSDSA-N beta-cryptochrome Natural products CC(=C/C=C/C=C(C)/C=C/C=C(C)/C1OC2(C)CC(O)CC(C)(C)C2=C1)C=CC=C(/C)C3OC4(C)CCCC(C)(C)C4=C3 KCYOZNARADAZIZ-XZOHMNSDSA-N 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 210000000234 capsid Anatomy 0.000 description 3
- 108020001778 catalytic domains Proteins 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 230000005754 cellular signaling Effects 0.000 description 3
- 230000004186 co-expression Effects 0.000 description 3
- 239000013078 crystal Substances 0.000 description 3
- 238000012258 culturing Methods 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 230000002255 enzymatic effect Effects 0.000 description 3
- 210000002950 fibroblast Anatomy 0.000 description 3
- 230000007614 genetic variation Effects 0.000 description 3
- 229910052737 gold Inorganic materials 0.000 description 3
- 239000010931 gold Substances 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 210000002443 helper t lymphocyte Anatomy 0.000 description 3
- 102000047882 human INSR Human genes 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 210000003734 kidney Anatomy 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 210000004779 membrane envelope Anatomy 0.000 description 3
- 238000000520 microinjection Methods 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 108091027963 non-coding RNA Proteins 0.000 description 3
- 102000042567 non-coding RNA Human genes 0.000 description 3
- 239000002853 nucleic acid probe Substances 0.000 description 3
- 229960003104 ornithine Drugs 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 108020001580 protein domains Proteins 0.000 description 3
- 238000011002 quantification Methods 0.000 description 3
- 102000005912 ran GTP Binding Protein Human genes 0.000 description 3
- 230000003252 repetitive effect Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 238000002864 sequence alignment Methods 0.000 description 3
- 210000004895 subcellular structure Anatomy 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 238000012795 verification Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 2
- 102100033051 40S ribosomal protein S19 Human genes 0.000 description 2
- 102100031020 5-aminolevulinate synthase, erythroid-specific, mitochondrial Human genes 0.000 description 2
- 241000580270 Adeno-associated virus - 4 Species 0.000 description 2
- 102100020895 Ammonium transporter Rh type A Human genes 0.000 description 2
- 108091093088 Amplicon Proteins 0.000 description 2
- 102100040894 Amylo-alpha-1,6-glucosidase Human genes 0.000 description 2
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 description 2
- 102100030343 Antigen peptide transporter 2 Human genes 0.000 description 2
- 241000203069 Archaea Species 0.000 description 2
- 208000000659 Autoimmune lymphoproliferative syndrome Diseases 0.000 description 2
- 102100021630 B-cell CLL/lymphoma 7 protein family member A Human genes 0.000 description 2
- 108700020462 BRCA2 Proteins 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 101150008921 Brca2 gene Proteins 0.000 description 2
- 102100031151 C-C chemokine receptor type 2 Human genes 0.000 description 2
- 102100034808 CCAAT/enhancer-binding protein alpha Human genes 0.000 description 2
- 208000032325 CEBPE-associated autoinflammation-immunodeficiency-neutrophil dysfunction syndrome Diseases 0.000 description 2
- 102100026548 Caspase-8 Human genes 0.000 description 2
- 102100028914 Catenin beta-1 Human genes 0.000 description 2
- 102100037182 Cation-independent mannose-6-phosphate receptor Human genes 0.000 description 2
- 108010035563 Chloramphenicol O-acetyltransferase Proteins 0.000 description 2
- 102100029057 Coagulation factor XIII A chain Human genes 0.000 description 2
- 108091029523 CpG island Proteins 0.000 description 2
- 108010058546 Cyclin D1 Proteins 0.000 description 2
- 108010079245 Cystic Fibrosis Transmembrane Conductance Regulator Proteins 0.000 description 2
- 102000012605 Cystic Fibrosis Transmembrane Conductance Regulator Human genes 0.000 description 2
- 102100023419 Cystic fibrosis transmembrane conductance regulator Human genes 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 101710177611 DNA polymerase II large subunit Proteins 0.000 description 2
- 101710184669 DNA polymerase II small subunit Proteins 0.000 description 2
- 102100020986 DNA-binding protein RFX5 Human genes 0.000 description 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 2
- 241000283086 Equidae Species 0.000 description 2
- 241000588722 Escherichia Species 0.000 description 2
- 108700024394 Exon Proteins 0.000 description 2
- 108010033305 Fanconi Anemia Complementation Group G protein Proteins 0.000 description 2
- 102100027285 Fanconi anemia group B protein Human genes 0.000 description 2
- 102100034555 Fanconi anemia group G protein Human genes 0.000 description 2
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 2
- 108091092584 GDNA Proteins 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- 229940123611 Genome editing Drugs 0.000 description 2
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 2
- 102100036264 Glucose-6-phosphatase catalytic subunit 1 Human genes 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 102100033079 HLA class II histocompatibility antigen, DM alpha chain Human genes 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 102100027685 Hemoglobin subunit alpha Human genes 0.000 description 2
- 102100021519 Hemoglobin subunit beta Human genes 0.000 description 2
- 102100022057 Hepatocyte nuclear factor 1-alpha Human genes 0.000 description 2
- 108091027305 Heteroduplex Proteins 0.000 description 2
- 241000251188 Holocephali Species 0.000 description 2
- 101000733040 Homo sapiens 40S ribosomal protein S19 Proteins 0.000 description 2
- 101001075525 Homo sapiens Ammonium transporter Rh type A Proteins 0.000 description 2
- 101000893559 Homo sapiens Amylo-alpha-1,6-glucosidase Proteins 0.000 description 2
- 101000823051 Homo sapiens Amyloid-beta precursor protein Proteins 0.000 description 2
- 101000971230 Homo sapiens B-cell CLL/lymphoma 7 protein family member A Proteins 0.000 description 2
- 101000945515 Homo sapiens CCAAT/enhancer-binding protein alpha Proteins 0.000 description 2
- 101000983528 Homo sapiens Caspase-8 Proteins 0.000 description 2
- 101000916173 Homo sapiens Catenin beta-1 Proteins 0.000 description 2
- 101001028831 Homo sapiens Cation-independent mannose-6-phosphate receptor Proteins 0.000 description 2
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 2
- 101000918352 Homo sapiens Coagulation factor XIII A chain Proteins 0.000 description 2
- 101001075432 Homo sapiens DNA-binding protein RFX5 Proteins 0.000 description 2
- 101001066268 Homo sapiens Erythroid transcription factor Proteins 0.000 description 2
- 101000914679 Homo sapiens Fanconi anemia group B protein Proteins 0.000 description 2
- 101000930910 Homo sapiens Glucose-6-phosphatase catalytic subunit 1 Proteins 0.000 description 2
- 101001009007 Homo sapiens Hemoglobin subunit alpha Proteins 0.000 description 2
- 101001045751 Homo sapiens Hepatocyte nuclear factor 1-alpha Proteins 0.000 description 2
- 101001048956 Homo sapiens Homeobox protein EMX1 Proteins 0.000 description 2
- 101000983747 Homo sapiens MHC class II transactivator Proteins 0.000 description 2
- 101001109719 Homo sapiens Nucleophosmin Proteins 0.000 description 2
- 101000987581 Homo sapiens Perforin-1 Proteins 0.000 description 2
- 101000583474 Homo sapiens Phosphatidylinositol-binding clathrin assembly protein Proteins 0.000 description 2
- 101000692464 Homo sapiens Platelet-derived growth factor receptor-like protein Proteins 0.000 description 2
- 101000718497 Homo sapiens Protein AF-10 Proteins 0.000 description 2
- 101000573199 Homo sapiens Protein PML Proteins 0.000 description 2
- 101000720958 Homo sapiens Protein artemis Proteins 0.000 description 2
- 101000946863 Homo sapiens T-cell surface glycoprotein CD3 delta chain Proteins 0.000 description 2
- 101000772194 Homo sapiens Transthyretin Proteins 0.000 description 2
- 101001087416 Homo sapiens Tyrosine-protein phosphatase non-receptor type 11 Proteins 0.000 description 2
- 101000807668 Homo sapiens Uracil-DNA glycosylase Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 201000004029 Immune dysregulation-polyendocrinopathy-enteropathy-X-linked syndrome Diseases 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- 206010061218 Inflammation Diseases 0.000 description 2
- 102000004310 Ion Channels Human genes 0.000 description 2
- 108090000862 Ion Channels Proteins 0.000 description 2
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 2
- 102100026371 MHC class II transactivator Human genes 0.000 description 2
- 241000282560 Macaca mulatta Species 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 108700011259 MicroRNAs Proteins 0.000 description 2
- 241000714177 Murine leukemia virus Species 0.000 description 2
- 101100113998 Mus musculus Cnbd2 gene Proteins 0.000 description 2
- 101001033765 Mus musculus Methyl-CpG-binding protein 2 Proteins 0.000 description 2
- 101100494762 Mus musculus Nedd9 gene Proteins 0.000 description 2
- 108091092724 Noncoding DNA Proteins 0.000 description 2
- 108020004485 Nonsense Codon Proteins 0.000 description 2
- 238000000636 Northern blotting Methods 0.000 description 2
- 102100022678 Nucleophosmin Human genes 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 102100040444 P2X purinoceptor 1 Human genes 0.000 description 2
- 102100037602 P2X purinoceptor 7 Human genes 0.000 description 2
- 102100028467 Perforin-1 Human genes 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- 101710169596 Phosphatidylinositol-binding clathrin assembly protein Proteins 0.000 description 2
- 102100026554 Platelet-derived growth factor receptor-like protein Human genes 0.000 description 2
- 108010071690 Prealbumin Proteins 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 102100026286 Protein AF-10 Human genes 0.000 description 2
- 102100026375 Protein PML Human genes 0.000 description 2
- 102100025918 Protein artemis Human genes 0.000 description 2
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 2
- 108700008625 Reporter Genes Proteins 0.000 description 2
- 108091006299 SLC2A2 Proteins 0.000 description 2
- 241000713311 Simian immunodeficiency virus Species 0.000 description 2
- 102100022433 Single-stranded DNA cytosine deaminase Human genes 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 240000003768 Solanum lycopersicum Species 0.000 description 2
- 102100023537 Solute carrier family 2, facilitated glucose transporter member 2 Human genes 0.000 description 2
- 241000194020 Streptococcus thermophilus Species 0.000 description 2
- RAHZWNYVWXNFOC-UHFFFAOYSA-N Sulphur dioxide Chemical compound O=S=O RAHZWNYVWXNFOC-UHFFFAOYSA-N 0.000 description 2
- 102100040365 T-cell acute lymphocytic leukemia protein 1 Human genes 0.000 description 2
- 102100035891 T-cell surface glycoprotein CD3 delta chain Human genes 0.000 description 2
- 102100028082 Tapasin Human genes 0.000 description 2
- 102100036407 Thioredoxin Human genes 0.000 description 2
- 108010073062 Transcription Activator-Like Effectors Proteins 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 102000009190 Transthyretin Human genes 0.000 description 2
- 102100029290 Transthyretin Human genes 0.000 description 2
- 108090000704 Tubulin Proteins 0.000 description 2
- 102000004243 Tubulin Human genes 0.000 description 2
- 108700005077 Viral Genes Proteins 0.000 description 2
- 208000023940 X-Linked Combined Immunodeficiency disease Diseases 0.000 description 2
- 102100040314 Zinc finger and BTB domain-containing protein 16 Human genes 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 235000004279 alanine Nutrition 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 208000007502 anemia Diseases 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 238000010171 animal model Methods 0.000 description 2
- 210000004436 artificial bacterial chromosome Anatomy 0.000 description 2
- 210000001106 artificial yeast chromosome Anatomy 0.000 description 2
- 208000033651 b subunit deficiency of factor XIII Diseases 0.000 description 2
- 230000004888 barrier function Effects 0.000 description 2
- 108010005774 beta-Galactosidase Proteins 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 239000002551 biofuel Substances 0.000 description 2
- 239000013060 biological fluid Substances 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 238000001574 biopsy Methods 0.000 description 2
- 108091005948 blue fluorescent proteins Proteins 0.000 description 2
- 210000004958 brain cell Anatomy 0.000 description 2
- 210000005013 brain tissue Anatomy 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 210000000349 chromosome Anatomy 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000005520 cutting process Methods 0.000 description 2
- 108010082025 cyan fluorescent protein Proteins 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 238000002716 delivery method Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000011143 downstream manufacturing Methods 0.000 description 2
- 238000009510 drug design Methods 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- CTSPAMFJBXKSOY-UHFFFAOYSA-N ellipticine Chemical compound N1=CC=C2C(C)=C(NC=3C4=CC=CC=3)C4=C(C)C2=C1 CTSPAMFJBXKSOY-UHFFFAOYSA-N 0.000 description 2
- 108010025678 empty spiracles homeobox proteins Proteins 0.000 description 2
- 210000002889 endothelial cell Anatomy 0.000 description 2
- 108010048367 enhanced green fluorescent protein Proteins 0.000 description 2
- CBOQJANXLMLOSS-UHFFFAOYSA-N ethyl vanillin Chemical compound CCOC1=CC(C=O)=CC=C1O CBOQJANXLMLOSS-UHFFFAOYSA-N 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- ZXQYGBMAQZUVMI-GCMPRSNUSA-N gamma-cyhalothrin Chemical compound CC1(C)[C@@H](\C=C(/Cl)C(F)(F)F)[C@H]1C(=O)O[C@H](C#N)C1=CC=CC(OC=2C=CC=CC=2)=C1 ZXQYGBMAQZUVMI-GCMPRSNUSA-N 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- 238000001476 gene delivery Methods 0.000 description 2
- 208000016361 genetic disease Diseases 0.000 description 2
- 238000012268 genome sequencing Methods 0.000 description 2
- 235000011187 glycerol Nutrition 0.000 description 2
- 210000005003 heart tissue Anatomy 0.000 description 2
- 238000010438 heat treatment Methods 0.000 description 2
- 239000000185 hemagglutinin Substances 0.000 description 2
- 208000031169 hemorrhagic disease Diseases 0.000 description 2
- 230000028993 immune response Effects 0.000 description 2
- 230000000415 inactivating effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000004054 inflammatory process Effects 0.000 description 2
- 206010022000 influenza Diseases 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 230000029226 lipidation Effects 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 208000030159 metabolic disease Diseases 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000003471 mutagenic agent Substances 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 230000001537 neural effect Effects 0.000 description 2
- 210000000633 nuclear envelope Anatomy 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 108010079892 phosphoglycerol kinase Proteins 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 230000001737 promoting effect Effects 0.000 description 2
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 108010005597 ran GTP Binding Protein Proteins 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 2
- 230000019491 signal transduction Effects 0.000 description 2
- 239000000344 soap Substances 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- 230000002463 transducing effect Effects 0.000 description 2
- 230000010474 transient expression Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 210000002845 virion Anatomy 0.000 description 2
- 239000000277 virosome Substances 0.000 description 2
- 108091005957 yellow fluorescent proteins Proteins 0.000 description 2
- SGKRLCUYIXIAHR-AKNGSSGZSA-N (4s,4ar,5s,5ar,6r,12ar)-4-(dimethylamino)-1,5,10,11,12a-pentahydroxy-6-methyl-3,12-dioxo-4a,5,5a,6-tetrahydro-4h-tetracene-2-carboxamide Chemical compound C1=CC=C2[C@H](C)[C@@H]([C@H](O)[C@@H]3[C@](C(O)=C(C(N)=O)C(=O)[C@H]3N(C)C)(O)C3=O)C3=C(O)C2=C1O SGKRLCUYIXIAHR-AKNGSSGZSA-N 0.000 description 1
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 1
- 102100028734 1,4-alpha-glucan-branching enzyme Human genes 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- CHHHXKFHOYLYRE-UHFFFAOYSA-M 2,4-Hexadienoic acid, potassium salt (1:1), (2E,4E)- Chemical compound [K+].CC=CC=CC([O-])=O CHHHXKFHOYLYRE-UHFFFAOYSA-M 0.000 description 1
- VZSRBBMJRBPUNF-UHFFFAOYSA-N 2-(2,3-dihydro-1H-inden-2-ylamino)-N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]pyrimidine-5-carboxamide Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C(=O)NCCC(N1CC2=C(CC1)NN=N2)=O VZSRBBMJRBPUNF-UHFFFAOYSA-N 0.000 description 1
- DIDGPCDGNMIUNX-UUOKFMHZSA-N 2-amino-9-[(2r,3r,4s,5r)-5-(dihydroxyphosphinothioyloxymethyl)-3,4-dihydroxyoxolan-2-yl]-3h-purin-6-one Chemical compound C1=2NC(N)=NC(=O)C=2N=CN1[C@@H]1O[C@H](COP(O)(O)=S)[C@@H](O)[C@H]1O DIDGPCDGNMIUNX-UUOKFMHZSA-N 0.000 description 1
- WTOFYLAWDLQMBZ-UHFFFAOYSA-N 2-azaniumyl-3-thiophen-2-ylpropanoate Chemical compound OC(=O)C(N)CC1=CC=CS1 WTOFYLAWDLQMBZ-UHFFFAOYSA-N 0.000 description 1
- KKAJSJJFBSOMGS-UHFFFAOYSA-N 3,6-diamino-10-methylacridinium chloride Chemical compound [Cl-].C1=C(N)C=C2[N+](C)=C(C=C(N)C=C3)C3=CC2=C1 KKAJSJJFBSOMGS-UHFFFAOYSA-N 0.000 description 1
- 101150092649 3a gene Proteins 0.000 description 1
- 101150006159 3b gene Proteins 0.000 description 1
- WXNZTHHGJRFXKQ-UHFFFAOYSA-N 4-chlorophenol Chemical compound OC1=CC=C(Cl)C=C1 WXNZTHHGJRFXKQ-UHFFFAOYSA-N 0.000 description 1
- 101710087140 50S ribosomal protein L22, chloroplastic Proteins 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 208000033598 A subunit deficiency of factor XIII Diseases 0.000 description 1
- 102100028446 ADP-ribosylation factor-like protein 11 Human genes 0.000 description 1
- 108010029988 AICDA (activation-induced cytidine deaminase) Proteins 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 102100032922 ATP-dependent 6-phosphofructokinase, muscle type Human genes 0.000 description 1
- 241000589291 Acinetobacter Species 0.000 description 1
- 241001502050 Acis Species 0.000 description 1
- 102100036664 Adenosine deaminase Human genes 0.000 description 1
- 102100032157 Adenylate cyclase type 10 Human genes 0.000 description 1
- 241000567147 Aeropyrum Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 208000003808 Amyloid Neuropathies Diseases 0.000 description 1
- 241000192542 Anabaena Species 0.000 description 1
- 208000009575 Angelman syndrome Diseases 0.000 description 1
- 102100033715 Apolipoprotein A-I Human genes 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 241000207208 Aquifex Species 0.000 description 1
- 241000219195 Arabidopsis thaliana Species 0.000 description 1
- 101100056377 Arabidopsis thaliana ARL gene Proteins 0.000 description 1
- 101100243447 Arabidopsis thaliana PER53 gene Proteins 0.000 description 1
- 241000205046 Archaeoglobus Species 0.000 description 1
- 102100030907 Aryl hydrocarbon receptor nuclear translocator Human genes 0.000 description 1
- 101000690509 Aspergillus oryzae (strain ATCC 42149 / RIB 40) Alpha-glucosidase Proteins 0.000 description 1
- 108010004586 Ataxia Telangiectasia Mutated Proteins Proteins 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 241000589941 Azospirillum Species 0.000 description 1
- 108091012583 BCL2 Proteins 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 206010061692 Benign muscle neoplasm Diseases 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 101000964894 Bos taurus 14-3-3 protein zeta/delta Proteins 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- 241000208231 Bursera Species 0.000 description 1
- 101710149815 C-C chemokine receptor type 2 Proteins 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 101150029409 CFTR gene Proteins 0.000 description 1
- 101150018129 CSF2 gene Proteins 0.000 description 1
- 101150069031 CSN2 gene Proteins 0.000 description 1
- 101000690445 Caenorhabditis elegans Aryl hydrocarbon receptor nuclear translocator homolog Proteins 0.000 description 1
- 240000001432 Calendula officinalis Species 0.000 description 1
- 235000005881 Calendula officinalis Nutrition 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 241000589986 Campylobacter lari Species 0.000 description 1
- 101000809436 Candida albicans Sterol O-acyltransferase 2 Proteins 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 208000010693 Charcot-Marie-Tooth Disease Diseases 0.000 description 1
- 241000191366 Chlorobium Species 0.000 description 1
- 241000588881 Chromobacterium Species 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 102100022641 Coagulation factor IX Human genes 0.000 description 1
- 101100007328 Cocos nucifera COS-1 gene Proteins 0.000 description 1
- 206010010099 Combined immunodeficiency Diseases 0.000 description 1
- 108010053085 Complement Factor H Proteins 0.000 description 1
- 102000016550 Complement Factor H Human genes 0.000 description 1
- 108091028732 Concatemer Proteins 0.000 description 1
- 206010053138 Congenital aplastic anaemia Diseases 0.000 description 1
- 208000026372 Congenital cystic kidney disease Diseases 0.000 description 1
- 101000644617 Conus textile Textile convulsant peptide Proteins 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 102100028908 Cullin-3 Human genes 0.000 description 1
- 208000026292 Cystic Kidney disease Diseases 0.000 description 1
- 102100028717 Cytosolic 5'-nucleotidase 3A Human genes 0.000 description 1
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 1
- 101150074155 DHFR gene Proteins 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 230000005971 DNA damage repair Effects 0.000 description 1
- 239000012625 DNA intercalator Substances 0.000 description 1
- 230000007067 DNA methylation Effects 0.000 description 1
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 1
- 101710158312 DNA-binding protein HU-beta Proteins 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 241000605716 Desulfovibrio Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 101100247319 Drosophila melanogaster Ras64B gene Proteins 0.000 description 1
- 102100034546 E3 ubiquitin-protein ligase FANCL Human genes 0.000 description 1
- 239000001692 EU approved anti-caking agent Substances 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 101710091045 Envelope protein Proteins 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000588698 Erwinia Species 0.000 description 1
- 101710100588 Erythroid transcription factor Proteins 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- QTANTQQOYSUMLC-UHFFFAOYSA-O Ethidium cation Chemical compound C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 QTANTQQOYSUMLC-UHFFFAOYSA-O 0.000 description 1
- 241001531192 Eubacterium ventriosum Species 0.000 description 1
- 108010082945 Eukaryotic Initiation Factor-2B Proteins 0.000 description 1
- 101150030532 F7 gene Proteins 0.000 description 1
- 108010014172 Factor V Proteins 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 201000003542 Factor VIII deficiency Diseases 0.000 description 1
- 201000007176 Factor XII Deficiency Diseases 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 108010087740 Fanconi Anemia Complementation Group A protein Proteins 0.000 description 1
- 102000018825 Fanconi Anemia Complementation Group C protein Human genes 0.000 description 1
- 108010027673 Fanconi Anemia Complementation Group C protein Proteins 0.000 description 1
- 108010026653 Fanconi Anemia Complementation Group D2 protein Proteins 0.000 description 1
- 102000010634 Fanconi Anemia Complementation Group E protein Human genes 0.000 description 1
- 108010077898 Fanconi Anemia Complementation Group E protein Proteins 0.000 description 1
- 102000012216 Fanconi Anemia Complementation Group F protein Human genes 0.000 description 1
- 108010022012 Fanconi Anemia Complementation Group F protein Proteins 0.000 description 1
- 201000004939 Fanconi anemia Diseases 0.000 description 1
- 102100027286 Fanconi anemia group C protein Human genes 0.000 description 1
- 102100040306 Fanconi anemia group D2 protein Human genes 0.000 description 1
- 102100034553 Fanconi anemia group J protein Human genes 0.000 description 1
- 102100034552 Fanconi anemia group M protein Human genes 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 102000008857 Ferritin Human genes 0.000 description 1
- 108050000784 Ferritin Proteins 0.000 description 1
- 238000008416 Ferritin Methods 0.000 description 1
- 101800000656 Fetal antigen 1 Proteins 0.000 description 1
- 102100031752 Fibrinogen alpha chain Human genes 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- 102000003869 Frataxin Human genes 0.000 description 1
- 108090000217 Frataxin Proteins 0.000 description 1
- 241000223221 Fusarium oxysporum Species 0.000 description 1
- 102100033452 GMP synthase [glutamine-hydrolyzing] Human genes 0.000 description 1
- 101710071060 GMPS Proteins 0.000 description 1
- 102100030708 GTPase KRas Human genes 0.000 description 1
- 208000036357 GUCY2D-related recessive retinopathy Diseases 0.000 description 1
- 101150014889 Gad1 gene Proteins 0.000 description 1
- 102100039556 Galectin-4 Human genes 0.000 description 1
- 102100028953 Gelsolin Human genes 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 241001135750 Geobacter Species 0.000 description 1
- 241001468096 Gluconacetobacter diazotrophicus Species 0.000 description 1
- 102100039684 Glucose-6-phosphate exchanger SLC37A4 Human genes 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 102100035902 Glutamate decarboxylase 1 Human genes 0.000 description 1
- 102100035857 Glutamate decarboxylase 2 Human genes 0.000 description 1
- 102100039264 Glycogen [starch] synthase, liver Human genes 0.000 description 1
- 102100029481 Glycogen phosphorylase, liver form Human genes 0.000 description 1
- 102100036698 Golgi reassembly-stacking protein 1 Human genes 0.000 description 1
- ZIXGXMMUKPLXBB-UHFFFAOYSA-N Guatambuinine Natural products N1C2=CC=CC=C2C2=C1C(C)=C1C=CN=C(C)C1=C2 ZIXGXMMUKPLXBB-UHFFFAOYSA-N 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 241000204988 Haloferax mediterranei Species 0.000 description 1
- 102100039894 Hemoglobin subunit delta Human genes 0.000 description 1
- 208000036066 Hemophagocytic Lymphohistiocytosis Diseases 0.000 description 1
- 208000009292 Hemophilia A Diseases 0.000 description 1
- 206010019629 Hepatic adenoma Diseases 0.000 description 1
- 206010019663 Hepatic failure Diseases 0.000 description 1
- 102000019267 Hepatic lipases Human genes 0.000 description 1
- 108050006747 Hepatic lipases Proteins 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 208000032672 Histiocytosis haematophagic Diseases 0.000 description 1
- 102100029234 Histone-lysine N-methyltransferase NSD2 Human genes 0.000 description 1
- 102100029235 Histone-lysine N-methyltransferase NSD3 Human genes 0.000 description 1
- 102100023823 Homeobox protein EMX1 Human genes 0.000 description 1
- 102100021086 Homeobox protein Hox-D4 Human genes 0.000 description 1
- 101001058479 Homo sapiens 1,4-alpha-glucan-branching enzyme Proteins 0.000 description 1
- 101001083755 Homo sapiens 5-aminolevulinate synthase, erythroid-specific, mitochondrial Proteins 0.000 description 1
- 101000769457 Homo sapiens ADP-ribosylation factor-like protein 11 Proteins 0.000 description 1
- 101001029059 Homo sapiens ATP-binding cassette sub-family C member 10 Proteins 0.000 description 1
- 101000730838 Homo sapiens ATP-dependent 6-phosphofructokinase, muscle type Proteins 0.000 description 1
- 101000824278 Homo sapiens Acyl-[acyl-carrier-protein] hydrolase Proteins 0.000 description 1
- 101000929495 Homo sapiens Adenosine deaminase Proteins 0.000 description 1
- 101000775498 Homo sapiens Adenylate cyclase type 10 Proteins 0.000 description 1
- 101000652582 Homo sapiens Antigen peptide transporter 2 Proteins 0.000 description 1
- 101000733802 Homo sapiens Apolipoprotein A-I Proteins 0.000 description 1
- 101000793115 Homo sapiens Aryl hydrocarbon receptor nuclear translocator Proteins 0.000 description 1
- 101000777599 Homo sapiens C-C chemokine receptor type 2 Proteins 0.000 description 1
- 101000946926 Homo sapiens C-C chemokine receptor type 5 Proteins 0.000 description 1
- 101000883545 Homo sapiens Chromodomain-helicase-DNA-binding protein 8 Proteins 0.000 description 1
- 101000916238 Homo sapiens Cullin-3 Proteins 0.000 description 1
- 101000915170 Homo sapiens Cytosolic 5'-nucleotidase 3A Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101000736065 Homo sapiens DNA replication complex GINS protein PSF2 Proteins 0.000 description 1
- 101000848191 Homo sapiens E3 ubiquitin-protein ligase FANCL Proteins 0.000 description 1
- 101000619542 Homo sapiens E3 ubiquitin-protein ligase parkin Proteins 0.000 description 1
- 101000914673 Homo sapiens Fanconi anemia group A protein Proteins 0.000 description 1
- 101000914680 Homo sapiens Fanconi anemia group C protein Proteins 0.000 description 1
- 101000848171 Homo sapiens Fanconi anemia group J protein Proteins 0.000 description 1
- 101000848187 Homo sapiens Fanconi anemia group M protein Proteins 0.000 description 1
- 101000846244 Homo sapiens Fibrinogen alpha chain Proteins 0.000 description 1
- 101000980756 Homo sapiens G1/S-specific cyclin-D1 Proteins 0.000 description 1
- 101000608765 Homo sapiens Galectin-4 Proteins 0.000 description 1
- 101001059150 Homo sapiens Gelsolin Proteins 0.000 description 1
- 101000886173 Homo sapiens Glucose-6-phosphate exchanger SLC37A4 Proteins 0.000 description 1
- 101000873786 Homo sapiens Glutamate decarboxylase 2 Proteins 0.000 description 1
- 101001036117 Homo sapiens Glycogen [starch] synthase, liver Proteins 0.000 description 1
- 101000700616 Homo sapiens Glycogen phosphorylase, liver form Proteins 0.000 description 1
- 101000634048 Homo sapiens Histone-lysine N-methyltransferase NSD2 Proteins 0.000 description 1
- 101000634046 Homo sapiens Histone-lysine N-methyltransferase NSD3 Proteins 0.000 description 1
- 101001041136 Homo sapiens Homeobox protein Hox-D4 Proteins 0.000 description 1
- 101000843809 Homo sapiens Hydroxycarboxylic acid receptor 2 Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000599940 Homo sapiens Interferon gamma Proteins 0.000 description 1
- 101001043809 Homo sapiens Interleukin-7 receptor subunit alpha Proteins 0.000 description 1
- 101100086477 Homo sapiens KRAS gene Proteins 0.000 description 1
- 101001091385 Homo sapiens Kallikrein-6 Proteins 0.000 description 1
- 101000975108 Homo sapiens Katanin p60 ATPase-containing subunit A-like 2 Proteins 0.000 description 1
- 101000998020 Homo sapiens Keratin, type I cytoskeletal 18 Proteins 0.000 description 1
- 101000975496 Homo sapiens Keratin, type II cytoskeletal 8 Proteins 0.000 description 1
- 101000945492 Homo sapiens Killer cell immunoglobulin-like receptor 3DS1 Proteins 0.000 description 1
- 101001018100 Homo sapiens Lysozyme C Proteins 0.000 description 1
- 101001012669 Homo sapiens Melanoma inhibitory activity protein 2 Proteins 0.000 description 1
- 101001057159 Homo sapiens Melanoma-associated antigen C3 Proteins 0.000 description 1
- 101000954986 Homo sapiens Merlin Proteins 0.000 description 1
- 101000615261 Homo sapiens Multiple coagulation factor deficiency protein 2 Proteins 0.000 description 1
- 101001128138 Homo sapiens NACHT, LRR and PYD domains-containing protein 2 Proteins 0.000 description 1
- 101000981336 Homo sapiens Nibrin Proteins 0.000 description 1
- 101001125026 Homo sapiens Nucleotide-binding oligomerization domain-containing protein 2 Proteins 0.000 description 1
- 101000614405 Homo sapiens P2X purinoceptor 1 Proteins 0.000 description 1
- 101001098175 Homo sapiens P2X purinoceptor 7 Proteins 0.000 description 1
- 101000706121 Homo sapiens Parvalbumin alpha Proteins 0.000 description 1
- 101000617536 Homo sapiens Presenilin-1 Proteins 0.000 description 1
- 101000892338 Homo sapiens Protein AF1q Proteins 0.000 description 1
- 101000716803 Homo sapiens Protein SCO1 homolog, mitochondrial Proteins 0.000 description 1
- 101000863978 Homo sapiens Protein downstream neighbor of Son Proteins 0.000 description 1
- 101001000998 Homo sapiens Protein phosphatase 1 regulatory subunit 12C Proteins 0.000 description 1
- 101000600434 Homo sapiens Putative uncharacterized protein encoded by MIR7-3HG Proteins 0.000 description 1
- 101001091536 Homo sapiens Pyruvate kinase PKLR Proteins 0.000 description 1
- 101001075466 Homo sapiens Regulatory factor X-associated protein Proteins 0.000 description 1
- 101000899806 Homo sapiens Retinal guanylyl cyclase 1 Proteins 0.000 description 1
- 101000857677 Homo sapiens Runt-related transcription factor 1 Proteins 0.000 description 1
- 101000984753 Homo sapiens Serine/threonine-protein kinase B-raf Proteins 0.000 description 1
- 101000755690 Homo sapiens Single-stranded DNA cytosine deaminase Proteins 0.000 description 1
- 101000684826 Homo sapiens Sodium channel protein type 2 subunit alpha Proteins 0.000 description 1
- 101000868152 Homo sapiens Son of sevenless homolog 1 Proteins 0.000 description 1
- 101000881247 Homo sapiens Spectrin beta chain, erythrocytic Proteins 0.000 description 1
- 101000617130 Homo sapiens Stromal cell-derived factor 1 Proteins 0.000 description 1
- 101000821100 Homo sapiens Synapsin-1 Proteins 0.000 description 1
- 101000575685 Homo sapiens Synembryn-B Proteins 0.000 description 1
- 101000891113 Homo sapiens T-cell acute lymphocytic leukemia protein 1 Proteins 0.000 description 1
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 description 1
- 101000738413 Homo sapiens T-cell surface glycoprotein CD3 gamma chain Proteins 0.000 description 1
- 101000649068 Homo sapiens Tapasin Proteins 0.000 description 1
- 101000715050 Homo sapiens Thromboxane A2 receptor Proteins 0.000 description 1
- 101000625338 Homo sapiens Transcriptional adapter 1 Proteins 0.000 description 1
- 101000626636 Homo sapiens Transcriptional adapter 2-beta Proteins 0.000 description 1
- 101001057681 Homo sapiens Translation initiation factor eIF-2B subunit beta Proteins 0.000 description 1
- 101000925982 Homo sapiens Translation initiation factor eIF-2B subunit delta Proteins 0.000 description 1
- 101000925985 Homo sapiens Translation initiation factor eIF-2B subunit epsilon Proteins 0.000 description 1
- 101001049688 Homo sapiens Translation initiation factor eIF-2B subunit gamma Proteins 0.000 description 1
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 1
- 101000611185 Homo sapiens Tumor necrosis factor receptor superfamily member 5 Proteins 0.000 description 1
- 101000934996 Homo sapiens Tyrosine-protein kinase JAK3 Proteins 0.000 description 1
- 101000772888 Homo sapiens Ubiquitin-protein ligase E3A Proteins 0.000 description 1
- 101000749634 Homo sapiens Uromodulin Proteins 0.000 description 1
- 101001061851 Homo sapiens V(D)J recombination-activating protein 2 Proteins 0.000 description 1
- 101000742373 Homo sapiens Vesicular inhibitory amino acid transporter Proteins 0.000 description 1
- 101100377226 Homo sapiens ZBTB16 gene Proteins 0.000 description 1
- 101000964425 Homo sapiens Zinc finger and BTB domain-containing protein 16 Proteins 0.000 description 1
- 101001074035 Homo sapiens Zinc finger protein GLI2 Proteins 0.000 description 1
- 206010020460 Human T-cell lymphotropic virus type I infection Diseases 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- WOBHKFSMXKNTIM-UHFFFAOYSA-N Hydroxyethyl methacrylate Chemical compound CC(=C)C(=O)OCCO WOBHKFSMXKNTIM-UHFFFAOYSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 101710128560 Initiator protein NS1 Proteins 0.000 description 1
- 108010061833 Integrases Proteins 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 102100039068 Interleukin-10 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 1
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 1
- 102100034866 Kallikrein-6 Human genes 0.000 description 1
- 102100022971 Katanin p60 ATPase-containing subunit A-like 2 Human genes 0.000 description 1
- 102100033421 Keratin, type I cytoskeletal 18 Human genes 0.000 description 1
- 102100023972 Keratin, type II cytoskeletal 8 Human genes 0.000 description 1
- 102100034833 Killer cell immunoglobulin-like receptor 3DS1 Human genes 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- 241000186841 Lactobacillus farciminis Species 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000005870 Lafora disease Diseases 0.000 description 1
- 208000014161 Lafora myoclonic epilepsy Diseases 0.000 description 1
- 101710128836 Large T antigen Proteins 0.000 description 1
- 201000003533 Leber congenital amaurosis Diseases 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 108010020246 Leucine-Rich Repeat Serine-Threonine Protein Kinase-2 Proteins 0.000 description 1
- 102100032693 Leucine-rich repeat serine/threonine-protein kinase 2 Human genes 0.000 description 1
- 241000209510 Liliopsida Species 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 108010009491 Lysosomal-Associated Membrane Protein 2 Proteins 0.000 description 1
- 102100038225 Lysosome-associated membrane glycoprotein 2 Human genes 0.000 description 1
- 102100033468 Lysozyme C Human genes 0.000 description 1
- 239000007993 MOPS buffer Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 102100025169 Max-binding protein MNT Human genes 0.000 description 1
- 108700020845 Medullary Cystic Kidney Disease 2 Proteins 0.000 description 1
- 102100029778 Melanoma inhibitory activity protein 2 Human genes 0.000 description 1
- 108010023338 Member 3 Subfamily B ATP Binding Cassette Transporter Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102100037106 Merlin Human genes 0.000 description 1
- 241000202974 Methanobacterium Species 0.000 description 1
- 241000203353 Methanococcus Species 0.000 description 1
- 241000204675 Methanopyrus Species 0.000 description 1
- 241000205276 Methanosarcina Species 0.000 description 1
- 101000966542 Methanosarcina barkeri Trimethylamine corrinoid protein Proteins 0.000 description 1
- 241000589345 Methylococcus Species 0.000 description 1
- 108060004795 Methyltransferase Proteins 0.000 description 1
- 102100021387 Multiple coagulation factor deficiency protein 2 Human genes 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101000981253 Mus musculus GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1 Proteins 0.000 description 1
- 101100452019 Mus musculus Icam2 gene Proteins 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 102100030856 Myoglobin Human genes 0.000 description 1
- 201000004458 Myoma Diseases 0.000 description 1
- 241000863420 Myxococcus Species 0.000 description 1
- ZKXDGKXYMTYWTB-UHFFFAOYSA-N N-nitrosomorpholine Chemical compound O=NN1CCOCC1 ZKXDGKXYMTYWTB-UHFFFAOYSA-N 0.000 description 1
- 102100031897 NACHT, LRR and PYD domains-containing protein 2 Human genes 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 102100021867 Natural resistance-associated macrophage protein 2 Human genes 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 241000588654 Neisseria cinerea Species 0.000 description 1
- 102000048850 Neoplasm Genes Human genes 0.000 description 1
- 108700019961 Neoplasm Genes Proteins 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 208000007382 Neurofibromatosis-Noonan syndrome Diseases 0.000 description 1
- 102000008763 Neurofilament Proteins Human genes 0.000 description 1
- 108010088373 Neurofilament Proteins Proteins 0.000 description 1
- 101100058191 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) bcp-1 gene Proteins 0.000 description 1
- 101100385413 Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) csm-3 gene Proteins 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 241000605122 Nitrosomonas Species 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 101710144127 Non-structural protein 1 Proteins 0.000 description 1
- 102100029441 Nucleotide-binding oligomerization domain-containing protein 2 Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 101710189973 P2X purinoceptor 1 Proteins 0.000 description 1
- 101710189965 P2X purinoceptor 7 Proteins 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 208000037581 Persistent Infection Diseases 0.000 description 1
- 201000011252 Phenylketonuria Diseases 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241000607568 Photobacterium Species 0.000 description 1
- 241000204826 Picrophilus Species 0.000 description 1
- 101000831437 Plasmodium falciparum Trophozoite cysteine proteinase Proteins 0.000 description 1
- RVGRUAULSDPKGF-UHFFFAOYSA-N Poloxamer Chemical compound C1CO1.CC1CO1 RVGRUAULSDPKGF-UHFFFAOYSA-N 0.000 description 1
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 1
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 1
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 241000605894 Porphyromonas Species 0.000 description 1
- 102100022033 Presenilin-1 Human genes 0.000 description 1
- WDVSHHCDHLJJJR-UHFFFAOYSA-N Proflavine Chemical compound C1=CC(N)=CC2=NC3=CC(N)=CC=C3C=C21 WDVSHHCDHLJJJR-UHFFFAOYSA-N 0.000 description 1
- 108010049395 Prokaryotic Initiation Factor-2 Proteins 0.000 description 1
- 108700003766 Promyelocytic Leukemia Zinc Finger Proteins 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-N Propionic acid Chemical class CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 1
- 101800001494 Protease 2A Proteins 0.000 description 1
- 101800001066 Protein 2A Proteins 0.000 description 1
- 102100040665 Protein AF1q Human genes 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102100020866 Protein SCO1 homolog, mitochondrial Human genes 0.000 description 1
- 101710188315 Protein X Proteins 0.000 description 1
- 102100036467 Protein delta homolog 1 Human genes 0.000 description 1
- 102100035620 Protein phosphatase 1 regulatory subunit 12C Human genes 0.000 description 1
- 241000567197 Puccinia graminis f. sp. tritici Species 0.000 description 1
- 102100037401 Putative uncharacterized protein encoded by MIR7-3HG Human genes 0.000 description 1
- 241000205226 Pyrobaculum Species 0.000 description 1
- 241000205160 Pyrococcus Species 0.000 description 1
- 102100034909 Pyruvate kinase PKLR Human genes 0.000 description 1
- 102000001183 RAG-1 Human genes 0.000 description 1
- 108060006897 RAG1 Proteins 0.000 description 1
- 101150019218 RAS2 gene Proteins 0.000 description 1
- 102000014450 RNA Polymerase III Human genes 0.000 description 1
- 108010078067 RNA Polymerase III Proteins 0.000 description 1
- 230000007022 RNA scission Effects 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 102000001218 Rec A Recombinases Human genes 0.000 description 1
- 108010055016 Rec A Recombinases Proteins 0.000 description 1
- 108010091086 Recombinases Proteins 0.000 description 1
- 102000018120 Recombinases Human genes 0.000 description 1
- 102100021043 Regulatory factor X-associated protein Human genes 0.000 description 1
- 101710162453 Replication factor A Proteins 0.000 description 1
- 102100035729 Replication protein A 70 kDa DNA-binding subunit Human genes 0.000 description 1
- 102100022663 Retinal guanylyl cyclase 1 Human genes 0.000 description 1
- MJNIWUJSIGSWKK-UHFFFAOYSA-N Riboflavine 2',3',4',5'-tetrabutanoate Chemical compound CCCC(=O)OCC(OC(=O)CCC)C(OC(=O)CCC)C(OC(=O)CCC)CN1C2=CC(C)=C(C)C=C2N=C2C1=NC(=O)NC2=O MJNIWUJSIGSWKK-UHFFFAOYSA-N 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 241000398180 Roseburia intestinalis Species 0.000 description 1
- 102100025373 Runt-related transcription factor 1 Human genes 0.000 description 1
- KJTLSVCANCCWHF-UHFFFAOYSA-N Ruthenium Chemical compound [Ru] KJTLSVCANCCWHF-UHFFFAOYSA-N 0.000 description 1
- SUYXJDLXGFPMCQ-INIZCTEOSA-N SJ000287331 Natural products CC1=c2cnccc2=C(C)C2=Nc3ccccc3[C@H]12 SUYXJDLXGFPMCQ-INIZCTEOSA-N 0.000 description 1
- 108091006618 SLC11A2 Proteins 0.000 description 1
- 101150063267 STAT5B gene Proteins 0.000 description 1
- 101100170553 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) DLD2 gene Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 102100027103 Serine/threonine-protein kinase B-raf Human genes 0.000 description 1
- 102100024474 Signal transducer and activator of transcription 5B Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 102100023150 Sodium channel protein type 2 subunit alpha Human genes 0.000 description 1
- 102100037613 Spectrin beta chain, erythrocytic Human genes 0.000 description 1
- 241000639167 Sphaerochaeta globosa Species 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 241001501869 Streptococcus pasteurianus Species 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000320123 Streptococcus pyogenes M1 GAS Species 0.000 description 1
- 241001633172 Streptococcus thermophilus LMD-9 Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 102100021669 Stromal cell-derived factor 1 Human genes 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 241000205101 Sulfolobus Species 0.000 description 1
- 102100026014 Synembryn-B Human genes 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 description 1
- 102100037911 T-cell surface glycoprotein CD3 gamma chain Human genes 0.000 description 1
- 108091084976 TET family Proteins 0.000 description 1
- 108700012920 TNF Proteins 0.000 description 1
- 101150080074 TP53 gene Proteins 0.000 description 1
- 101150070537 Tet3 gene Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 208000002903 Thalassemia Diseases 0.000 description 1
- 241000186339 Thermoanaerobacter Species 0.000 description 1
- 241000204667 Thermoplasma Species 0.000 description 1
- 241000204652 Thermotoga Species 0.000 description 1
- 241000589596 Thermus Species 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 102100036704 Thromboxane A2 receptor Human genes 0.000 description 1
- 241000283907 Tragelaphus oryx Species 0.000 description 1
- 102100025043 Transcriptional adapter 1 Human genes 0.000 description 1
- 102100024858 Transcriptional adapter 2-beta Human genes 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 102100027059 Translation initiation factor eIF-2B subunit alpha Human genes 0.000 description 1
- 102100027065 Translation initiation factor eIF-2B subunit beta Human genes 0.000 description 1
- 102100034266 Translation initiation factor eIF-2B subunit delta Human genes 0.000 description 1
- 102100034267 Translation initiation factor eIF-2B subunit epsilon Human genes 0.000 description 1
- 102100023225 Translation initiation factor eIF-2B subunit gamma Human genes 0.000 description 1
- 108010020764 Transposases Proteins 0.000 description 1
- 102000008579 Transposases Human genes 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 1
- 102100033760 Tumor necrosis factor receptor superfamily member 19 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 208000006391 Type 1 Hyper-IgM Immunodeficiency Syndrome Diseases 0.000 description 1
- 102100025387 Tyrosine-protein kinase JAK3 Human genes 0.000 description 1
- 102100039127 Tyrosine-protein kinase receptor TYRO3 Human genes 0.000 description 1
- 101710116241 Tyrosine-protein phosphatase non-receptor type 11 Proteins 0.000 description 1
- 208000033130 UMOD-related autosomal dominant tubulointerstitial kidney disease Diseases 0.000 description 1
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 1
- 101710160987 Uracil-DNA glycosylase Proteins 0.000 description 1
- 108010046334 Urease Proteins 0.000 description 1
- 102100040613 Uromodulin Human genes 0.000 description 1
- 102100029591 V(D)J recombination-activating protein 2 Human genes 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 102100038170 Vesicular inhibitory amino acid transporter Human genes 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 108091093126 WHP Posttrascriptional Response Element Proteins 0.000 description 1
- 239000005862 Whey Substances 0.000 description 1
- 102000007544 Whey Proteins Human genes 0.000 description 1
- 108010046377 Whey Proteins Proteins 0.000 description 1
- 241000605941 Wolinella Species 0.000 description 1
- 201000001696 X-linked hyper IgM syndrome Diseases 0.000 description 1
- 102100036976 X-ray repair cross-complementing protein 6 Human genes 0.000 description 1
- 101710124907 X-ray repair cross-complementing protein 6 Proteins 0.000 description 1
- 241000589634 Xanthomonas Species 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- 102100035558 Zinc finger protein GLI2 Human genes 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 150000001242 acetic acid derivatives Chemical class 0.000 description 1
- DPKHZNPWBDQZCN-UHFFFAOYSA-N acridine orange free base Chemical compound C1=CC(N(C)C)=CC2=NC3=CC(N(C)C)=CC=C3C=C21 DPKHZNPWBDQZCN-UHFFFAOYSA-N 0.000 description 1
- 150000001251 acridines Chemical class 0.000 description 1
- 229940023020 acriflavine Drugs 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical group N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 230000009418 agronomic effect Effects 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 102000009899 alpha Karyopherins Human genes 0.000 description 1
- 108010077099 alpha Karyopherins Proteins 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 1
- 230000003466 anti-cipated effect Effects 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- UORJNBVJVRLXMQ-UHFFFAOYSA-N aprobarbital Chemical compound C=CCC1(C(C)C)C(=O)NC(=O)NC1=O UORJNBVJVRLXMQ-UHFFFAOYSA-N 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 230000003416 augmentation Effects 0.000 description 1
- 239000005441 aurora Substances 0.000 description 1
- 150000001558 benzoic acid derivatives Chemical class 0.000 description 1
- DZBUGLKDJFMEHC-UHFFFAOYSA-N benzoquinolinylidene Natural products C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 1
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical group NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 230000008499 blood brain barrier function Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 210000004900 c-terminal fragment Anatomy 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 102220354910 c.4C>G Human genes 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 101150038500 cas9 gene Proteins 0.000 description 1
- 230000001364 causal effect Effects 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 210000003710 cerebral cortex Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 229960003677 chloroquine Drugs 0.000 description 1
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- ZYVSOIYQKUDENJ-WKSBCEQHSA-N chromomycin A3 Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1OC(C)=O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@@H](O)[C@H](O[C@@H]3O[C@@H](C)[C@H](OC(C)=O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@@H]1C[C@@H](O)[C@@H](OC)[C@@H](C)O1 ZYVSOIYQKUDENJ-WKSBCEQHSA-N 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 230000007882 cirrhosis Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 230000015271 coagulation Effects 0.000 description 1
- 238000005345 coagulation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 235000008504 concentrate Nutrition 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 238000004624 confocal microscopy Methods 0.000 description 1
- 230000001268 conjugating effect Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 101150055601 cops2 gene Proteins 0.000 description 1
- 239000011258 core-shell material Substances 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- SPTYHKZRPFATHJ-HYZXJONISA-N dT6 Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)CO)[C@@H](O)C1 SPTYHKZRPFATHJ-HYZXJONISA-N 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- 238000000432 density-gradient centrifugation Methods 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 229960003722 doxycycline Drugs 0.000 description 1
- 239000003937 drug carrier Substances 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 230000008482 dysregulation Effects 0.000 description 1
- 230000005670 electromagnetic radiation Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 238000005538 encapsulation Methods 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 1
- 229940073505 ethyl vanillin Drugs 0.000 description 1
- 241001233957 eudicotyledons Species 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000002964 excitative effect Effects 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 230000008622 extracellular signaling Effects 0.000 description 1
- 201000007386 factor VII deficiency Diseases 0.000 description 1
- 208000005376 factor X deficiency Diseases 0.000 description 1
- 201000007219 factor XI deficiency Diseases 0.000 description 1
- 229960000301 factor viii Drugs 0.000 description 1
- 208000015756 familial Alzheimer disease Diseases 0.000 description 1
- 201000007249 familial juvenile hyperuricemic nephropathy Diseases 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 230000001605 fetal effect Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 108010021843 fluorescent protein 583 Proteins 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 210000001222 gaba-ergic neuron Anatomy 0.000 description 1
- 238000003500 gene array Methods 0.000 description 1
- 238000012239 gene modification Methods 0.000 description 1
- 230000009368 gene silencing by RNA Effects 0.000 description 1
- 238000010363 gene targeting Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 238000010448 genetic screening Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 208000007345 glycogen storage disease Diseases 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 101150055960 hemB gene Proteins 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 208000014752 hemophagocytic syndrome Diseases 0.000 description 1
- 208000009429 hemophilia B Diseases 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 208000006359 hepatoblastoma Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 102000056427 human CFTR Human genes 0.000 description 1
- 102000056115 human SYN1 Human genes 0.000 description 1
- 210000005119 human aortic smooth muscle cell Anatomy 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- 208000026095 hyper-IgM syndrome type 1 Diseases 0.000 description 1
- 208000018949 hyper-IgM syndrome type 2 Diseases 0.000 description 1
- 208000025762 hyper-IgM syndrome type 4 Diseases 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003119 immunoblot Methods 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 201000001373 immunodeficiency with hyper-IgM type 2 Diseases 0.000 description 1
- 201000001399 immunodeficiency with hyper-IgM type 4 Diseases 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000000530 impalefection Methods 0.000 description 1
- 238000000126 in silico method Methods 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 238000003017 in situ immunoassay Methods 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 239000012212 insulator Substances 0.000 description 1
- 230000004068 intracellular signaling Effects 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 101150044508 key gene Proteins 0.000 description 1
- 238000011005 laboratory method Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000010410 layer Substances 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 231100000835 liver failure Toxicity 0.000 description 1
- 208000007903 liver failure Diseases 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 230000004777 loss-of-function mutation Effects 0.000 description 1
- 231100000053 low toxicity Toxicity 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000002101 lytic effect Effects 0.000 description 1
- 150000002690 malonic acid derivatives Chemical class 0.000 description 1
- 210000005075 mammary gland Anatomy 0.000 description 1
- 239000008204 material by function Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 210000004379 membrane Anatomy 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000003505 mutagenic effect Effects 0.000 description 1
- 231100000243 mutagenic effect Toxicity 0.000 description 1
- UPBAOYRENQEPJO-UHFFFAOYSA-N n-[5-[[5-[(3-amino-3-iminopropyl)carbamoyl]-1-methylpyrrol-3-yl]carbamoyl]-1-methylpyrrol-3-yl]-4-formamido-1-methylpyrrole-2-carboxamide Chemical compound CN1C=C(NC=O)C=C1C(=O)NC1=CN(C)C(C(=O)NC2=CN(C)C(C(=O)NCCC(N)=N)=C2)=C1 UPBAOYRENQEPJO-UHFFFAOYSA-N 0.000 description 1
- 210000005044 neurofilament Anatomy 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 125000004433 nitrogen atom Chemical group N* 0.000 description 1
- 230000037434 nonsense mutation Effects 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 230000009438 off-target cleavage Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 229940090668 parachlorophenol Drugs 0.000 description 1
- 102000045222 parkin Human genes 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 229920001277 pectin Polymers 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 229940067107 phenylethyl alcohol Drugs 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 108091005981 phosphorylated proteins Proteins 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 238000013081 phylogenetic analysis Methods 0.000 description 1
- 238000003976 plant breeding Methods 0.000 description 1
- 229960003171 plicamycin Drugs 0.000 description 1
- 210000001778 pluripotent stem cell Anatomy 0.000 description 1
- 229960000502 poloxamer Drugs 0.000 description 1
- 229920001983 poloxamer Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 125000004424 polypyridyl Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229940068968 polysorbate 80 Drugs 0.000 description 1
- 235000010241 potassium sorbate Nutrition 0.000 description 1
- 239000004302 potassium sorbate Substances 0.000 description 1
- 229940069338 potassium sorbate Drugs 0.000 description 1
- 244000144977 poultry Species 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000003825 pressing Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 210000002243 primary neuron Anatomy 0.000 description 1
- 229960000286 proflavine Drugs 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- 230000004845 protein aggregation Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001273 protein sequence alignment Methods 0.000 description 1
- 230000012743 protein tagging Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- ZJFJVRPLNAMIKH-UHFFFAOYSA-N pseudo-u Chemical compound O=C1NC(=O)C(C)=CN1C1OC(COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)CO)C(O)C1 ZJFJVRPLNAMIKH-UHFFFAOYSA-N 0.000 description 1
- 238000012207 quantitative assay Methods 0.000 description 1
- 239000013646 rAAV2 vector Substances 0.000 description 1
- 108700022487 rRNA Genes Proteins 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000009711 regulatory function Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000000754 repressing effect Effects 0.000 description 1
- 230000008672 reprogramming Effects 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 230000000630 rising effect Effects 0.000 description 1
- 102220103617 rs878854700 Human genes 0.000 description 1
- 229910052707 ruthenium Inorganic materials 0.000 description 1
- 238000007480 sanger sequencing Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000021317 sensory perception Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000014639 sexual reproduction Effects 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 239000010703 silicon Substances 0.000 description 1
- 229910052710 silicon Inorganic materials 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 229940083542 sodium Drugs 0.000 description 1
- 235000017557 sodium bicarbonate Nutrition 0.000 description 1
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 238000011895 specific detection Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 108010042747 stallimycin Proteins 0.000 description 1
- 238000002672 stereotactic surgery Methods 0.000 description 1
- 108020003113 steroid hormone receptors Proteins 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 229940044609 sulfur dioxide Drugs 0.000 description 1
- 235000010269 sulphur dioxide Nutrition 0.000 description 1
- 239000002344 surface layer Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 238000012385 systemic delivery Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 108010059434 tapasin Proteins 0.000 description 1
- 238000010809 targeting technique Methods 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 108091006106 transcriptional activators Proteins 0.000 description 1
- 230000037426 transcriptional repression Effects 0.000 description 1
- 108091006107 transcriptional repressors Proteins 0.000 description 1
- 230000031998 transcytosis Effects 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000011426 transformation method Methods 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 230000010415 tropism Effects 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 108091005990 tyrosine-phosphorylated proteins Proteins 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 229910001868 water Inorganic materials 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 235000013618 yogurt Nutrition 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 239000011701 zinc Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases RNAses, DNAses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/1034—Isolating an individual clone by screening libraries
- C12N15/1082—Preparation or screening gene libraries by chromosomal integration of polynucleotide sequences, HR-, site-specific-recombination, transposons, viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/30—Chemical structure
- C12N2310/35—Nature of the modification
- C12N2310/351—Conjugate
- C12N2310/3519—Fusion with another nucleic acid
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
Definitions
- the present invention generally relates to the delivery, engineering and optimization of systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and components thereof.
- sequence targeting such as genome perturbation or gene-editing
- CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
- the CRISPR-Cas system does not require the generation of customized proteins to target specific sequences but rather a single Cas enzyme can be programmed by a short RNA molecule to recognize a specific DNA target.
- Adding the CRISPR-Cas system to the repertoire of genome sequencing techniques and analysis methods may significantly simplify the methodology and accelerate the ability to catalog and map genetic factors associated with a diverse range of biological functions and diseases.
- An exemplar ⁇ ' CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
- the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
- the invention provides methods for using one or more elements of a CRISPR system.
- the CRISPR complex of the invention provides an effective means for modifying a target polynucleotide.
- the CRISPR complex of the invention has a wide variety of utilities including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types.
- modifying e.g., deleting, inserting, translocating, inactivating, activating
- the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene or genome editing, gene therapy, dr g discovery, dmg screening, disease diagnosis, and prognosis.
- An exemplary CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
- the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
- aspects of the invention relate to Cas9 enzymes having improved target specificity in a CRISPR ⁇ Cas9 system having guide RNAs having optimal activity, smaller in length than wild- type Cas9 enzymes and nucleic acid molecules coding therefor, and chimeric Cas9 enzymes, as well as methods of improving the target specificity of a Cas9 enzyme or of designing a CRISPR- Cas9 system comprising designing or preparing guide RNAs having optimal activity and/or selecting or preparing a Cas9 enzyme having a smaller size or length than wild-type Cas9 whereby packaging a nucleic acid coding therefor into a delivery vector is advanced as there is less coding therefor in the delivery vector than for wild-type Cas9, and/or generating chimeric Cas9 enzymes.
- a Cas9 enzyme may comprise one or more mutations and may be used as a generic DNA binding protein with or without fusion to a functional domain.
- the mutations may be artificially mtroduced mutations or gain- or loss-of- function mutations.
- the mutations may include but are not limited to mutations in one of the catalytic domains (D10 and H840). Further mutations have been characterized.
- the transcriptional activation domain may be VP64.
- mutated Cas 9 enzyme being fused to domains which include but are not limited to a transcriptional repressor, a recombinase, a transposase, a histone remodeler, a DNA methyitransferase, a cryptochrome, a light inducible/controllable domain or a chemically inducible/con trollab 1 e domain.
- the invention provides for methods to generate mutant tracrRNA and direct repeat sequences or mutant chimeric guide sequences that allow for enhancing performance of these RNAs in cells. Aspects of the invention also provide for selection of said sequences.
- aspects of the invention also provide for methods of simplifying the cloning and delivery of components of the CRISPR complex.
- a suitable promoter such as the U6 promoter
- a DNA oligo is amplified with a DNA oligo and added onto the guide RNA.
- the resulting PCR product can then be transfected into ceils to drive expression of the guide RNA.
- aspects of the invention also relate to the guide RNA being transcribed in vitro or ordered from a synthesis company and directly transfected.
- the invention provides for methods to improve activity by using a more active polymerase.
- the expression of guide RNAs under the control of the T7 promoter is driven by the expression of the T7 polymerase in the cell.
- the cell is a eukaryotic cell.
- the eukaryotic cell is a human ceil.
- the human cell is a patient specific cell.
- the invention provides for methods of reducing the toxicity of Cas enzymes.
- the Cas enzyme is any Cas9 as described herein, for instance any naturally-occurring bacterial Cas9 as well as any chimaeras, mutants, homologs or orthologs.
- the Cas9 is delivered into the cell in the form of mRNA. This allows for the transient expression of the enzyme thereby reducing toxicity.
- the invention also provides for methods of expressing Cas9 under the control of an inducible promoter the constructs used therein.
- the invention provides for methods of improving the in vivo applications of the CRISPR-Cas system.
- the Cas enzyme is wildtype Cas9 or any of the modified versions described herein, including any naturally- occurring bacterial Cas9 as well as any chimaeras, mutants, homologs or orthologs.
- An advantageous aspect of the invention provides for the selection of Cas9 homologs that are easily packaged into viral vectors for delivery.
- Cas9 orthologs typically share the general organization of 3-4 RuvC domains and a HNH domain. The 5' most RuvC domain cleaves the non- complementary strand, and the HNH domain cleaves the complementary strand. All notations are in reference to the guide sequence.
- the catalytic residue in the 5' RuvC domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type II CRISPR locus, S. therm.ophi.lus CRISPR locus .1, S. thennophilus CRISPR locus 3, and Franciscilla novicida type II CRISPR locus), and the conserved Asp residue is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the H domains are mutated to Alanine to convert Cas 9 into a non-complementary- strand nicking enzyme.
- the CRISPR enzyme is a type I or III CRISPR enzyme, preferably a type II CRISPR enzyme.
- This type II CRISPR enzyme may be any Cas enzyme.
- a Cas enzyme may be identified Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system.
- the Cas9 enzyme is from, or is derived from, spCas9 or saCas9.
- derived Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein
- Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
- residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes .
- this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCas9, StlCas9 and so forth. Further examples are provided herein.
- the invention provides for methods of enhancing the function of Cas9 by generating chimeric Cas9 proteins. These methods may comprise fusing -terminal fragments of one Cas9 homolog with C-terminal fragments of another Cas9 homolog. These methods also allow for the selection of new properties displayed by the chimeric proteins.
- the modification may occur ex vivo or in vitro, for instance in a cell culture and in some instances not in vivo. In other embodiments, it may occur in vivo.
- the invention provides for a method of modifying an organism or a non- human organism by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a non-naturally occurring or engineered composition comprising : I.
- a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence may comprise: (a) a first guide sequence capable of hybridizing to the first target sequence, (b) a first tracr mate sequence, (c) a first tracr sequence, (d) a second guide sequence capable of hybridizing to the second target sequence, (e) a second tracr mate sequence, and (f) a second tracr sequence, and il.
- a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences wherein (a), (b), (c), (d), (e) and (f) may be arranged in a 5' to 3' orientation, wherein the polynucleotide sequence may comprise a linker sequence between the first tracr sequence and the second guide sequence, whereby the first guide sequence and the second guide sequence are in tandem, wherein when transcribed, the first and the second tracr mate sequence may hybridize to the first and second tracr sequence respectively and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR complex may comprise the CRISPR.
- the second CRISPR complex may comprise the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the second tracr mate sequence that is hybridized to the second tracr sequence, wherein the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA, and wherein the first guide sequence directs cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directs cleavage of other strand near the second target sequence inducing a double strand break, thereby modifying the organism or the non-human organism.
- the in vention also comprehends a method of modifying an organism or a non-human organism by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a non-natural ly occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
- a first regulatory element operably linked to (a) a first guide sequence capable of hybridizing to the first target sequence, (b) a first tracr mate sequence, (c) a first tracr sequence, (d) a second guide sequence capable of hybridizing to the second target sequence, (e) a second tracr mate sequence, and (f) a second tracr sequence, and wherein a linker sequence is present between the first tracr sequence and the second guide sequence, whereby the first guide sequence and the second guide sequence are in tandem, and II.
- a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and wherein components I and II are located on the same or different vectors of the system, when transcribed, a first tracr mate sequence hybridizes to a first tracr sequence and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR.
- the complex comprises the CRISPR enzyme complexed with (1 ) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence
- the second CRISPR complex comprises the CRISPR enzyme complexed with (1 ) the second guide sequence that is hybridized to the second target sequence, and (2) the second tracr mate sequence that is hybridized to the second tracr sequence
- the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA
- the first guide sequence directs cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directs cleavage of other strand near the second target sequence inducing a double strand break, thereby modifying the organism or the non-human organism with a reduction in likelihood of off-target modifications.
- the second tracr may hybridize with the first tracr-mate.
- the invention also comprehends a non-iiaturaily occurring or engineered composition for modifying an organism or a non-human organism by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising : I.
- a CR.1SPR.-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises: (a) a first guide sequence capable of hybridizing to the first target sequence, (b) a first tracr mate sequence, (c) a first tracr sequence, (d) a second guide sequence capable of hybridizing to the second target sequence, (e) a second tracr mate sequence, and (f) a second tracr sequence, and IL a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, wherein (a), (b), (c), (d), (e) and (f) may be arranged in a 5' to 3' orientation, wherein the polynucleotide sequence comprises a linker sequence between the first tracr sequence and the second guide sequence, whereby the first guide sequence and the second guide sequence are in tandem, wherein when transcribed, the first and
- the modifying of the organism or the non-human organism with a reduction in likelihood of off-target modifications may comprise inducing a microdeletion, wherein the microdeletion may comprise deletion of a sequence between the first and second target sequences.
- the linker sequence may comprise at least 5 nucleotides, or at least 10 nucleotides or at least 20 nucleotides.
- the linker sequence has 8 or 12 nucleotides
- the first or second guide sequence, the first or second tracr sequence and/or the first or second tracr mate sequences are modified, wherein the modification comprises optimized first or second tracr sequence and/or optimized first or second guide sequence and/or, co-fold structure of first or second tracr sequence and/or first or second tracr mate sequence(s) respectively and/or stabilizing secondary structures (hair pins) of first or second tracr sequence and/or first or second tracr sequence with a reduced region of base-pairing and/or first or second tracr sequence fused RNA elements.
- any or all of the polynucleotide sequence encoding the CRJSPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA.
- the invention also comprehends the polynucleotides encoding the sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence, is/are RNA and are delivered via nanoparticles, exosomes, microvesicles, or a gene-gun.
- the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity.
- the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9. It is not necessarily the case for 100% identity between the first traer and second tracr sequence: Many of the altered scaffolds have changes to the DR/TracR sequences as well as the distal hairpins. It is also possible to have tandems involving alternate scaffolds that have distinct DR/TRACR. sequences,
- the invention comprehends a method of modifying an organism or a non-human organism by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cel l comprising delivering a non- naturaliy occurring or engineered composition comprising: I.
- a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherem the polynucleotide sequence comprises: (a) a first guide sequence capable of hybridizing to the first target sequence, (b) a first tracr mate sequence, (c) a first tracr sequence, (d) a second guide sequence capable of hybridizing to the second target sequence, (e) a second tracr mate sequence, and (f) a second tracr sequence, and II.
- a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences and comprising one or more mutations wherein (a), (b), (c), (d), (e) and (f) are may be in a 5 ' to 3' orientation, wherem the polynucleotide sequence comprises a linker sequence between the first tracr sequence and the second guide sequence, whereby the first guide sequence and the second guide sequence are in tandem, wherem when transcribed, the first and the second tracr mate sequence hybridize to the first and second tracr sequence respectively and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence, wherein the second CRISPR complex comprises the CRISPR enzyme
- the invention comprehends a method of modifying an organism or a non-human organism by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising L a first regulatory element operably linked to (a) a first guide sequence capable of hybridizing to the first target sequence, (b) a first tracr mate sequence, (c) a first tracr sequence, (d) a second guide sequence capable of hybridizing to the second target sequence, (e) a second tracr mate sequence, and (f) a second tracr sequence, and wherein a linker sequence is present between the first tracr sequence and the second guide sequence, whereby the first guide sequence and the second guide sequence are in tandem, and II.
- a first tracr mate sequence hybridizes to a first tracr sequence and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively
- the first CRISPR complex comprises the CRISPR enzyme complexed with (1 ) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence
- the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the second tracr mate sequence that is hybridized to the second tracr sequence
- the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA
- the first guide sequence directs cle
- the invention also comprehends a non-naturally occurring or engineered composition modifying an organism or a non-human organism by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a ceil comprising: I.
- a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises: (a) a first guide sequence capable of hybridizing to the first target sequence, (b) a first tracr mate sequence, (c) a first tracr sequence, (d) a second guide sequence capable of hybridizing to the second target sequence, (e) a second tracr mate sequence, and (f) a second tracr sequence, and II.
- a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences and comprising one or more mutations, wherein (a), (b), (e), (d), (e) and (f) may be arranged in a 5' to 3' orientation, wherein the polynucleotide sequence comprises a linker sequence between the first tracr sequence and the second guide sequence, whereby the first guide sequence and the second guide sequence are in tandem, wherein when transcribed, the first and the second tracr mate sequence hybridize to the first and second tracr sequence respectively and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence, wherein the second CRISPR complex comprises the CRISPR
- the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a 5' overhang.
- the 5' overhang is at most 200 base pairs, or at most 100 base pairs, or at most 50 base pairs or at least 26 base pairs or at least 30 base pairs. In a preferred embodiment, the 5' overhang is 34-50 base pairs.
- the invention comprehends any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence, is/are RNA.
- the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity. It is not necessarily the case for 100% identity between the first tracr and second tracr sequence: Many of the altered scaffolds have changes to the DR/TracR sequences as well as the distal hairpins. It is also possible to have tandems involving alternate scaffolds that have distinct DR/TRACR sequences.
- the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9. In a further embodiment, the CRISPR.
- the CRISPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the CRISPR enzyme has the D10A mutation.
- the modification comprises optimized first or second tracr sequence and/or optimized first or second guide sequence and/or, co-fold structure of first or second tracr sequence and/or first or second tracr mate sequence(s) respectively a d/or stabilizing secondary structures (hair pins) of first or second tracr sequence and/or first or second tracr sequence with a reduced region of base-pairing and/or first or second tracr sequence fused RNA elements.
- the linker sequence may comprise at least 5 nucleotides, or at least 10 nucleotides or at least 20 nucleotides. In an advantageous embodiment, the linker sequence has 8 or 12 nucleotides.
- more than two guide sequences may be in tandem.
- the term "tandem single guide RNA” or “tsg NA” is used to refer to one or more single guide RNAs (sgRNAs) connected by one or more linker sequences.
- sgRNAs single guide RNAs
- linker sequences one or more linker sequences.
- two guide sequences are in tandem in the polynucleotide sequence.
- a key aspect of the invention is the utilization of a single promoter or operable element to drive the expression of more tha one guide RN A.
- the invention provides a method of modifying an organism or a non- human organism by manipulation of a target sequence in a genomic locus of interest comprising:
- the CRISPR. complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence and the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA,
- the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence
- the CRISPR. complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence, and the polynucleotide sequence encoding a CRISPR. enzyme is DNA or RNA.
- any or all of the polynucleotide sequence encoding a CRISPR enzyme, guide sequence, tracr mate sequence or tracr sequence may be RNA.
- the polynucleotides encoding the sequence encoding a CRISPR enzyme, the guide sequence, tracr mate sequence or tracr sequence may be RNA and are delivered via nanoparticles, exosomes, microvesicles, or a gene- gun.
- the RNA sequence includes the feature.
- the DNA sequence is or can be transcribed into the RNA the feature at issue.
- the feature is a protein, such as the CRISPR enzyme
- the DNA or RNA sequence referred to is, or can be, translated (and in the case of DNA. transcribed first).
- the invention provides method of modifying an organism., e.g., mammal including human or a non-human mammal or organism by manipulation of a target sequence in a genomic locus of interest comprising delivering a non-naturally occurring or engineered composition comprising a viral or plasmid vector system comprising one or more viral or plasmid vectors operably encoding a composition for expression thereof, wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
- a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotie cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
- chiRNA CRISPR-Cas system chimeric RNA
- a first regulatory element operably linked to (a) a guide sequence capable of hybridizing to a target sequence in a prokaryotic cell, and (b) at least one or more tracr mate sequences, II. a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
- a third regulatory element operably linked to a tracr sequence wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- the vector is a viral vector, such as a lenti- or baeulo- or preferably adeno- viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanoparticles) and are provided.
- a viral vector such as a lenti- or baeulo- or preferably adeno- viral/adeno-associated viral vectors, but other means of delivery are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nanoparticles) and are provided.
- one or more of the viral or plasmid vectors may be delivered via nanoparticles, exosomes, microvesicles, or a gene-gun.
- Applicants By manipulation of a target sequence, Applicants also mean the epigenetic manipulation of a target sequence. This may be of the chromatin state of a target sequence, such as by modification of the methylation state of the target sequence (i.e. addition or removal of methyiation or methylation patterns or CpG islands), histone modification, increasing or reducing accessibility to the target sequence, or by promoting or reducing 3D folding.
- the invention provides a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest in a subject (e.g., mammal or human) or a non-human subject (e.g., mammal ) in need thereof comprising modifying the subject or a non-human subject by manipulation of the target sequence and wherein the condition is susceptible to treatment or inhibition by manipulation of the target sequence comprising providing treatment comprising: delivering a non-naturally occurring or engineered composition comprising an AAV vector system comprising one or more AAV vectors comprising operably encoding a composition for expression thereof, wherein the target sequence is manipulated by the composition when expressed, wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
- a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target- sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
- chiRNA CRISPR-Cas system chimeric RNA
- a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
- a third regulatory element operably linked to a tracr sequence wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- Some methods of the invention can include inducing expression.
- the organism or subject is a eukaryote (including mammal including human) or a non-human eukaryote or a non-human animal or a non-human mammal.
- the organism or subject is a plant.
- the organism or subject is a mammal or a non-human mammal.
- the organism or subject is algae.
- the viral vector is an AAV.
- the CRIS PR enzyme is a Cas9.
- the expression of the guide sequence is under the control of the T7 promoter is driven by the expression of T7 polymerase.
- Applicants By manipulation of a target sequence. Applicants also mean the epigenetic manipulation of a target sequence. This may be of the chromatin state of a target sequence, such as by modification of the methyl ation state of the target sequence (i.e. addition or removal of methylation or methylation patterns or CpG islands), histone modification, increasing or reducing accessibility to the target sequence, or by promoting or reducing 3D folding.
- the mvention provides a method of treating or inhibiting a condition caused by a defect in a target sequence in a genomic locus of interest in a subject or a non-human subject in need thereof comprising modifying the subject or a non-huma subject by manipulation of the target sequence and wherein the condition is susceptible to treatment or inhibition by manipulation of the target sequence comprising providing treatment comprising: delivering a non-natural ly occurring or engineered composition comprising an AAV vector system comprising one or more AAV vectors comprising operably encoding a composition for expression thereof, wherein the target sequence is manipulated by the composition when expressed, wherein the composition comprises: (A) a non-naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising I.
- a first regulatory element operably linked to a CRISPR-Cas system chimeric RNA (chiRNA) polynucleotide sequence wherein the polynucleotide sequence comprises (a) a guide sequence capable of hybridizing to a target sequence in a eukaryotic cell, (b) a tracr mate sequence, and (c) a tracr sequence, and II.
- chiRNA CRISPR-Cas system chimeric RNA
- a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme, and III.
- a third regulatory element operably linked to a tracr sequence wherein components I, II and III are located on the same or different vectors of the system, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- Some methods of the mvention can include inducing expression.
- the organism or subject is a eukaryote or a non-human eukaryote or a non-human animal.
- the organism or subject is a plant.
- the organism or subject is a mammal or a non-human mammal.
- the organism or subject is algae.
- the viral vector is an AAV.
- the CRISPR enzyme is a Cas9.
- the expression of the guide sequence is under the control of the T7 promoter is driven by the expression of T7 polymerase.
- the invention in some embodiments comprehends a method of delivering a CRISPR enzyme comprising delivering to a cell mRNA encoding the CRISPR enzyme.
- the CRISPR enzyme is a Cas9.
- the invention in some embodiments comprehends a method of preparing the AAV of the invention comprising transfecting plasmid(s) containing or consisting essential!)' of nucleic acid molecule(s) coding for the AAV into AAV-infeeted cells, and supplying AAV rep and/or cap obligatory for replication and packaging of the AAV.
- the AAV rep and/or cap obligatory for replication and packaging of the AAV are supplied by transtecting the cells with helper piasmid(s) or helper virus(es).
- the helper vims is a poxvirus, adenovirus, herpesvirus or baculovirus.
- the poxvirus is a vaccinia vims.
- the cells are mammalian cells. And in some embodiments the cells are insect cells and the helper vims is baculovirus.
- pathogens are often host-specific.
- Fiisarium oxysporum f. sp. lycopersici causes tomato wilt but attacks only tomato
- Plants have existing and induced defenses to resist most pathogens. Mutations and recombination events across plant generations lead to genetic variability that gives rise to susceptibility, especially as pathogens reproduce with more frequency than plants. In plants there can be non-host resistance, e.g., the host and pathogen are incompatible.
- Horizontal Resistance e.g., partial resistance against all races of a pathogen, typically controlled by many genes
- Vertical Resistance e.g., complete resistance to some races of a pathogen but not to other races, typically controlled by a few genes.
- Plant and pathogens evolve together, and the genetic changes in one balance changes in other. Accordingly, using Natural V ariability, breeders combine most useful genes for Yield, Quality, Uniformity, Hardiness, Resistance.
- the sources of resistance genes include native or foreign Varieties, Heirloom Varieties, Wild Plant Relatives, and Induced Mutations, e.g., treating plant material with mutagenic agents.
- plant breeders are provided with a new r tool to induce mutations. Accordingly, one skilled in the art can analyze the genome of sources of resistance genes, and in Varieties having desired characteristics or traits employ the present invention to induce the rise of resistance genes, with more precision than previous mutagenic agents and hence accelerate and improve plant breeding programs.
- the invention further comprehends a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in medicine.
- the invention comprehends a composition according to the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) for use in a method according to the invention.
- the invention provides for the use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in ex vivo gene or genome editing.
- the invention comprehends use of a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme) in the manufacture of a medicament for ex vivo gene or genome editing or for use in a method according of the invention.
- the invention comprehends in some embodiments a composition of the invention or a CRISPR enzyme thereof (including or alternatively mRNA encoding the CRISPR enzyme), wherem the target sequence is flanked at its 3' end by 5 '-motif (where N is any Nucleotide), especially where the Cas9 is (or is derived from) S. pyogenes or S. aureus Cas9.
- a suitable PAM is 5 -NRG or 5 -NNGRR for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively, as mentioned below.
- SpCas9 or SaCas9 are those from or derived from S. pyogenes or S. aureus Cas9.
- Apects of the invention comprehend improving the specificity of a CRISPR enzyme, e.g. Cas9, mediated gene targeting and reducing the likelihood of off-target modification by the CRISPR enzyme, e.g. Cas9.
- the invention in some embodiments comprehends a method of modifying an organism or a non-human organism with a reduction in likelihood of off-target modifications by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a non-naturally occurring or engineered composition comprising :
- a first CRISPR-Cas system chimeric RNA. (chiRNA) polynucleotide sequence wherein the first polynucleotide sequence comprises:
- a second CRISPR-Cas system chiRNA polynucleotide sequence wherein the second polynucleotide sequence comprises:
- a polynucleotide sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences and comprising one or more mutations wherein (a), (b) and (c) are arranged in a 5 ' to 3 ' orientation, wherein when transcribed, the first and the second tracr mate sequence hybridize to the first and second tracr sequence respectively and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively, wherein the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the first tracr mate sequence that is hybridized to the first tracr sequence, wherein the second CRISPR complex comprises the CRISPR enzyme complexed wit (1) the second guide sequence that is hybridized to the second target sequence, and (2) the second tracr mate sequence that is hybridized to the second tracr sequence, wherein the polynucleot
- any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA.
- the polynucleotides encoding the sequence encoding the CRISPR. enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA and are delivered via nanopartieles, exosomes, rnicrovesicles, or a gene-gun.
- the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity. It is not necessarily the case for 100% identity between the first tracr and second tracr sequence: Many of the altered scaffolds have changes to the DR/TracR sequences as well as the distal hairpins. It is also possible to have tandems involving alternate scaffolds that have distinct DR/TRACR sequences.
- the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9.
- the CRISPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the CRISPR enzyme has the D10A mutation.
- the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a 5' overhang.
- the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
- the invention in some embodiments comprehends a method of modifying an organism or a non-human organism with a reduction in likelihood of off-target modifications by manipulation of a first and a second target sequence on opposite strands of a DNA duplex in a genomic locus of interest in a cell comprising delivering a no -naturally occurring or engineered composition comprising a vector system comprising one or more vectors comprising
- the tracr mate sequence hybridizes to the tracr sequence and the first and the second guide sequence directs sequence-specific binding of a first and a second CRISPR complex to the first and second target sequences respectively
- the first CRISPR complex comprises the CRISPR enzyme complexed with (1) the first guide sequence that is hybridized to the first target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence
- the second CRISPR complex comprises the CRISPR enzyme complexed with (1) the second guide sequence that is hybridized to the second target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence
- the polynucleotide sequence encoding a CRISPR enzyme is DNA or RNA
- the first guide sequence directs cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directs cleavage of other strand near
- any or all of the polynucleotide sequence encoding the CRISPR enzyme, the first and the second guide sequence, the first and the second tracr mate sequence or the first and the second tracr sequence is/are RNA.
- the first and second tracr mate sequence share 100% identity and/or the first and second tracr sequence share 100% identity. It is not necessarily the case for 100% identity between the first tracr and second tracr sequence: Many of the altered scaffolds have changes to the DR/TraeR sequences as well as the distal hairpins. It is also possible to have tandems involving alternate scaffolds that have distinct DR/TRACR sequences.
- the CRISPR enzyme is a Cas9 enzyme, e.g. SpCas9.
- the CRISPR enzyme comprises one or more mutations in a catalytic domain, wherein the one or more mutations are selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the CRISPR enzyme has the D10A mutation.
- one or more of the viral vectors are delivered via nanoparticies, exosomes, microvesicles, or a gene-gun.
- the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a 5' overhang.
- the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5' overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
- the invention in some embodiments comprehends a method of modifying a genomic locus of interest with a reduction in likelihood of off-target modifications by introducing into a cell containing and expressing a double stranded DNA molecule encoding the gene product an engineered, non-naturally occurring CRISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand of the DNA molecule respectively, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
- the Cas protein nicking each of the first strand and the second strand of the DN A molecule encoding the gene product results in a 5' overhang.
- the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs.
- the 5 " overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs.
- Embodiments of the invention also comprehend the guide RNAs comprising a guide sequence fused to a tracr mate sequence and a tracr sequence.
- the Cas protein is codon optimized for expression in a eukaryotie cell, wherein it may be a mammalian cell or a human cell.
- the Cas protein is a type ⁇ CRISPR-Cas protein, e.g. a Cas 9 protein.
- the Cas protein is a Cas9 protein, e.g. SpCas9.
- the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the Cas protein has the D10A mutation.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an inten ⁇ ening sequence being excised precisely by allowing the two 5' overhangs to reanneal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protein.
- the invention also comprehends an engineered, non-iiaturaily occurring CRISPR-Cas system comprising a Cas protein having one or more mutations and two guide RNAs that target a first strand and a second strand respectively of a double stranded DNA molecule encoding a gene product in a cell, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RN As do not naturally occur together.
- the guide RNAs may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence.
- the Cas protein is a type II CRISPR-Cas protein, in an aspect of the invention the Cas protein is codon optimized for expression in a eukaryotic cell, wherein it may be a mammalian cell or a human cell
- the Cas protem is a type II CRISPR-Cas protein, e.g. a Cas 9 protein.
- the Cas protein is a Cas9 protein, e.g. SpCas9.
- the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N85 A, N863A and D986A.
- the Cas protein has the Dl OA mutation.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DMA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reamieal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protem.
- the invention also comprehends an engineered, non-naturally occurring vector system comprising one or more vectors comprising:
- components (a) and (b) are located on same or different vectors of the system, whereby the guide RNAs target the DNA molecule encoding the gene product and the Cas protein nicks each of the first strand and the second strand of the DNA molecule encoding the gene product, whereby expression of the gene product is altered; and, wherein the Cas protein and the two guide RNAs do not naturally occur together.
- the guide RN may comprise a guide sequence fused to a tracr mate sequence and a tracr sequence.
- the Cas protein is a type II CRISPR-Cas protein.
- the Cas protein is codon optimized for expression in a eukaryotic cell, wherein it may be a mammalian ceil or a human cell.
- the Cas protein is a type II CRISPR-Cas protein, e.g. a Cas 9 protein.
- the Cas protein is a Cas9 protein, e.g. SpCas9.
- the Cas protein has one or more mutations selected from the group consisting of D10A, E762A, H840A, N854A, N863A and D986A.
- the Cas protein has the Dl OA mutation.
- aspects of the invention relate to the expression of the gene product being decreased or a template polynucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5' overhangs to reamieal and ligate or the activity or function of the gene product being altered or the expression of the gene product being increased.
- the gene product is a protein.
- the vectors of the system are viral vectors.
- the vectors of the system are delivered via nanoparticl.es, exosomes, microvesicles, or a gene-gun.
- the invention provides a method of modifying a target polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expressed from a gene comprising the target sequence.
- the method further comprises delivering one or more vectors to said eukaryotic cell, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
- said vectors are delivered to the eukaryotic cell in a subject.
- said modifying takes place in said eukaryotic cell in a cell culture.
- the method further comprises isolating said eukaryotie cell from a subject prior to said modifying.
- the method further comprises returning said eukaryotie cell and/or cells derived therefrom to said subject.
- the invention provides a method of modifying expression of a polynucleotide in a eukaryotie cell.
- the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme compiexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- the method further comprises delivering one or more vectors to said eukaryotie cells, wherein the one or more vectors drive expression of one or more of: the CRISPR enzyme, the guide sequence linked to the tracr mate sequence, and the tracr sequence.
- the invention provides a method of generating a model eukaryotie cell comprising a mutated disease gene.
- a disease gene is any gene associated an increase in the risk of having or developing a disease.
- the method comprises (a) introducing one or more vectors into a eukaryotie cell, wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and (b) allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said disease gene, wherein the CRISPR complex comprises the CRISPR enzyme compiexed with (1) the guide sequence that is hybridized to the target sequence within the target polynucleotide, and (2) the tracr mate sequence that is hybridized to the tracr sequence, thereby generating a model eukaryotie cell comprising a mutated disease gene.
- said cleavage comprises cleaving one or two strands at the location of the target sequence by said CRISPR enzyme. In some embodiments, said cleavage results in decreased transcription of a target gene. In some embodiments, the method further comprises repairing said cleaved target polynucleotide by homologous recombination with an exogenous template polynucleotide, wherein said repair results in a mutation comprising an insertion, deletion, or substitution of one or more nucleotides of said target polynucleotide. In some embodiments, said mutation results in one or more amino acid changes in a protein expression from a gene comprising the target sequence.
- the invention provides for a method of selecting one or more prokaryotic ceil(s) by introducing one or more mutations in a gene in the one or more prokaryotie cell (s), the method comprising: introducing one or more vectors into the prokaryotic cell (s), wherein the one or more vectors drive expression of one or more of: a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, a tracr sequence, and an editing template; wherein the editing template comprises the one or more mutations that abolish CRISPR enzyme cleavage; allowing homologous recombination of the editing template with the target polynucleotide in the cell(s) to be selected; allowing a CRISPR complex to bind to a target polynucleotide to effect cleavage of the target polynucleotide within said gene, wherein the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target
- the CRISPR enzyme is Cas9
- the cell to be selected may be a eukaryotic cell. Aspects of the invention allow for selection of specific cells without requiring a selection marker or a two-step process that may include a counter-selection system.
- the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises increasing or decreasing expression of a target polynucleotide by using a CR ISPR. complex that binds to the polynucleotide.
- one or more vectors comprising a tracr sequence, a guide sequence linked to the tracr mate sequence, a sequence encoding a CRISPR enzyme is delivered to a cell.
- the one or more vectors comprises a regulatoiy element operably linked to an enzyme-coding sequence encoding said CRISPR e zyme comprising a nuclear localization sequence; and a regulatory element operably linked to a tracr mate sequence and one or more insertion sites for inserting a guide sequence upstream of the tracr mate sequence.
- the guide sequence directs sequence-specific binding of a CRISPR complex to a target sequence in a cell.
- the CRISPR complex comprises a CRISPR enzyme complexed with (1 ) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- a target polynucleotide can be inactivated to effect the modification of the expression in a cell
- the target polynucleotide upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does.
- a protein or microRNA coding sequence may be inactivated such that the protein is not produced.
- the CRISPR enzyme comprises one or more mutations DIOA, E762A, H840A, N854A, N863A or D986A and/or the one or more mutations is in a RuvCl or HNH domain of the CRISPR enzyme or is a mutation as otherwise as discussed herein.
- the CRISPR enzyme has one or more mutations in a catalytic domain, wherein when transcribed, the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence, and wherein the enzyme further comprises a functional domain.
- a transcriptional activation domain is VP64.
- a transcription repression domains is KRAB.
- a transcription repression domain is SID, or concatemers of SID (i.e. SID4X).
- an epigenetic modifying enzyme is provided.
- an activation domain is provided, which may be the P65 activation domain.
- the CRISPR enzyme is a type I or III CRISPR enzyme, preferabl a type II CRISPR enzyme.
- This type II CRISPR enzyme may be any Cas enzyme.
- a Cas enzyme may be identified Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system.
- the Cas9 enzyme is from, or is derived from, spCas9 or saCas9,
- spCas9 or saCas9 By derived, Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wildtype enzyme, but that it has been mutated (modified) in some way as described herein.
- Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
- residue numberings used herein refer to the Cas9 enzyme from the type II CRISPR locus in Streptococcus pyogenes.
- this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, StlCas9 and so forth.
- delivery is in the form of a vector which may be a viral vector, such as a lenti- or baculo- or preferably adeno-viral/adeno-associated viral vectors, but other means of deliver)' are known (such as yeast systems, microvesicles, gene guns/means of attaching vectors to gold nano articles) and are provided.
- a vector may mean not only a viral or yeast system (for instance, where the nucleic acids of interest may be operably linked to and under the control (in terms of expression, such as to ultimately provide a processed RNA) a promoter), but also direct delivery of nucleic acids into a host cell.
- the vector may be a viral vector and this is advantageously an AAV
- other viral vectors as herein discussed can be employed.
- bacuioviruses may be used for expression in insect cells. These insect cells may, in turn be useful for producing large quantities of further vectors, such as AAV vectors adapted for delivery of the present invention.
- a method of delivering the present CRISPR enzyme comprising delivering to a cell n RNA encoding the CRISPR enzyme.
- the CRISPR enzyme is truncated, comprised of less than one thousand amino acids or less than four thousand amino acids, is a nuclease or nickase, is codon- optimized comprises one or more mutations, and/or comprises a chimeric CRISPR enzyme, or the other options as herein discussed.
- AAV viral vectors are preferred.
- the target sequence is flanked or followed, at its 3' end, by a PAM suitable for the CRISPR enzyme, typically a Cas and in particular a Cas9.
- a suitable PAM is 5'- RG or 5'-NNGRR for SpCas9 or SaCas9 enzymes (or derived enzymes), respectively.
- SpCas9 or SaCas9 are those from or derived from S. pyogenes or S. aureus Cas9.
- FIG 1 shows a schematic model of the CRISPR system.
- the Cas9 nuclease from Streptococcus pyogenes (yellow) is targeted to genomic DNA by a synthetic guide RNA (sgRNA.) consisting of a 20-nt guide sequence (blue) and a scaffold (red).
- the guide sequence base-pairs with the DNA target (blue), directly upstream of a requisite 5'-NGG protospacer adjacent motif (PAM; magenta), and Cas9 mediates a double-stranded break (DSB) ⁇ 3 bp upstream of the PAM (red triangle).
- PAM magenta
- Figure 2A-F shows a schematic representation assay carried out to evaluate the cleavage specificity of Cas9 form Streptococcus pyogenes, Single base pair mismatches between the guide RNA sequence and the target DNA are mapped against cleavage efficiency in %.
- Figure 3A-F is a circular phylogenetic tree of Cas genes
- Figure 4A-F shows the linear phylogenetic analysis revealing five families of Cas9s, including three groups of large Cas9s (-1400 amino acids) and two of small Cas9s ( ⁇ 1100 amino acids).
- Figure 5 shows a graph representing the length distribution of Cas9 orthologs.
- Figure 6A-M shows sequences where the mutation points are located within the SpCas9 gene.
- Figure 7 A shows the Conditional Cas9, Rosa26 targeting vector map.
- Figure 7B shows the Constitutive Cas9, Rosa26 targeting vector map.
- Figure 8 shows a schematic of the important elements in the Constitutive
- Figure 9 shows delivery and in vivo mouse brain Cas9 expression data.
- Figure 10 shows RNA delivery of Cas9 and chimeric RNA. into cells
- A Delivery of a GFP reporter as either DNA or mRNA into Neuro-2A cells.
- B Delivery of Cas9 and chimeric RNA against the Icam2 gene as RNA results in cutting for one of two spacers tested.
- C Delivery of Cas9 and chimeric RNA against the F7 gene as RNA results in cutting for one of two spacers tested.
- FIG 11 shows how DNA double-strand break (DSB) repair promotes gene editing.
- NHEJ error-prone non-homologous end joining
- Indel random insertion/deletion
- a repair template in the form of a piasmid or single-stranded oligodeoxynucleotides (ssODN) can be supplied to leverage the homology-directed repair (HDR) pathway, which allows high fidelity and precise editing.
- Figure 12A-C shows shows anticipated results for HDR in HEK and HUES9 cells
- Either a targeting plasmid or an ssODN (sense or antisense) with homology arms can be used to edit the sequence at a target genomic locus cleaved by Cas9 (red triangle).
- a targeting plasmid or an ssODN (sense or antisense) with homology arms can be used to edit the sequence at a target genomic locus cleaved by Cas9 (red triangle).
- a targeting plasmid or an ssODN sense or antisense
- ssODNs oriented in either the sense or the antisense is or a) direction relative to the locus of interest, can be used in combination with Cas9 to achieve efficient HDR-mediated editing at the target locus.
- ssODNs Example of the effect of ssODNs on HDR in the EMX1 locus is shown using both wild-type Cas9 and Cas9 nickase (DIOA).
- Each ssODN contains homology arms of 90 bp flanking a 12-bp insertion of two restriction sites.
- Figure 13A-C shows the repair strategy for Cystic Fibrosis delta F508 mutation.
- Figure 14A-15 shows (a) a schematic of the GAA repeat expansion in FXN intron 1 and (b) a schematic of the strategy adopted to excise the GAA expansion region using the CRISPR/Cas system.
- Figure 15 shows a screen for efficient SpCas9 mediated targeting of Tetl-3 and Dnmtl, 3a and 3b gene loci.
- Surveyor assay on DNA. from transfected N2A cells demonstrates efficient DNA cleavage by using different gRNAs.
- Figure 16 shows a strategy of multiplex genome targeting using a 2 -vector system in an AAV 1/2 delivery system. Tetl-3 and Dnmtl , 3a and 3b gRNA under the control of the U6 promoter. GFP-KASH under the control of the human synapsin promoter. Restriction sides shows simple gRNA replacement strategy by subclomng. HA-tagged SpCas9 flanked by two nuclear localization signals (NLS) is shown. Both vectors are delivered into the brain by AAV 1/2 virus in a 1 : 1 ratio.
- NLS nuclear localization signals
- Figure 17 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay. N2A cells were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci. gRNA only (-) is negative control. Cells were harvested for DNA purification and downstream processing 48 h after transfection. [0122] Figure 18 shows verification of multiplex DNMT targeting vector #2 functionality using Surveyor assay. N2A cells were co-transfected with the DNMT targeting vector #1 (+) and the SpCas9 encoding vector for testing SpCas9 mediated cleavage of DNMTs genes family loci. gRNA only (-) is negative control. Cells were harvested for D A purification and downstream processing 48 h after transfection.
- Figure 19 shows schematic overview of short promoters and short polyA versions used for HA-SpCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right.
- Figure 20 shows schematic overview of short promoters and short polyA versions used for HA-SaCas9 expression in vivo. Sizes of the encoding region from L-ITR to R-ITR are shown on the right.
- Figure 21 shows expression of SpCas9 and SaCas9 in N2A cells. Representative Western blot of HA-tagged SpCas9 and SaCas9 versions under the control of different short promoters and with or short polyA (spA) sequences. Tubulin is loading control. mCherry (mCh) is a transfection control. Cells were harvested and further processed for Western blotting 48 h after transfection.
- spA short polyA
- Figure 22 shows screen for efficient SaCas9 mediated targeting of Tet3 gene locus.
- Surveyor assay on DNA. from transfected N2A cells demonstrates efficient DNA cleavage by using different gRNAs with NNGGGT PUM sequence.
- GFP transfected cells and ceils expressing only SaCas9 are controls.
- Figure 23 shows expression of HA-SaCas9 in the mouse brain.
- Animals were injected into dentate gyri with virus driving expression of HA-SaCas9 under the control of human Sytiapsin promoter. Animals were sacrificed 2 weeks after surgery.
- HA tag was detected using rabbit monoclonal antibody C29F4 (Cell Signaling). Cell nuclei stained in blue with DAPI stain.
- Figure 24 shows expression of SpCas9 and SaCas9 in cortical primary neurons in culture 7 days after transduction. Representative Western blot of HA-tagged SpCas9 and SaCas9 versions under the control of different promoters and with bgh or short polyA (spA) sequences. Tubulin is loading control.
- Figure 25 shows LIVE/DEAD stain of primary cortical neurons 7 days after transduction with AAV1 particles carrying SpCas9 with different promoters and multiplex gRNAs constructs (example shown on the last panel for DNMTs). Neurons after AAV transduction were compared with control untransduced neurons. Red nuclei indicate permeabilized, dead cells (second line of panels). Live cells are marked in green color (third line of panels).
- Figure 26 shows LIVE/DEAD stain of primary cortical neurons 7 days after transduction with AAVl particles carrying SaCas9 with different promoters. Red nuclei indicate permeabilized, dead ceils (second line of panels). Live cells are marked in green color (third line of panels).
- FIG. 27 shows comparison of morphology of neurons after transduction with AAVl vims canying SpCas9 and gRNA multiplexes for TETs and DNMTs genes loci. Neurons without transduction are shown as a control.
- Figure 28 shows verification of multiplex DNMT targeting vector #1 functionality using Surveyor assay in primary cortical neurons.
- Cells were co-transduced with the DNMT targeting vector #1 and the SpCas9 viruses with different promoters for testing SpCas9 mediated cleavage of DNMTs genes family loci.
- Figure 29 shows in vivo efficiency of SpCas9 cleavage in the brain.
- Mice were injected with AAV 1/2 vims carrying gRNA multiplex targeting DNMT family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat Map lb.
- Figure 30 shows purification of GFP -KASH labeled cell nuclei from hippocampai neurons.
- the outer nuclear membrane (ONM) of the cell nuclear membrane is tagged with a fusion of GFP and the KASH protein transmembrane domain. Strong GFP expression in the brain after one week of stereotactic surgery and AAV 1/2 injection. Density gradient centrifugation step to purify cell nuclei from intact brain. Purified nuclei are shown. Chromatin stain by Vybrant® DyeCycleTM Ruby Stain is shown in red, GFP labeled nuclei are green.
- FIG. 31 shows efficiency of SpCas9 cleavage in the mouse brain.
- Mice were injected with AA.Vl/2 virus carrying gRNA. miiitiplex targeting TET family genes loci together with SpCas9 viruses under control of 2 different promoters: mouse Mecp2 and rat Map lb.
- Three weeks after injection brain tissue was extracted, nuclei were prepped and sorted using FACS, based on the GFP expression driven by Synapsin promoter from gRNA multiplex construct. After gDNA extraction Surveyor assay was run. + indicates GFP positive nuclei and - control, GFP-negative nuclei from the same animal. Numbers on the gel indicate assessed SpCas9 efficiency.
- Figure 32 shows GFP-KASFI expression in cortical neurons in culture. Neurons were transduced with AAVl vims carrying gRNA multiplex constructs targeting TET genes loci. The strongest signal localize around cells nuclei due to KAS domain localization.
- Figure 33 shows (top) a list of spacing (as indicated by the pattern of arrangement for two PAM sequences) between pairs of guide RNAs. Only guide RNA pairs satisfying patterns 1, 2, 3, 4 exhibited indels when used with SpCas9(DlGA) nickase. (bottom) Gel images showing that combination of SpCas9(D10A) with pairs of guide RNA satisfying patterns L 2, 3, 4 led to the formation of indels in the target site.
- Figure 34 shows a list of U6 reverse primer sequences used to generate U6-guide RNA expression, casssettes. Each primer needs to be paired with the U6 forward primer "gcactgagggcctatttcccatgattc" to generate amplicons containing U6 and the desired guide RNA.
- Figure 35 shows a Genomic sequence map from the human Emxl locus showing the locations of the 24 patterns listed in Figure 33.
- Figure 36 shows on (right) a gel image indicating the formation of indels at the target site when variable 5 " ' overhangs are present after cleavage by the Cas9 nickase targeted by different pairs of guide RNAs. on (left) a table indicating the lane numbers of the gel on the right and various parameters including identifying the guide RN A pairs used and the length of the 5' overhang present following cleavage by the Cas9 nickase.
- Figure 37 shows a Genomic sequence map from the human Emxl locus showing the locations of the different pairs of guide RNAs that result in the gel patterns of Figure 36 (right) and which are further described in Example 30.
- Figure 38 ⁇ - ⁇ shows (A) Optimization of sgRNA scaffold for additional stability; Architectures A and B are indicated.
- (B) a schematic illustrating a tandem sgRNA (2 sgRNAs connected by a linker) driven by a single U6 promoter
- (C) a gel figure indicating tsg NAs are designed to target a region of EMXl so that, when co-tratisfected into HEK cells with vvt Cas9, mediates a genomic microdeletion. Here, the targets flank the last exon of EMXl .
- tsgRNAs are synthesized with either custom scaffold A or B that differ from the vvt sgRNA scaffold (as indicated above).
- D a gel figure where, alternatively, tsgRNAs are designed to target a region of EMXl so that, when co-transfected into HEK cells with DIOA Cas9, mediates an indel as previously described in double nickase experiments. Spacers are chosen so that the left and right targets are offset with at least 0, or 4 -bp of non-overlap in between the 20-bp targets, and resulting cuts from DIOA would generate 5 '-overhangs.
- the gel image shows SURVEYOR assay measuring indels from either D IOA Cas9 co-transfected with either a single tsgRNA encoding 2 spacers or two separate sgRNA, where the former can mediate a similar level of indels as the latter.
- Figure 39A-C shows (A) tandem ientivirai vector design. (B) the scaffold sequences for LentiCRiSPR. (C) a schematic and gel image indicating that the tandem guide R As constructd of modified scaffolds are more efficiently processed to individual units.
- Figure 4 ⁇ - ⁇ shows paired sgRNAs induce indels via double-nicking with the nickase Cas9n
- A Schematic illustrating DNA double strand break using a pair of Cas9 DIOA nickases (Cas9n). Two sgRNA target Cas9n to nick both strands of DNA. The DIOA mutation renders Cas9 capable of only cleaving the DNA strand that is complementary to the sgRNA.
- the offset distance refers to the length of DNA between the closest ends of the paired sgRNAs, in this case 4bp.
- Figure 41 A-B shows double-nicking is able to induce indels
- A Graphs showing indel frequency corresponding to indicated sgRNA offset distances across three different human genes: EMXl, DYRK1A, GRIN2B.
- B As an example, sequence of the human EMXl locus targeted by Cas9n. sgRNA target sites and PAMs are indicated by blue and magenta bars respectively. Below, selected sequences showing representative indels.
- Figure 42A-C shows double nicking strategy is able to facilitate homologous recombination
- A Schematic illustrating HDR targeted via a single stranded oligodeoxynucleotide (ssODN) template at a DSB created by a pair of Cas9n. Successful recombination at the DSB site introduces a Hindlll restriction site.
- B Restriction digest assay gel showing successful insertion of HindlH cleavage sites by double nicking-facilitated HDR in HE 293FT cells. Upper bands are unmodified template; lower bands are HindlH cleavage product.
- Figure 43 shows characterization of double nicking spacing for homologous recombination.
- Schematic illustrating HDR with ssODN template shown in blue, introduced HindlH site in red).
- Red arrowheads indicate binding site of respective sgRNA with black bars corresponding putative overhangs resulting from paired nicking activity.
- Panels at right show efficiency of recombination with the indicated sgRNA pairs, overhang length and type, and offset distances between paired sgRNAs.
- Figure 44A-D shows double-nicking reduces non-specific activity at known off- target sites.
- A Schematic showing the target human EM.X1 locus and sgRNA target sites. Genomic off-target sites for the right sgRNA are listed below. Off-target sites were identified previously as described in Hsu et al48.
- B SURVEYOR gels showing modification at the on- target site by Cas9n with two sgRNAs as well as by wild-type Cas9 with individual sgRNA. mdels at off-target 5 were only observed for wild-type Cas9 with sgRNA 1.
- C The levels of off-target modification are quantified using deep sequencing at all five off-target loci.
- Figure 45A-B shows rational mutagenesis of sgRNA architecture.
- A Schematic of the chimeric sgRNA architecture with 20-bp guide sequence encoding for the target specificity. The different regions of the sgRNA interrogated by mutagenesis are named and highlighted above.
- B Description of mutations made and corresponding in del activity at human EMX1 locus.
- Figure 46 shows distal hairpin and DDR stabilization retains comparable indei activity. Schematic showing sequence of three alternative scaffold architectures aimed at stabilization of the hairpins with changes base-pairs denoted in black. Indel -inducing activity of corresponding scaffolds compared to the wild-type sp85 architecture is shown at right,
- Figure 47A-C shows U6-driven tandem guide RNAs are able to efficiently target two genomic loci.
- A Schematic illustrating a tandem sgRNA (2 sgRNAs connected by a linker) driven by a single U6 promoter. Images of PAGE gels of SURVEYOR assays demonstrate that tsgRNAs using modified RNA scaffolds delivered with the mckase Cas9n or wild-type Cas9 are able to induce genomic indeis or microdeletions, (B and C, respectively) with frequencies comparable to co-delivery of two independent sgRNAs,
- Figure 48 shows optimization of tandem sgRNA linker length and structure.
- Gel quantification of band intensities from PCR amplification of the human EMXl target loci comparing relative abundance of wild-type and modified DNA with varying tandem linkers of 0, 4, 8, 12, 16 base pairs, half direct repeat or full direct repeat (listed in bottom panel).
- Figure 49A-C shows tandem guide RNAs are efficiently processed in only the first position
- A Schematic showing tandem guide RNA scaffolds encoding for either EMXl .3 or EMX63 in the first or second position with position of Emxl .3 Northern probe shown in red.
- B Northern blot analysis examining processing of tandem sgRNA in cells.
- C SURVEYOR assay examining independent sgRNA activity targeting two genomic loci, DYR 1A and GRIN2B. The three left lanes in both panels are tsgRNAs targeting DYRK1A in the first position and GRIN2B in the second position. Conversely, three right lanes target GRIN2B first and then DYRK.1A second.
- Figure 50A-C shows optimization of tsgRNA scaffold pairings.
- A Schematic of tandem scaffold design with first spacer targeting Grin2B using Scaffold A and second spacer targeting Cas9 itself using Scaffold B in a Cas9-T2A-GFP expressing plasmid.
- B Single U6- guide controls show both an increase in the percentage of GFP-negative cells as well as a decrease in mean fluorescence intensity of the positive fraction.
- C 12x12 matrix of tandem scaffold pairings and results of subsequent analyses by flow cytometry.
- Figure 51 shows tandem pairs between divergent scaffolds improve second spacer activity. Sequence alignment of the sgRNA scaffolds used in the previous study to the sp85 scaffold.
- Figure 52 shows different truncations of the Bi-directional U6 promoter and associated microdeletion activity and quantification of indel-inducing activity coming off of either side of the bi-directional promoter.
- Figure 53 shows a sequence of the smallest U6-8/U6-1 bi-directional reporter
- the Cas9 nuclease from the microbial CRISP R- Cas system is targeted to specific genomic loci by a 20 nt guide sequence, which can tolerate certain mismatches to the DNA target and thereby promote undesired off-target mutagenesis.
- Ran et ai described an approach that combined a Cas9 nickase mutant with paired guide RNAs to introduce targeted double-strand breaks. Because individual nicks in the genome are repaired with high fidelity, simultaneous nicking via appropriately offset guide RNAs is required for double-stranded breaks and extends the number of specifically recognized bases for target cleavage.
- ⁇ Ran et ai described a set of tools for Cas9-.mediated genome editing via non-homologous end joining (NHEJ) or homoiogy-directed repair (HDR) in mammalian cells, as well as generation of modified cell lines for downstream functional studies.
- NHEJ non-homologous end joining
- HDR homoiogy-directed repair
- the authors further described a double-nicking strategy using the Cas9 nickase mutant with paired guide RNAs.
- the protocol provided by the authors experimentally derived guidelines for the selection of target sites, evaluation of cleavage efficiency and analysis of off-target activity.
- the studies showed that beginning with target design, gene modifications can be achieved within as little as 1-2 weeks, and modified clonal cell lines can be derived within 2-3 weeks.
- Nishimasu et al. reported the crystal structure of Streptococcus pyogenes Cas9 in complex with sgRNA and its target DNA at 2.5 A° resolution.
- the structure revealed a bilobed architecture composed of target recognition and nuclease lobes, accommodating the sgR.NA.:DNA heteroduplex in a positively charged groove at their interface.
- the recognition lobe is essential for binding sgRNA and DNA
- the nuclease lobe contains the HNH and RuvC nuclease domains, which are properly positioned for cleavage of the complementary and non-complementar strands of the target DNA, respectively.
- the nuclease lobe also contains a carboxyl-terminal domain responsible for the interaction with the protospacer adjacent motif (PAM).
- PAM protospacer adjacent motif
- Hsu 2014 is a review article that discusses generally CRISPR-Cas9 history from yogurt to genome editing, including genetic screening of cells, that is in the information, data and findings of the applications in the lineage of this specification filed prior to June 5, 2014.
- the general teachings of Hsu 2014 do not involve the specific models, animals of the instant specification.
- the invention relates to the engineering and optimization of systems, methods and compositions used for the control of gene expression involving sequence targeting, such as genome perturbation or gene-editing, that relate to the CRISPR-Cas system and components thereof.
- sequence targeting such as genome perturbation or gene-editing
- the Cas enzyme is Cas9.
- An advantage of the present methods is that the CRISPR system avoids off-target binding and its resulting side effects. This is achieved using systems arranged to have a high degree of sequence specificity for the target DNA.
- Cas9 optimization may be used to enhance function or to develop new functions, one can generate chimeric Cas9 proteins. Examples that the Applicants have generated are provided in Example 6.
- Chimeric Cas9 proteins can be made by combining fragments from different Cas9 homologs. For example, two example chimeric Cas9 proteins from the Cas9s described herein. For example, Applicants fused the N ⁇ term of Stl Cas9 (fragment from this protein is in bold) with C-term of SpCas9.
- the benefit of making chimeric Cas9s include any or all of:
- the Cas9 may be used as a generic DNA binding protein.
- Cas9 as a generic DNA binding protein by mutating the two catalytic domains (D10 and H84Q) responsible for cleaving both strands of the DN A target.
- VP64 transcriptional activation domain
- Other transcriptional activation domains are known.
- transcriptional activation is possible.
- gene repression in this case of the beta-cateniii gene
- Cas9 repressor DNA- binding domain
- Transgenic animals are also provided.
- Preferred examples include animals comprising Cas9, in terms of polynucleotides encoding Cas9 or the protein itself. Mice, rats and rabbits are preferred.
- To generate transgenic mice with the constructs as exemplified herein one may inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant female, e.g. a CB56 female. Founders may then be identified are identified, genotyped, and backcrossed to CB57 mice. The constructs may then be cloned and optionally verified, for instance by Sanger sequencing. Knock outs are envisaged where for instance one or more genes are knocked out in a model.
- conditional Cas9 mouse may cross their conditional Cas9 mouse with a mouse that ubiquitously expresses Cre (ACTB-Cre line) and may arrive at a mouse that expresses Cas9 in every ceil, it should only take the delivery of chimeric RNA to induce genome editing in embryonic or adult mice.
- conditional Cas9 mouse is crossed with a mouse expressing Cre under a tissue specific promoter, there should only be Cas9 in the tissues that also express Cre. This approach may be used to edit the genome in only precise tissues by delivering chimeric RNA to the same tissue.
- transgenic animals are also provided, as are transgenic plants, especially crops and algae.
- the transgenic may be useful in applications outside of providing a disease model. These may include food of feed production through expression of, for instance, higher protein, carbohydrate, nutrient or vitamins levels than would normally be seen in the wildtype.
- transgenic plants, especial ly pulses and tubers, and animals, especial ly mammals such as livestock (cows, sheep, goats and pigs), but also poultry and edible insects, are preferred.
- Transgenic algae or other plants such as rape may be particularly useful in the production of vegetable oils or biofuels such as alcohols (especially methanol and ethanol), for instance. These may be engineered to express or overexpress high levels of oil or alcohols for use in the oil or biofuel industries.
- alcohols especially methanol and ethanol
- AAV In terms of in vivo delivery, AAV is advantageous over other viral vectors for a couple of reasons:
- AAV has a packaging limit of 4.5 or 4.75 Kb. This means that Cas9 as well as a promoter and transcription terminator have to be al l fit into the same viral vector. Constructs larger than 4.5 or 4.75 Kb will lead to significantly reduced vims production. SpCas9 is quite large, the gene itself is over 4, 1 Kb, which makes it difficult for packing into AAV . Therefore embodiments of the invention include utilizing homologs of Cas9 that are shorter. For example:
- Double vims vector [0124] Double vims vector:
- Vector 1 containing one expression cassette for driving the expression of Cas9
- Vector 2 containing one more expression cassettes for driving the expression of one or more guideRNAs
- Promoter used to drive Cas9 coding nucleic acid molecule expression can include:
- AAV ITR can serve as a promoter: this is advantageous for eliminating the need for an additional promoter element (which can take up space in the vector). The additional space freed up can be used to drive the expression of additional elements (gRNA, etc). Also, ITR activity is relativeiy weaker, so can be used to reduce toxicity due to over expression of Cas9. [0133] For ubiquitous expression, can use promoters: CMV, CAG, CBh
- hematopoietic cells can use IFNbeta or CD45
- Promoter used to drive guide RNA can include:
- the AAV can be AAV1 , AAV2, AAV5 or any combination thereof.
- AAV 8 is useful for delivery to the liver. The above promoters and vectors are preferred individually.
- RNA delivery is also a useful method of in vivo delivery.
- Figure 9 shows delivery and in vivo mouse brain Cas9 expression data. It is possible to deliver Cas9 and gRNA (and, for instance, HR repair template) into cells using liposomes or nanoparticles.
- delivery of the CRISPR enzyme, such as a Cas9 and/or delivery of the RNAs of the invention may be in RNA form and via microvesicles, liposomes or nanoparticles.
- Cas9 mRNA and gRNA can be packaged into liposomal particles for delivery in vivo.
- Liposomal transfection reagents such as Invivofectamine from Life Technologies and other reagents on the market can effectively deliver RNA molecules into the liver.
- Enhancing NHEJ or HR efficiency is also helpful for delivery. It is preferred that NHEJ efficiency is enhanced by co-expressing end-processing enzymes such as Trex2 (Dumitrache et al. Genetics. 201 1 August; 188(4): 787-797). It is preferred that HR efficiency is increased by transiently inhibiting NHEJ machineries such as Ku70 and u86. HR efficiency can also be increased by co-expressing prokaryotic or eukaryotic homologous recombination enzymes such as RecBCD, RecA. [0146] Various means of delivery are described herein, and further discussed in this section.
- the CRISPR enzyme for instance a Cas9, and/or any of the present RNAs, for instance a guide RNA, can be delivered using adeno associated vims (AAV), lentivirus, adenovirus or other viral vector types, or combinations thereof.
- Cas9 and one or more guide RNAs can be packaged into one or more viral vectors.
- the viral vector is delivered to the tissue of interest by, for example, an intramuscular injection, while other times the viral deliver is via intravenous, transdermal, intranasal, oral, mucosal, or other delivery methods. Such delivery may be either via a single dose, or multiple doses.
- AAV adeno associated vims
- lentivirus lentivirus
- adenovirus adenovirus
- the viral vector is delivered to the tissue of interest by, for example, an intramuscular injection, while other times the viral deliver is via intravenous, transdermal, intranasal, oral, mucosal, or other delivery
- the actual dosage to be delivered herein may vary greatly depending upon a variety of factors, such as the vector chose, the target cell, organism, or tissue, the general condition of the subject to be treated, the degree of transformation/modification sought, the administration route, the administration mode, the type of transformation/modification sought, etc.
- Such a dosage may further contain, for example, a carrier (water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.), a diluent, a pharmaceuticaily-acceptable carrier (e.g., phosphate- buffered saline), a pharmaceutically-acceptable excipient, and/or other compounds known in the art.
- a carrier water, saline, ethanol, glycerol, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, etc.
- a pharmaceuticaily-acceptable carrier e.g., phosphate- buffered saline
- a pharmaceutically-acceptable excipient e.g., a pharmaceutically-acceptable excipient, and/or other
- the dosage may further contain one or more pharmaceutically acceptable salts such as, for example, a mineral acid salt such as a hydrochloride, a hydrobromide, a phosphate, a sulfate, etc.; and the salts of organic acids such as acetates, propionates, malonates, benzoates, etc.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, gels or gelling materials, flavorings, colorants, , microspheres, polymers, suspension agents, etc. may also be present herein.
- Suitable exemplary ingredients include macrocrystalline cellulose, carboxymethyleellulose sodium, polysorbate 80, phenylethyl alcohol, chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gailate, the parabens, ethyl vanillin, glycerin, phenol, parachlorophenol, gelatin, albumin and a combination thereof.
- the delivery is via an adenovims, which may be at a single booster dose containing at least 1 x 10 5 particles (also referred to as particle units, pu) of adenoviral vector.
- the dose preferably is at least about 1 x 10 6 particles (for example, about 1 x 10 D -1 x 10 12 particles), more preferably at least about 1 x 10 7 particles, more preferably at least about 1 x I Q 8 particles (e.g., about 1 x 10 8 -1 x 10 n particles or about 1 x 10 8 -1 x 10 l2 particles), and most preferably at least about 1 x 10 J particles (e.g., about 1 x 10 9 - 1 x 10 1J particles or about 1 x 10 9 - 1 x 10 12 particles), or even at least about 1 x 10 10 particles (e.g., about 1 x 10 lU -l x 10 particles) of the adenoviral vector.
- the dose comprises no more than about 1 x 10 particles, preferably no more than about 1 x 1.0 ⁇ particles, even more preferably no more than about 1 x 10 " particles, even more preferably no more than about 1 x 10 11 particles, and most preferably no more than about 1 x 10 1 " particles (e.g., no more than about. 1 x 1() 9 articles).
- the dose may contain a single dose of adenoviral vector with, for example, about 1 x 10° particle units (pu), about 2 x 10 6 pu, about 4 x 10 6 pu, about 1 x 10' pu, about.
- the adenovirus is delivered via multiple doses.
- the delivery is via an AAV.
- a therapeutically effective dosage for in vivo delivery of the AAV to a human is believed to be in the range of from about 20 to about 50 ml of saline solution containing from about 1 x 10 10 to about 1 x 10 10 functional AAV/ml solution. The dosage may be adjusted to balance the therapeutic benefit against any side effects.
- the AAV dose is generally in the range of concentrations of from about 1 x 10 3 to 1 x 10 30 genomes AAV, from about 1 x 10 8 to 1 x 10 ⁇ ° genomes AAV, from about 1 x 10 1 " to about 1 x 10 l6 genomes, or about 1 x 10 1 ' to about 1 x 10 lD genomes AAV.
- a human dosage may be about I x 10 3 i genomes AAV.
- concentrations may be delivered in from about 0.001 ml to about 100 ml, about 0.05 to about 50 ml, or about 10 to about 25 ml of a carrier solution.
- Other effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves. See, for example, U.S. Patent No. 8,404,658 B2 to Hajjar, et al, granted on March 26, 2013, at col. 27, lines 45-60.
- the delivery is via a plasmid.
- the dosage should be a sufficient amount of plasmid to elicit a response.
- suitable quantities of plasmid DNA in plasmid compositions can be from about 0.1 to about 2 mg, or from about 1 ⁇ ig to about 10 ug.
- the doses herein are based on an average 70 kg individual.
- the frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), or scientist skilled in the art.
- a mouse used in experiments is typically considered 20g, and one skilled in the art can extrapolate dosages from a 20g mouse to a 70 kg individual.
- Cas9 and one or more guide RNA can be delivered using adeno associated virus (AAV), lentivims, adenovirus or other plasmid or viral vector types, using formulations and doses from, for example, US Patents Nos. 8,454,972 (formulations, doses for adenovirus), 8,404,658 (formulations, doses for AAV) and 5,846,946 (formulations, doses for DNA plasmids) and from clinical trials and publications regarding the clmical trials involving lentivims, AAV and adenovirus.
- AAV the route of administration, formulation and dose can be as in US Patent No. 8,454,972 and as in clinical trials involving AAV.
- the route of administration, formulation and dose can be as in US Patent No. 8,404,658 and as in clinical trials involving adenovirus.
- the route of administration, formulation and dose can be as in US Patent No 5,846,946 and as in clinical studies involving plasmids.
- Doses may be based on or extrapolated to an average 70 kg individual, and can be adjusted for patients, subjects, mammals of different weight and species. Frequency of administration is within the ambit of the medical or veterinary practitioner (e.g., physician, veterinarian), depending on usual factors including the age, sex, general health, other conditions of the patient or subject and the particular condition or symptoms being addressed.
- the viral vectors can be injected into the tissue of interest.
- the expression of Cas9 can be driven by a cell-type specific promoter.
- liver- specific expression might use the Albumin promoter and neuron-specific expression might use the Synapsin I promoter.
- RNA delivery The CRISPR enzyme, for instance a Cas9, and/or any of the present RN As, for instance a guide RNA, can also be delivered in the form of RN A.
- Cas9 mRNA can be generated using in vitro transcription.
- Cas9 mRNA can be synthesized using a PGR cassette containing the following elements: T7 prom.oter-k.ozak sequence (GCCACC)-Cas9-3 ' UTR from beta globin-polyA tai l (a string of 120 or more adenines).
- the cassette can be used for transcription by T7 polymerase.
- Guide RNAs can also be transcribed using in vitro transcription from a cassette containing T7_promoter-GG-guide RNA sequence.
- the CRISPR enzyme and/or guide RNA can be modified using pseudo-U or 5-Methyl-C.
- CR ISPR enzyme mRNA and guide RNA may be delivered simultaneously using nanoparticles or lipid envelopes.
- CRISPR enzyme mRNA and guide RNA might also be delivered separately.
- CRISPR. enzyme mRNA can be delivered prior to the guide RNA to give time for CRISPR enzyme to be expressed.
- CRISPR enzyme mRNA might be administered 1-12 hours (preferably around 2-6 hours) prior to the administration of guide RNA.
- CRISPR enzyme mRNA and guide RNA can be administered together.
- a second booster dose of guide RNA can be administered 1-12 hours (preferably around 2-6 hours) after the initial administration of CRISPR enzyme mRNA + guide RNA.
- CRISPR enzyme mRNA and/or guide RNA might be useful to achieve the most efficient levels of genome modification.
- CRISPR enzyme mRNA and guide RNA delivered For minimization of toxicity and off-target effect, it will be important to control the concentration of CRISPR enzyme mRNA and guide RNA delivered.
- Optimal concentrations of CRISPR enzyme mRNA and guide RNA can be determined by testing different concentrations in a cellular or animal model and using deep sequencing the analyze the extent of modification at potential off-target genomic loci. For example, for the guide sequence targeting 5'- GAGTCCGAGCAGAAGAAGAA-3 ' in the EMX1 gene of the human genome, deep sequencing can be used to assess the level of modification at the following two off-target loci, 1 : 5 ' -GAGTCCTAGC AGGAGAAG AA-3 ' and 2: 5' -GAGTCTAAGCAGAAGAAGAA-3 ' .
- the concentration that gives the highest level of on-target modification while minimizing or with a reduction in likelihood of the level of off-target modification should be chosen for in vivo delivery.
- CRISPR enzyme nickase mRNA for example S. pyogenes Cas9 with the D10A mutation
- CRISPR enzyme nickase mRNA can be delivered with a pair of guide RNAs targeting a site of interest.
- the two guide RNAs need to be spaced as follows. Guide sequences in red (single underline) and blue (double underline) respectively
- the 5' overhang is at most 200 base pairs, preferably at most 100 base pairs, or more preferably at most 50 base pairs. In embodiments of the invention the 5 " overhang is at least 26 base pairs, preferably at least 30 base pairs or more preferably 34-50 base pairs or 1-34 base pairs. In other preferred methods of the invention the first guide sequence directing cleavage of one strand of the DNA duplex near the first target sequence and the second guide sequence directing cleavage of other strand near the second target sequence results in a blunt cut or a 3' overhang. In embodiments of the invention the 3' overhang is at most 150, 100 or 25 base pairs or at least 15, 10 or 1 base pairs. In preferred embodiments the 3' overhang is 1 - 100 base pairs.
- aspects of the invention relate to the expression of the gene product being decreased or a template pol nucleotide being further introduced into the DNA molecule encoding the gene product or an intervening sequence being excised precisely by allowing the two 5 ' overhangs to reanneal and ligate or the activity or function of the gene product being al tered or the expression of the gene product being increased.
- the gene product is a protein.
- Additional delivery options for the brain include encapsulation of CRISPR enzyme and guide RNA in the form of either UNA or RNA into liposomes and conjugating to molecular Trojan horses for trans-blood brain barrier (BBB) delivery.
- BBB trans-blood brain barrier
- Molecular Trojan horses have been shown to be effective for delivery of B-gal expression vectors into the brain of non-human primates.
- the same approach can be used to delivery vectors containing CRISPR enzyme and guide RNA.
- Xia CF and Boado RJ, Pardridge WM Antibody-mediated targeting of siRNA via the human insulin receptor using avidin-biotin technology. Mol Pharm. 2009 May-Jun;6(3):747-51.
- siRNA short interfering RNA
- mAb monoclonal antibody
- avidin-biotin a receptor-specific monoclonal antibody
- the authors also report that because the bond between the targeting mAb and the siRNA is stable with avidin-biotin technology, and RNAi effects at distant sites such as brain are observed in vivo following an intravenous administration of the targeted siRN A.
- the HIRMAb enables the liposome carrying the exogenous gene to undergo transcytosis across the blood -brain bamer and endocytosis across the neuronal plasma membrane following intravenous injection.
- the level of luciferase gene expression in the brain was 50-fold higher in the rhesus monkey as compared to the rat.
- Widespread neuronal expression of the beta- galactosidase gene in primate brain was demonstrated by both histochemistry and confocal microscopy. The authors indicate that this approach makes feasible reversible adult transgenics in 24 hours. Accordingly, the use of immunoliposome is preferred. These may be used in conjunction with antibodies to target specific tissues or cell surface proteins.
- RNA Ribonucleic acid
- nanoparticles Cho, S., Goldberg, M., Son, S., Xu, Q., Yang, F., Mei, Y., Bogatyrev, 8., Langer, R. and Anderson, D., Lipid-like nanoparticles for small interfering RNA delivery to endothelial cells, Advanced Functional Materials, 19: 3112-31 18, 2010
- exosomes Schroeder, A,, Levins, €., Cortez, C, Langer, R., and Anderson, D., Lipid-based nanotherapeutics for siRNA delivery, Journal of Internal Medicine, 267: 9-21, 2010, PMID: 20059641).
- exozomes have been shown to be particularly useful in delivery siRNA, a system with some parallels to the CRISPR system.
- El-Andaloussi S, et al. (“Exosome -mediated delivery of siRNA in vitro and in vivo.” Nat Protoc. 2012 Dec;7(12):21 12-26. doi: 10.1038/nprot.2012.131. Epub 2012 Nov 15.) describe how exosomes are promising tools for drug delivery across different biological barriers and can be harnessed for deliver ⁇ ' of siRNA in vitro and in vivo.
- Their approach is to generate targeted exosomes through transfection of an expression vector, comprising an exosomal protein fused with a peptide ligand. The exosomes are then purify and characterized from transfected cell supernatant, then siRNA is loaded into the exosomes.
- Targeted deletion of genes is preferred. Examples are exemplified in Example 12. Preferred are, therefore, genes involved in cholesterol biosynthesis, fatty acid biosynthesis, and other metabolic disorders, genes encoding mis-folded proteins involved in amyloid and other diseases, oncogenes leading to cellular transformation, latent viral genes, and genes leading to dominant-negative disorders, amongst other disorders.
- Applicants prefer gene delivery of a CRISPR-Cas system to the liver, brain, ocular, epithelial, hematopoetic, or another tissue of a subject or a patient in need thereof, suffering from metabolic disorders, amyloidosis and protein-aggregation related diseases, cellular transformation arising from genetic mutations and translocations, dominant negative effects of gene mutations, latent viral infections, and other related symptoms, using either viral or nanoparticle delivery system,
- Therapeutic applications of the CRISPR-Cas system include G laucoma, Amyloidosis, and Huntington's disease. These are exemplified in Example 14 and the features described therein are preferred alone or in combination.
- CRISPR-Cas guide RNAs that target the vast majority of the HIV-1 genome while taking into account HIV-1 strain variants for maximal coverage and effectiveness.
- host immune ceils could be a) isolated, transduced with CRISPR-Cas, selected, and reintroduced in to the host or b) transduced in vivo by systemic delivery of the CRISPR-Cas system.
- the first approach allows for generation of a resistant immune population whereas the second is more likely to target latent viral reservoirs within the host. This is discussed in more detail in the Examples section.
- the present invention generates a gene knockout cell library. Each cell may have a single gene knocked out. This is exemplified in Example 17.
- This library is useful for the screening of gene function in cellular processes as well as diseases.
- To make this cell library one may integrate Cas9 driven by an inducible promoter (e.g. doxycycline inducible promoter) into the ES ceil.
- an inducible promoter e.g. doxycycline inducible promoter
- To make the ES cell library one may simply mix ES cells with a library of genes encoding guide RNAs targeting each gene in the human genome.
- each guide RNA. gene may be contained on a plasmid that carries of a single attP site. This way BxBl will recombine the attB site in the genome with the attP site on the guide RNA containing plasmid.
- To generate the cell library one may take the library of cells that have single guide RNAs integrated and induce Cas9 expression. After induction, Cas9 mediates double strand break at sites specified by the guide RNA.
- the immunogenicity of protein drugs can be ascribed to a few immunodominant helper T lymphocyte (HTL) epitopes. Reducing the MHC binding affinity of these HTL epitopes contained within these proteins can generate drugs with lower immunogenicity (Tangri S, et al. ("Rationally engineered therapeutic proteins with reduced immunogenicity'' J Immunol. 2005 Mar 15 ; 174(6) : 3187-96.)
- the immunogenicity of the CRISPR enzyme in particular may be reduced following the approach first set out in Tangri et al with respect to erythropoietin and subsequently developed. Accordingly, directed evolution or rational design may be used to reduce the immunogenicity of the CRISPR enzyme (for instance a Cas9) in the host species (human or other species).
- Example 28 Applicants used 3 guideRNAs of interest and able to visualize efficient DNA cleavage in vivo occurring only in a small subset of cells. Essentially, what Applicants have shown here is targeted in vivo cleavage. In particular, this provides proof of concept that specific targeting in higher organisms such as mammals can also be achieved. It also highlights multiplex aspect in that multipie guide sequences (i.e. separate targets) can be used simultaneously (in the sense of co-delivery). In other words. Applicants used a multipie approach, with several different sequences targeted at the same time, but independently.
- Example 29 A suitable example of a protocol for producing AAV, a preferred vector of the invention is provided in Example 29.
- Trinucleotide repeat disorders are preferred conditions to be treated. These are also exemplified herein.
- a method of gene therapy for the treatment of a subject having a mutation in the CFTR gene comprises administering a therapeutically effective amount of a CRISPR-Cas gene therapy particle, optionally via a biocompatible pharmaceutical carrier, to the cells of a subject.
- the target DNA comprises the mutation deltaF508.
- the mutation is repaired to the wildtype.
- the mutation is a deletion of the three nucleotides that comprise the codon for phenylalanine (F) at position 508. Accordingly, repair in this instance requires remtroduction of the missing codon into the mutant.
- an adenovirus/AAV vector system is introduced into the host cell, cells or patient.
- the system comprises a Cas9 (or Cas9 nickase) and the guide RNA along with a adenovirus/AAV vector system comprising the homology repair template containing the F5Q8 residue.
- This may be introduced into the subject via one of the methods of delivery discussed earlier.
- the CRISPR-Cas system may be guided by the CFTRdelta 508 chimeric guide RNA. It targets a specific site of the CFTR genomic locus to be nicked or cleaved.
- the repair template is inserted into the cleavage site via homologous recombination correcting the deletion that results in cystic fibrosis or causes cystic fibrosis related symptoms.
- This strategy to direct delivery and provide systemic introduction of CRJSPR systems with appropriate guide RNAs can be employed to target genetic mutations to edit or otherwise manipulate genes that cause nietabolic, liver, kidney and protein diseases and disorders such as those in Table B.
- CFTRdelta508 chimeric guide RNA For an example of CFTRdelta508 chimeric guide RNA, see Example which demonstrates gene transfer or gene delivery of a CRISPR-Cas system in airways of subject or a patient in need thereof, suffering from cystic fibrosis or from cystic fibrosis (CF) related symptoms, using adeno-assoeiated virus (AAV) particles. In particular, they exemplify a repair strategy for Cystic Fibrosis delta F508 mutation. This type of strategy should apply across all organisms. With particular reference to CF, suitable patients may include: Human, non-primate human, canine, feline, bovine, equine and other domestic animals. In this instance, Applicants utilized a CRISPR-Cas system comprising a Cas9 enzyme to target deltaF508 or other CFTR- inducing mutations.
- AAV adeno-assoeiated virus
- aerosolized AAV vector system per lung endobronchial ⁇ delivered while spontaneously breathing.
- aerosolized delivery is preferred for AAV delivery in general.
- An adenovirus or an AAV particle may be used for delivery.
- Suitable gene constructs, each operably linked to one or more regulatory sequences, may be cloned into the delivery vector.
- Cbh or EFla promoter for Cas9, U6 or HI promoter for chimeric guide RNA A preferred arrangement is to use a CFTRdelta508 targeting chimeric guide, a repair template for deltaF508 mutation and a codon optimized Cas9 enzyme (preferred Cas9s are those with nuclease or nickase activity) with optionally one or more nuclear localization signal or sequence(s) ( LS(s)), e.g., two (2) NLSs. Constructs without NLS are also envisaged.
- the PAM may contain a NGG or a NNAGAAW motif.
- the present method comprises manipulation of a target sequence in a genomic locus of interest comprising
- composition comprising a viral vector system comprising one or more viral vectors operably encoding a composition for expression thereof, wherein the composition comprises: [0189] a non-naturally occurring or engineered composition comprising a vector system com rising one or more vectors comprising
- a second regulatory element operably linked to an enzyme-coding sequence encoding a CRISPR enzyme comprising at least one or more nuclear localization sequences, [0195] wherein (a), (b) and (c) are arranged in a 5' to 3' orientation,
- the tracr mate sequence hybridizes to the tracr sequence and the guide sequence directs sequence-specific binding of a CRISPR complex to the target sequence
- the CRISPR complex comprises the CRISPR enzyme complexed with (1) the guide sequence that is hybridized to the target sequence, and (2) the tracr mate sequence that is hybridized to the tracr sequence.
- preferred target DNA sequences comprise the CFTRdelta508 mutation.
- a preferred PAM is described above.
- a preferred CRISPR enzyme is any Cas (described herein, but particularly that described in Example 16).
- Alternatives to CF include any genetic disorder and examples of these are well known.
- Another preferred method or use of the invention is for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease.
- a "guide sequence” may be distinct from “guide RNA”.
- a guide sequence may refer to an approx. 20bp sequence, within the guide RNA, that specifies the target site.
- the Cas9 is (or is derived from) the SpCas9.
- preferred mutations are at any or ail or positions 10, 762, 840, 854, 863 and/or 986 of SpCas9 or corresponding positions in other Cas9s (which may be ascertained for instance by standard sequence comparison tools.
- any or all of the following mutations are preferred in SpCas9: D10A, E762A, H840A, N854A, N863A and/or D986A; as well as conservative substitution for any of the replacement amino acids is also envisaged .
- the same (or conservative substitutions of these mutations) at corresponding positions in other Cas9s are also preferred.
- Particularly preferred are D10 and H840 in SpCas9.
- residues corresponding to SpCas9 D10 and H840 are also preferred. These are advantageous as they provide ickase activity.
- the invention uses nucleic acids to bind target DNA sequences. This is advantageous as nucleic acids are much easier and cheaper to produce and the specificity can be varied according to the length of the stretch where homology is sought. Complex 3-D positioning of multiple fingers, for example is not required.
- polynucleotide refers to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Polynucleotides may have any three dimensional structure, and may perform any function, known or unknown.
- polynucleotides coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, nbosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers.
- loci locus defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, nbosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branche
- a polynucleotide may comprise one or more modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- wild type is a term of the art understood by skilled persons and means the typical form of an organism, strain, gene or characteristic as it occurs in nature as distinguished from mutant or variant forms.
- variable should be taken to mean the exhibition of qualities that have a pattern that deviates from what occurs in nature.
- nucleic acid molecules or polypeptides mean that the nucleic acid molecule or the polypeptide is at least substantially free from at least one other component with which they are naturally associated in nature and as found in nature.
- Complementarity refers to the ability of a nucleic acid to form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick base pairing or other non- traditional types.
- a percent complementarity indicates the percentage of residues in a nucleic acid molecule which can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 being 50%. 60%, 70%, 80%, 90%. and 100% complementary).
- Perfectly complementary means that all the contiguous residues of a nucleic acid sequence will hydrogen bond with the same number of contiguous residues in a second nucleic acid sequence.
- Substantially complementary refers to a degree of complementarity that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, or more nucleotides, or refers to two nucleic acids that hybridize under stringent conditions.
- stringent conditions for hybridization refer to conditions under which a nucleic acid having complementarity to a target sequence predominantly hybridizes with the target sequence, and substantially does not hybridize to non-target sequences. Stringent conditions are generally sequence-dependent, and vary depending on a number of factors. In general, the longer the sequence, the higher the temperature at which the sequence specifically hybridizes to its target sequence. Non-limiting examples of stringent conditions are described in detail in Tijssen (1993), Laboratory Techniques In Biochemistry And Molecular Biology- Hybridization With Nucleic Acid Probes Part I, Second Chapter “Overview of principles of hybridization and the strategy of nucleic acid probe assay", Elsevier, N.Y.
- complementary or partially complementary sequences are also envisaged. These are preferably capable of hybridising to the reference sequence under highly stringent conditions.
- relatively low-stringency hybridization conditions are selected: about 20 to 25° C. lower than the thermal melting point (T m ).
- T m is the temperature at which 50% of specific target sequence hybridizes to a perfectly complementary probe in solution at a defined ionic strength and pH.
- highly stringent washing conditions are seiected to be about 5 to 15° C. lower than the T m .
- moderately-stringent washing conditions are selected to be about 15 to 30° C. lower than the T m .
- Highly permissive (very low stringency) washing conditions may be as low as 50° C. below the T m , allowing a high level of mis-matching between hybridized sequences.
- Other physical and chemical parameters in the hybridization and wash stages can also be altered to affect the outcome of a detectable hybridization signal from a specific level of homology between target and probe sequences.
- Preferred highly stringent conditions comprise incubation in 50% formamide, 5> ⁇ SSC, and 1% SDS at 42° C, or incubation in 5> ⁇ SSC and 1% SDS at 65° C, with wash in 0.2xSSC and 0.1% SDS at 65° C.
- Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
- the hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner.
- the complex may comprise two strands forming a duplex structure, three or more strands forming a multi stranded complex, a single self- hybridizing strand, or any combination of these.
- a hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme.
- a sequence capable of hybridizing with a given sequence is referred to as the "complement" of the given sequence.
- genomic locus or “locus” (plural loci) is the specific location of a gene or DNA sequence on a chromosome.
- a “gene” refers to stretches of DNA or RNA that encode a polypeptide or an RNA chain that has functional role to play in an organism and hence is the molecular unit of heredity in li ving organisms.
- genes include regions which regulate the production of the gene product, whether or not such regulator ⁇ ' sequences are adjacent to coding and/or transcribed sequences.
- a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions.
- expression of a genomic locus or “gene expression” is the process by which information from a gene is used in the synthesis of a functional gene product.
- the products of gene expression are often proteins, but in non-protein coding genes such as rRNA genes or tRNA genes, the product is functional RN A.
- the process of gene expression is used by all known life - eukaryotes (including multicellular organisms), prokaryotes (bacteria and archaea) and viruses to generate functional products to survive.
- expression of a gene or nucleic acid encompasses not only cellular gene expression, but also the transcription and translation of nucleic acid(s) in cloning systems and in any other context.
- expression also refers to the process by which a polynucleotide is transcribed from a D A template (such as into and mRNA or other RNA transcript) and/or the process by which a transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides may be collectively referred to as "gene product.” If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRN A in a eukaryotic cell .
- polypeptide refers to polymers of amino acids of any length.
- the polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non amino acids.
- the terms also encompass an amino acid polymer that has been modified; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation, such as conjugation with a labeling component.
- amino acid includes natural and/or unnatural or synthetic amino acids, including glycine and both the D or L optical isomers, and amino acid analogs and peptidomimetics.
- domain refers to a part of a protein sequence that may exist and function independently of the rest of the protein chain.
- sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences.
- the capping region of the dTALEs described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.
- Sequence homologies may be generated by any of a number of computer programs known in the art, for example BLAST or FASTA, etc.
- a suitable computer program for carrying out such an alignment is the GCG Wisconsin Bestfit package (University of Wisconsin, U.S. A; Devereux et aL 1984, Nucleic Acids Research 12:387).
- Examples of other software than may perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al., 1999 ibid - Chapter 18), FASTA (Atschui et aL 1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison tools. Both BLAST and FASTA are available for offline and online searching (see Ausubel et al, 1999 ibid, pages 7-58 to 7-60). However it is preferred to use the GCG Bestfit program.
- Percentage (%) sequence homology may be calculated over contiguous sequences, i.e., one sequence is aligned with the other sequence and each amino acid or nucleotide in one sequence is directly compared with the corresponding amino acid or nucleotide in the other sequence, one residue at a time. This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues.
- BLAST and FASTA are available for offline and online searching (see Ausubel et aL, 1999, Short Protocols in Molecular Biology, pages 7-58 to 7-60). However, for some applications, it is preferred to use the GCG Bestfit program.
- a new tool, called BLAST 2 Sequences is also available for comparing protein and nucleotide sequences (see FEMS Microbiol Lett. 1999 174(2): 247-50; FEMS Microbiol Lett. 1999 177(1): 187-8 and the website of the National Center for Biotechnology information at the website of the National Institutes for Health).
- the final % homology may be measured in terms of identity, the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pair-wise comparison based on chemical similarity or evolutionary distance.
- An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs.
- GCG Wisconsin programs generally use either the public default values or a custom symbol comparison table, if supplied (see user manual for further details). For some applications, it is preferred to use the public default values for the GCG package, or in the case of other software, the default matrix, such as BLOSUM62.
- percentage homologies may be calculated using the multiple alignment feature in DNASIS llVl (Hitachi Software), based on an algorithm, analogous to CLUSTAL (Higgins DG & Sharp PM (1988), Gene 73(1), 237-244).
- % homology preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
- sequences may also have deletions, insertions or substitutions of amino acid residues which produce a silent change and result in a functionally equivalent substance.
- Deliberate amino acid substitutions may be made on the basis of similarity in amino acid properties (such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues) and it is therefore useful to group amino acids together in functional groups.
- Amino acids may be grouped together based on the properties of their side chains alone. However, it is more useful to include mutation data as well.
- the sets of amino acids thus derived are likely to be conserved for structural reasons. These sets may be described in the form of a Venn diagram (Livingstone CD. and Barton G.J.
- Embodiments of the invention include sequences (both polynucleotide or polypeptide) which may comprise homologous substitution (substitution and replacement are both used herein to mean the interchange of an existing amino acid residue or nucleotide, with an alternative residue or nucleotide) that may occur i.e., iike-for-Iike substitution in the case of amino acids such as basic for basic, acidic for acidic, polar for polar, etc.
- Non-homologous substitution may also occur i.e., from one class of residue to another or alternatively involving the inclusion of unnatural amino acids such as ornithine (hereinafter referred to as Z), diammobutyric acid ornithine (hereinafter referred to as B), norieucine ornithine (hereinafter referred to as O), pyriyialanine, thienylalanine, naphthylaianine and phenylglycine.
- Z ornithine
- B diammobutyric acid ornithine
- O norieucine ornithine
- pyriyialanine pyriyialanine
- thienylalanine naphthylaianine
- phenylglycine unnatural amino acids
- Variant amino acid sequences may include suitable spacer groups that may be inserted between any two amino acid residues of the sequence including alkyl groups such as methyl, ethyl or propyl groups in addition to amino acid spacers such as glycine or ⁇ -alanine residues.
- alkyl groups such as methyl, ethyl or propyl groups
- amino acid spacers such as glycine or ⁇ -alanine residues.
- a further form of variation which involves the presence of one or more amino acid residues in peptoid form, may be well understood by those skilled in the art.
- the peptoid form is used to refer to variant amino acid residues wherein the ct-carbon substituent group is on the residue's nitrogen atom rather than the a-carbon.
- the invention provides for vectors that are used in the engineering and optimization of CRISPR-Cas systems.
- a "vector” is a tool that allows or facilitates the transfer of an entity from one environment to another. It is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Generally, a vector is capable of replication when associated with the proper control elements. In general, the term “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g. circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.
- viral vector wherein viraliy-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g.
- Viral vectors also include polynucleotides carried by a virus for transfection into a host cell.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- Other vectors e.g., non-episomal mammalian vectors are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as "expression vectors.”
- Common expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed.
- "operably linked" is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g. in an in vitro transcription ⁇ translation system or in a host ceil when the vector is introduced into the host ceil).
- aspects of the invention relate to vectors for chimeric RNA and Cas9.
- Bicistronic expression vectors for chimeric RNA and Cas9 are preferred.
- Cas9 is preferably driven by the CBh promoter.
- the chimeric RNA may preferably be driven by a U6 promoter. Ideally the two are combined.
- the chimeric guide RNA typicaliy consists of a 20bp guide sequence (Ns) and this may be joined to the tracr sequence (running from the first "U" of the lower strand to the end of the transcript). The tracr sequence may be truncated at various positions as indicated.
- the guide and tracr sequences are separated by the traer-mate sequence, which may be GUUUUAGAGCUA. This may be followed by the loop sequence GAAA as shown. Both of these are preferred examples.
- ChiRNAs are indicated by their "+n" designation, and crRNA refers to a hybrid RNA where guide and tracr sequences are expressed as separate transcripts.
- chimeric RNA may also be called single guide, or synthetic guide RNA (sgRNA).
- the loop is preferably GAAA, but it is not limited to this sequence or indeed to being only 4bp in length.
- preferred loop forming sequences for use in hairpin structures are four nucleotides in length, and most preferably have the sequence GAAA. However, longer or shorter loop sequences may be used, as may alternative sequences.
- the sequences preferably include a nucleotide triplet (for example, AAA), and an additional nucleotide (for example C or G). Examples of loop forming sequences include CAAA and AAAG.
- the U6 promoter may be a bi-directional promoter.
- Figure 52 depicts panels of data: the first showing different truncations of the Bi-directional U6 promoter and associated microdeletion activity and the second quantifying the ind el-inducing activity coming off of either side of the bi-directional promoter.
- Figure 52 represents yet another means by which it is possible to deliver two independent sgRNAs off of a single U6 promoter that is independent of and complementary to the tandem sgRNA approach .
- the increase in size of the U6 promoter is minimal, which makes this amenable and attractive to in vivo/AAV delivery applications where vector size represents a significant constraint.
- regulatory ⁇ ' element is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenyiation signals and poly-U sequences).
- promoters e.g. promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenyiation signals and poly-U sequences).
- IRES internal ribosomal entry sites
- regulatory elements e.g. transcription termination signals, such as polyadenyiation signals and poly-U sequences.
- Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences).
- a tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as muscle, neuron, bone, skin, blood, specific organs (e.g. liver, pancreas), or particular cell types (e.g. lymphocytes). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific.
- a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol I promoters), one or more pol II promoters (e.g. 1, 2, 3, 4, 5, or more pol 11 promoters), one or more pol I promoters (e.g.
- pol I promoters 1 , 2, 3, 4, 5, or more pol I promoters), or combinations thereof.
- pol 111 promoters include, but are not limited to, U6 and HI promoters.
- pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al.
- RSV Rous sarcoma virus
- CMV cytomegalovirus
- the SV40 promoter the dihydro folate reductase promoter, the ⁇ -actm promoter, the phosphoglycerol kinase (PGK) promoter, and the EFla promoter.
- regulatory element include WPRE; CMV enhancers; the R-U5' segment in LTR of HTLV-I (Mol. Cell. Biol, Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the iiitron sequence between exons 2 and 3 of rabbit ⁇ -giobin (Proe. Natl. Acad. Sci. USA., Vol.
- a vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., clustered regularly interspersed short palindromic repeats (CRISPR) transcripts, proteins, enzymes, mutant forms thereof ' !, fusion proteins thereof, etc.).
- CRISPR clustered regularly interspersed short palindromic repeats
- CRISPR transcripts e.g. nucleic acid transcripts, proteins, or enzymes
- CRISPR transcripts can be expressed in bacteria] cells such as Escherichia coli, insect ceils (using baculovirus expression vectors), yeast cells, or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZY OLOGY 1 85, Academic Press, San Diego, Calif. (1990).
- the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulator sequences and T7 polymerase,
- Vectors may be introduced and propagated in a prokaryote or prokaryotic cell.
- a prokaryote is used to amplify copies of a vector to be introduced into a eukaryotic cell or as an intermediate vector in the production of a vector to be introduced into a eukaryotic cell (e.g. amplifying a plasmid as part of a viral vector packaging system).
- a prokaryote is used to amplify copies of a vector and express one or more nucleic acids, such as to provide a source of one or more proteins for delivery to a host cell or host organism.
- Fusion vectors add a number of amino acids to a protein encoded therein, such as to the amino terminus of the recombinant protein.
- Such fusion vectors may serve one or more purposes, such as: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification.
- a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein.
- Such enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
- Example fusion expression vectors include pGEX (Pharmacia Biotech Ine; Smith and Johnson, 1988.
- GST glutathione S-transferase
- Examples of suitable inducible non-fusion E. coii expression vectors include pTrc (Amrann et al., (1988) Gene 69:301-315) and pET l id (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif (1990) 60-89).
- a vector is a yeast expression vector.
- yeast Saccharomyces cerivisae examples include pYepSecl (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kuijan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 1 13-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).
- a vector drives protein expression in insect cells using baculovirus expression vectors.
- Bacuiovirus vectors available for expression of proteins in cultured insect cells include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
- a vector is capable of driving expression of one or more sequences in mammalian cel ls using a mammalian expression vector.
- mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J, 6: 187-195).
- the expression vector's control functions are typically provided by one or more regulator ⁇ ' elements.
- commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art.
- the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid).
- tissue-specific regulatory elements are known in the art.
- suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinker?, et al., 1987. Genes Dev. 1 : 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J.
- a regulatory element is operably linked to one or more elements of a CRISPR system so as to drive expression of the one or more elements of the CRISPR system.
- CRISPRs Clustered Regularly Interspaced Short Palindromic Repeats
- SPIDRs Sacer Interspersed Direct Repeats
- the CRISPR locus comprises a distinct class of interspersed short sequence repeats (SSRs) that were recognized in E. coli (Ishino et al, J. Bacterid., 169:5429-5433 [1987]; and Nakata et al, J.
- the CRISPR loci typically differ from other SSRs by the structure of the repeats, which have been termed short regularly spaced repeats (SRSRs) (Janssen et al., OMICS J. Integ. Biol,, 6:23-33 [2002]; and Mojica et al, Mol. Microbiol, 36:244-246 [2000]).
- SRSRs short regularly spaced repeats
- the repeats are short elements that occur in clusters that are regularly spaced by unique intervening sequences with a substantially constant length (Mojica et al,, [2000], supra).
- CRISPR loci have been identified in more than 40 prokaryotes (See e.g., Jansen et al., Mol.
- CRISPR system refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR -associated (“Cas") genes, including sequences encoding a Cas gene, a tracr (trans -activating CRISPR) sequence (e.g. tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a "spacer” in the context of an endogenous CRISPR system h or other sequences and transcripts from a CRISPR locus.
- tracr trans -activating CRISPR
- tracr-mate sequence encompassing a "direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system
- guide sequence also referred to as a "spacer” in the context of an endogenous CRISPR
- one or more elements of a CRISPR. system is derived from a type I, type II, or type III CRISPR system.
- one or more elements of a CRISPR system is derived from a particular organism comprising an endogenous CRISPR system, such as Streptococcus pyogenes.
- a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system).
- target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex.
- a target sequence may comprise any polynucleotide, such as DNA or RNA polynucleotides.
- a target sequence is located in the nucleus or cytoplasm of a cell.
- direct repeats may be identified in silico by searching for repetitive motifs that fulfill any or all of the following criteria:
- 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, all 3 criteria may be used.
- candidate tracrRNA may be subsequently predicted by sequences that fulfill any or all of the following criteria:
- 2 of these criteria may be used, for instance 1 and 2, 2 and 3, or 1 and 3. In some embodiments, all 3 criteria may be used.
- chimeric synthetic guide RNAs may incorporate at least 12 bp of duplex structure between the direct repeat and tracrRNA.
- the CRISPR system is a type II CRISPR system and the Cas enzyme is Cas9, which catalyzes DNA cleavage.
- Cas9 which catalyzes DNA cleavage.
- Enzymatic action by Cas9 derived from Streptococcus pyogenes or any closely related Cas9 generates double stranded breaks at target site sequences which hybridize to 20 nucleotides of the guide sequence and that have a pro tospacer- adjacent motif (P AM) sequence (examples include NGG/NRG or a PAM that can be determined as described herein) following the 20 nucleotides of the target sequence.
- P AM pro tospacer- adjacent motif
- CRISPR activity through Cas9 for site-specific DNA recognition and cleavage is defined by the guide sequence, the tracr sequence that hybridizes in part to the guide sequence and the PAM sequence. More aspects of the CRISPR system are described in arginov and Hannon, The CRISPR system: small RNA-guided defence in bacteria and archaea. Mole Ceil 2010, January 15; 37(1): 7.
- the type II CRISPR locus from Streptococcus pyogenes SF370 which contains a cluster of four genes Cas9, Casl , Cas2, and Csnl, as well as two non-coding RNA elements, tracrRNA and a characteristic array of repetitive sequences (direct repeats) interspaced by short stretches of non-repetitive sequences (spacers, about 30bp each).
- DSB targeted DNA double-strand break
- tracrRNA hybridizes to the direct repeats of pre-crRNA, which is then processed into mature crRNAs containing individual spacer sequences.
- the mature crRNA:tracrRNA complex directs Cas9 to the DNA target consisting of the protospacer and the corresponding PAM via heteroduplex formation between the spacer region of the crRNA and the protospacer DNA.
- Cas9 mediates cleavage of target DNA upstream of PAM to create a DSB within the protospacer ( Figure 2 A).
- Figure 2B demonstrates the nuclear localization of the codon optimized Cas9.
- the RNA polymerase III -based U6 promoter was selected to drive the expression of tracrRNA ( Figure 2C).
- a U6 promoter-based construct was developed to express a pre-crRNA array consisting of a single spacer flanked by two direct repeats (DRs, also encompassed by the term "tracr-mate sequences"; Figure 2C).
- the initial spacer was designed to target a 33-base-pair (bp) target site (30-bp protospacer plus a 3 -bp CRISPR. motif (PAM) sequence satisfying the NGG recognition motif of Cas9) in the human ⁇ locus ( Figure 2C), a key gene in the development of the cerebral cortex.
- a CRISPR complex comprising a guide sequence hybridized to a target sequence and eomplexed with one or more Cas proteins
- formation of a CRISPR complex results in cleavage of one or both strands in or near (e.g. within 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 50, or more base pairs from) the target sequence.
- the tracr sequence which may comprise or consist of al l or a portion of a wild- type tracr sequence (e.g.
- one or more vectors driving expression of one or more elements of a CRISPR system are introduced into a host ceil such that expression of the elements of the CRISPR system direct formation of a CRISPR complex at one or more target sites.
- a Cas enzyme, a guide sequence linked to a tracr-mate sequence, and a tracr sequence could each be operably linked to separate regulatory elements on separate vectors.
- two or more of the elements expressed from the same or different regulatory elements may be combined in a single vector, with one or more additional vectors providing any components of the CRISPR system not included in the first vector.
- CRISPR system elements that are combined in a single vector may be arranged in any suitable orientation, such as one element located 5 ' with, respect to ("upstream" of) or 3' with respect to ("downstream" of) a second element.
- the coding sequence of one element may be located on the same or opposite strand of the coding sequence of a second element, and oriented in the same or opposite direction.
- a single promoter drives expression of a transcript encoding a CRISPR enzyme and one or more of the guide sequence, tracr mate sequence (optionally operably linked to the guide sequence), and a tracr sequence embedded within one or more intron sequences (e.g. each in a different intron, two or more in at least one intron, or all in a single intron).
- the CRISPR enzyme, guide sequence, tracr mate sequence, and tracr sequence are operably linked to and expressed from the same promoter.
- a vector comprises one or more insertion sites, such as a restriction endonuclease recognition sequence (also referred to as a "cloning site").
- one or more insertion sites e.g. about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more insertion sites
- a vector comprises an insertion site upstream of a tracr mate sequence, and optionally downstream of a regulatory element operably linked to the tracr mate sequence, such that .following insertion of a guide sequence into the insertion site and upon expression the guide sequence directs sequence-specific binding of a CRISPR.
- a vector comprises two or more insertion sites, each insertion site being located between two tracr mate sequences so as to allow insertion of a guide sequence at each site.
- the two or more guide sequences may comprise two or more copies of a single guide sequence, two or more different guide sequences, or combinations of these.
- a single expression construct may be used to target CRISPR activity to multiple different, corresponding target sequences within a cell.
- a single vector may comprise about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or more guide sequences. In some embodiments, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more such guide-sequence-containing vectors may be provided, and optionally delivered to a ceil.
- a vector comprises a regulatory element operabiy linked to an enzyme-coding sequence encoding a CRISPR enzyme, such as a Cas protein.
- Cas proteins include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas6, Cas7, Cas8, Cas9 (also known as Csnl and Csxl2), CaslO, Csyl, Csy2, Csy3, Csel, Cse2, Cscl, Csc2, Csa5, Csn2, Csm2, Csm3, Csm4, Csm5, Csm6, Cmrl, Cmr3, Cmr4, Cmr5, Cmr6, Csbl, Csb2, Csb3, Csxl7, Csxl4, CsxlO, Csxl 6, CsaX, Csx3, Csxl, Csxl 5, Csfl , Csf2, CsxlO, Csxl 6, Cs
- the CRISPR enzyme directs cleavage of one or both strands at the location of a target sequence, such as within the target sequence and/or within the complement of the target sequence. In some embodiments, the CRISPR enzyme directs cleavage of one or both strands within about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
- a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence.
- an aspartate-to-alanine substitution (D10A) in the RuvC I catalytic domain of Cas9 from S. pyogenes converts Cas9 from a nuclease that cleaves both strands to a nickase (cleaves a single strand).
- mutations that render Cas9 a nickase include, without limitation, H840A, N854A, and N863A,
- two or more catalytic domains of Cas9 may be mutated to produce a mutated Cas9 substantially lacking all DNA cleavage activity
- a D10A mutation is combined with one or more of H840A, N854A, or N863A. mutations to produce a Cas9 enzyme substantially lacking all DNA cleavage activity.
- a CRISPR enzyme is considered to substantially lack ail DNA cleavage activity when the DNA cleavage activity of the mutated enzyme is less than about 25%, 10%, 5%, 1%, 0.1%, 0.01%, or lower with respect to its non-mutated form.
- D10A aspartate -to-alanine substitution
- SpCas9n nickase
- the same locus was selected to test CRIS R-mediated HR by co- transfecting HEK 293FT cells with the chimeric RNA targeting EMXl, hSpCas9 or hSpCas9n, as well as a HR template to introduce a pair of restriction sites (Hindlll and Nhel) near the protospacer.
- a Cas enzyme may be identified Cas9 as this can refer to the general class of enzymes that share homology to the biggest nuclease with multiple nuclease domains from the type II CRISPR system. Most preferably, the Cas9 enzyme is from, or is derived from, spCas9 or saCas9. By derived, Applicants mean that the derived enzyme is largely based, in the sense of having a high degree of sequence homology with, a wild type enzyme, but that it has been mutated (modified) in some way as described herein.
- Cas and CRISPR enzyme are generally used herein interchangeably, unless otherwise apparent.
- residue numberings used herein refer to the Cas9 enzyme from the type I I CRISPR locus in Streptococcus pyogenes .
- this invention includes many more Cas9s from other species of microbes, such as SpCas9, SaCa9, Stl Cas9 and so forth.
- an enzyme coding sequence encoding a CRISPR enzyme is codon optimized for expression in particular ceils, such as eukaryotic cells.
- the eukaryotic cells may be those of or derived from a particular organism, such as a mammal, including but not limited to human, mouse, rat, rabbit, dog, or non-human mammal or primate.
- processes for modifying the germ line genetic identity of human beings and/or processes for modifying the genetic identity of animals which are likely to cause them suffering without any substantial medical benefit to man or animal, and also animals resulting from such processes may be excluded.
- codon optimization refers to a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1 , 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
- codon bias differs in codon usage between organisms
- mRNA messenger RNA
- tRNA transfer RNA
- Codon usage tables are readily available, for example, at the "Codon Usage Database” available at www.kazusa.orjp/codon/ (visited Jul. 9, 2002), and these tables can be adapted in a number of ways. See Nakamura, Y., et al. "Codon usage tabulated from the international DNA sequence databases: status for the year 2000"Nucl. Acids Res. 28:292 (2000).
- codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; jacobus, RA), are also available.
- Gene Forge Aptagen; jacobus, RA
- one or more codons e.g. 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons
- one or more codons in a sequence encoding a CRISPR enzyme correspond to the most frequently used codon for a particular amino acid.
- a vector encodes a CRISPR. enzyme comprising one or more nuclear localization sequences (NLSs), such as about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs.
- the CRISPR. enzyme comprises about or more than about 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about I, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-termiiius, or a combination of these (e.g. one or more NLS at the amino-terminus and one or more NLS at the carboxy terminus).
- the CRISPR enzyme comprises at most 6 NLSs.
- an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus.
- Non- limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence P&KKRKV; the NLS from nucleoplasm ⁇ ! (e.g. the nucleoplasm ⁇ ! bipartite NLS with the sequence RP A A T K AG Q A KKK ) ; the c-myc NLS having the amino acid sequence PAAKRVKLD or RQRRNELKRSP; the liRNPAl M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFA PRNQGGY; the sequence
- the one or more NLSs are of sufficient strength to drive accumulation of the CRISPR enzyme in a detectable amount in the nucleus of a eukaryotic cell.
- strength of nuclear localization activity may derive from the number of NLSs in the CRISPR enzyme, the particular NLS(s) used, or a combination of these factors.
- Detection of accumulation in the nucleus may be performed by any suitable technique.
- a detectable marker may be fused to the CRISPR enzyme, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g. a stain specific for the nucleus such as DAP I).
- Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of CRISPR complex formation (e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity), as compared to a control no exposed to the CRISPR enzyme or complex, or exposed to a CRISPR enzyme lacking the one or more NLSs.
- an assay for the effect of CRISPR complex formation e.g. assay for DNA cleavage or mutation at the target sequence, or assay for altered gene expression activity affected by CRISPR complex formation and/or CRISPR enzyme activity
- a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence.
- the degree of complementarity between a guide sequence and its corresponding target sequence, when optimally aligned using a suitable alignment algorithm is about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97,5%, 99%, or more.
- Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting example of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows- Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, CA), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).
- any suitable algorithm for aligning sequences include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows- Wheeler Transform (e.g. the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, CA), SOAP
- a guide sequence is about or more than about 5, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length. In some embodiments, a guide sequence is less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length. The ability of a guide sequence to direct sequence-specific binding of a CRISPR complex to a target sequence may be assessed by any suitable assay.
- the components of a CRISPR system sufficient to form a CRISPR complex may be provided to a host cell having the corresponding target sequence, such as by transfection w r ith vectors encoding the components of the CRISPR sequence, followed by an assessment of preferential cleavage within the target sequence, such as by Surveyor assay as described herein.
- cleavage of a target polynucleotide sequence may be evaluated in a test tube by providing the target sequence, components of a CRISPR complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions.
- Other assays are possible, and will occur to those skilled in the art.
- a guide sequence may be selected to target any target sequence.
- the target sequence is a sequence within a genome of a cell.
- Exemplary target sequences include those that are unique in the target genome.
- a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMM NNN NN N XGG where NNNNNNNNNNXGG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome.
- A. unique target sequence in a genome may include an S.
- NNNNNNNNNXGG N is A, G, T, or C; and X can be anything
- a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNNNXXAGAAW where NNNNNNNNNNXXAGAAW (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome.
- a unique target sequence in a genome may include an S, thermophilus CRISPRl Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNXXAGAAW " where ⁇ TON N NXXAGAAW (N is A, G, T, or C; X can be anything; and W is A or T) has a single occurrence in the genome.
- a unique target sequence in a genome may include a Cas9 target site of the form MMMMMMMMNNNNNNNNNNNNXGGXG where NNNNNNNNNNNNXGGXG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome.
- a unique target sequence in a genome may include an S, pyogenes Cas9 target site of the form MMMMMMMMMNNNNNNNNNNNNNXGGXG where NNNNNNNNNXGGXG (N is A, G, T, or C; and X can be anything) has a single occurrence in the genome.
- N is A, G, T, or C; and X can be anything
- M may be A, G, T, or C, and need not be considered in identifying a sequence as unique.
- a guide sequence is selected to reduce the degree secondary structure within the guide sequence. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of the nucleotides of the guide sequence participate in self-complementary base pairing when optimally folded.
- Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegier (Nucleic Acids Res. 9 (1981), 133-148).
- a tracr mate sequence includes any sequence that has sufficient complementarity with a tracr sequence to promote one or more of: (1) excision of a guide sequence flanked by tracr mate sequences in a cell containing the corresponding tracr sequence; and (2) formation of a CRISPR complex at a target sequence, wherein the CRISPR complex comprises the tracr mate sequence hybridized to the tracr sequence.
- degree of complementarity is with reference to the optimal alignment of the tracr mate sequence and tracr sequence, along the length of the shorter of the two sequences.
- Optimal alignment may be determined by any suitable alignment algorithm, and may further account for secondary structures, such as self-complementarity within either the tracr sequence or tracr mate sequence, in some embodiments, the degree of complementarity between the tracr sequence and tracr mate sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, I I, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length.
- the tracr sequence and tracr mate sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.
- the transcript or transcribed polynucleotide sequence has at least two or more hairpins.
- the transcript has two, three, four or five hairpins.
- the transcript has at most five hairpins.
- the portion of the sequence 5' of the final "N" and upstream of the loop corresponds to the tracr mate sequence
- the portion of the sequence 3' of the loop corresponds to the tracr sequence
- Further non-limiting examples of single polynucleotides comprising a guide sequence, a tracr mate sequence, and a tracr sequence are as follows (listed 5' to 3'), where "N" represents a base of a guide sequence, the first block of lower case letters represent the tracr mate sequence, and the second block of lower case letters represent the tracr sequence, and the final poly-T sequence represents the transcription terminator: (1) ggcttcatgccgaaatcaacaccctgtcattttatggcagggtgttttcgttattaaTTTTTT; (2) ⁇ N ⁇ N ⁇ N ⁇ NNNNNNui;i!iguu;icica(SAAAigcaga uciac aauai a
- gaaaaagtggcaccgagtcggtgcTTTTTTTT (5) ttgaaaaagtgTTTTTTT; and (6)
- sequences (1) to (3) are used in combination with Cas9 from S. thermophilus CRISPR 1.
- sequences (4) to (6) are used in combination with Cas9 from S. pyogenes.
- the tracr sequence is a separate transcript from a transcript comprising the tracr mate sequence.
- a recombination template is also provided.
- a recombination template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide.
- a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a CRISPR enzyme as a part of a CRISPR complex.
- a template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length.
- the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence.
- a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1, 5, 10, 15, 20, or more nucleotides).
- the nearest nucleotide of the template polynucleotide is within about 1 , 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.
- the CR ISPR. enzyme is part of a fusion protein comprising one or more heterologous protein domains (e.g. about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more domams in addition to the CRISPR enzyme).
- a CRISPR enzyme fusion protein may comprise any additional protein sequence, and optionally a linker sequence between any two domains.
- Examples of protein domams that may be fused to a CRISPR enzyme include, without limitation, epitope tags, reporter gene sequences, and protein domains having one or more of the following activities: methylase activity, demethvlase activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, RNA cleavage activity and nucleic acid binding activity.
- epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags.
- reporter genes include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, lueiferase, green fluorescent protein (GFP), i l ed. DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and autofluorescent proteins including blue fluorescent protein (BFP).
- GST glutathione-S-transferase
- HRP horseradish peroxidase
- CAT chloramphenicol acetyltransferase
- beta-galactosidase beta-galactosidase
- beta-glucuronidase beta-glucuronidase
- lueiferase green fluorescent protein
- GFP green fluorescent protein
- YFP yellow fluorescent protein
- BFP autofluorescent proteins including blue fluorescent protein
- a CRISPR enzyme may be fused to a gene sequence encoding a protein or a fragment of a protein that bind DNA molecules or bind other cellular molecules, including but not limited to maltose binding protein (MBP), S-tag, Lex A DNA binding domain (DBD) fusions, GAL4 DNA binding domain fusions, and herpes simplex vims (HSV) BP 16 protein fusions. Additional domains that may form part of a fusion protein comprising a CRISPR enzyme are described in US201 1G059502, incorporated herein by reference. In some embodiments, a tagged CRISPR enzyme is used to identify the location of a target sequence.
- MBP maltose binding protein
- DBD Lex A DNA binding domain
- HSV herpes simplex vims
- a CRISPR enzyme may form a component of an inducible system.
- the inducible nature of the system would allow for spatiotemporal control of gene editing or gene expression using a form of energy.
- the form of energy may include but is not limited to electromagnetic radiation, sound energy, chemical energy and thermal energy.
- inducible system examples include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FK.BP, ABA, etc), or light inducible systems (Phytochrome, LGV domains, or cryptochrome).
- the CRISPR enzyme may be a part of a Light Inducible Transcriptional Effector (LITE) to direct changes in transcriptional activity in a sequence-specific manner.
- the components of a light may include a CRISPR. enzyme, a light-responsive cryptochrome heterodimer (e.g. from Arabidopsis thaliana), and a transcriptional activation/repression domain.
- the invention provides methods comprising delivering one or more polynucleotides, such as or one or more vectors as described herein, one or more transcripts thereof, and/or one or proteins transcribed therefrom, to a host cell.
- the invention further provides cells produced by such methods, and animals comprising or produced from such cells.
- a CRISP enzyme in combination with (and optionally compiexed with) a guide sequence is delivered to a cell.
- Non-viral vector delivery systems include DNA plasmids, RNA (e.g. a transcript of a vector described herein), naked nucleic acid, and nucleic acid compiexed with a delivery vehicle, such as a liposome.
- Viral vector delivery systems include DNA and RNA virases, which have either episomal or integrated genomes after delivery to the cell.
- Methods of non-viral delivery of nucleic acids include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucieic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA.
- Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., TransfectamTM and LipofectiiiTM).
- Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Feigner, WO 91/17424; WO 91/16024. Delivery can be to cells (e.g. in vitro or ex vivo administration) or target tissues (e.g. in vivo administration).
- lipidrmicleic acid complexes including targeted liposomes such as immimoiipid complexes
- Boese et al Cancer Gene Ther. 2:291 -297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al, Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501 ,728, 4,774,085, 4,837,028, and 4,946,787).
- RNA or DNA viral based systems for the delivery of nucleic acids take advantage of highly evolved processes for targeting a virus to specific cells in the body and trafficking the viral payload to the nucleus.
- Viral vectors can be administered directly to patients (in vivo) or they can be used to treat cells in vitro, and the modified cells may optionally be administered to patients (ex vivo).
- Conventional viral based systems could include retroviral, lenti virus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Integration in the host genome is possible with the retrovirus, lentivirus, and adeno-associated virus gene transfer methods, often resulting in long term expression of the inserted transgene. Additionally, high transduction efficiencies have been observed in many different ceil types and target tissues.
- Lentiviral vectors are retroviral vectors that are able to transduce or infect non-dividing cells and typically produce high viral titers. Selection of a retroviral gene transfer system would therefore depend on the target tissue. Retroviral vectors are comprised of cis-acting long terminal repeats with packaging capacity for up to 6-10 kb of foreign sequence. The minimum cis-acting LTRs are sufficient for replication and packaging of the vectors, which are then used to integrate the therapeutic gene into the target cell to provide permanent transgene expression.
- Widely used retroviral vectors include those based upon murine leukemia virus (MuLV), gibbon ape leukemia virus (GaLV), Simian Immuno deficiency virus (SIV), human immuno deficiency virus (HIV), and combinations thereof (see, e.g., Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J. Virol. 66: 1635-1640 (1992); Sommnerfelt et al, Virol. 176:58-59 (1990); Wilson et al, J. Virol. 63:2374-2378 (1989); Miller et al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).
- MiLV murine leukemia virus
- GaLV gibbon ape leukemia virus
- SIV Simian Immuno deficiency virus
- HAV human immuno deficiency virus
- Adenoviral based systems may be used.
- Adenoviral based vectors are capable of very high transduction efficiency in many cell types and do not require cell division. With such vectors, high titer and levels of expression have been obtained. This vector can be produced in large quantities in a relatively simple system.
- Adeno-associated virus (“AAV”) vectors may also be used to transduce cells with target nucleic acids, e.g., in the in vitro production of nucleic acids and peptides, and for in vivo and ex vivo gene therapy procedures (see, e.g., West et al., Virology 160:38-47 (1987); U.S. Pat. No.
- Packaging cells are typically used to form virus particles that are capable of infecting a host cell.
- ceils include 293 ceils, which package adenovirus, and ⁇
- Viral vectors used in gene therapy are usually generated by producer a cell line that packages a nucleic acid vector into a viral particle.
- the vectors typically contain the minimal viral sequences required for packaging and subsequent integration into a host, other viral sequences being replaced by an expression cassette for the polynucleotide(s) to be expressed.
- the missing viral functions are typically supplied in trans by the packaging cell line.
- AAV vectors used in gene therapy typically only possess ITR sequences from the AAV genome which are required for packaging and integration into the host genome.
- Viral DNA is packaged in a cell line, which contains a helper plasmid encoding the other AAV genes, namely rep and cap, but lacking ITR sequences.
- the cell line may also infected with adenovirus as a helper.
- the helper vims promotes replication of the AAV vector and expression of AAV genes from the helper plasmid.
- the heiper plasmid is not packaged in significant amounts due to a lack of ITR sequences. Contamination with adenovirus can be reduced by, e.g., heat treatment to which adenovirus is more sensitive than AAV.
- AAV is considered an ideal candidate for use as a transducing vector.
- Such AAV transducing vectors can comprise sufficient cis-acting functions to replicate in the presence of adenovirus or herpesvirus or poxvirus (e.g., vaccinia virus) heiper functions provided in trans.
- Recombinant AAV rAAV
- rAAV Recombinant AAV
- these vectors the AAV cap and/or rep genes are deleted from the viral genome and replaced with a DNA segment of choice.
- Current AAV vectors may accommodate up to 4300 bases of inserted DNA.
- rAAV there are a number of ways to produce rAAV, and the invention provides rAAV and methods for preparing rAAV.
- plasmid(s) containing or consisting essentially of the desired construct are transfected into AAV-infected cells.
- a second or additional helper plasmid is cotransfected into these cells to provide the AAV rep and/or cap genes which are obligatory for replication and packaging of the recombinant viral construct. Under these conditions, the rep and/or cap proteins of AAV act in trans to stimulate replication and packaging of the rAAV construct.
- Two to Three days after transfection rAAV is harvested. Traditionally rAAV is harvested from the cells along with adenovirus.
- rAAV is advantageously harvested not from the cells themselves, but from cell supernatant.
- rAAV can be prepared by a method that comprises or consists essentially of: infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, and helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) wherein the rAAV lacks functioning cap and/or rep (and the helper virus (e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus) provides the cap and/or rev function that the rAAV lacks); or infecting susceptible cells with a rAAV containing exogenous DNA including DNA for expression, wherein the recombinant lacks functioning cap and/or rep,
- helper virus e.g., adenovirus, herpesvirus, poxvirus such as vaccinia virus
- the rAAV can be from an AAV as herein described, and advantageously can be an rAAVl , rAAV2, AAV5 or rAAV having hybrid capsid which may comprise AAV1, AAV2, AAV5 or any combination thereof.
- the invention provides rAAV that contains or consists essentially of an exogenous nucleic acid molecule encoding a CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) system, e.g., a plurality of cassettes comprising or consisting a first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding a CRISPR-associated (Cas) protein (putative nuclease or helicase proteins), e.g., Cas9 and a terminator, and a two, or more, advantageously up to the packaging size limit of the vector, e.g., in total (including the first cassette) five, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gRNA) and a terminator (e.g., each cassette schematically represented as Promoter-gRNAl -terminator, Promoter-gRNA2 -terminator ...
- CRISPR Clust
- Promoter- gRNA(N)-terminator (where is a number that can be inserted that is at an upper limit of the packaging size limit of the vector), or two or more individual rAAVs, each containing one or more than one cassette of a CRISPR system, e.g., a first rAAV containing the first cassette comprising or consisting essentially of a promoter, a nucleic acid molecule encoding Cas, e.g., Cas9 and a terminator, and a second rAAV containing a plurality, four, cassettes comprising or consisting essentially of a promoter, nucleic acid molecule encoding guide RNA (gR A) and a terminator (e.g., each cassette schematically represented as Promoter-gRNAl terminator, Promoter ⁇ gRNA2 -terminator ...
- a terminator e.g., each cassette schematically represented as Promoter-gRNAl terminator, Promoter ⁇ gRNA2 -terminator ...
- Promoter-gRNA(N)-terminator (where N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector).
- N is a number that can be inserted that is at an upper limit of the packaging size limit of the vector.
- the promoter is in some embodiments advantageously human Synapsin I promoter (hSyn).
- a host cell is transiently or non-transiently transfected with one or more vectors described herein.
- a cell is transfected as it naturally occurs in a subject.
- a cell that is transfected is taken from a subject.
- the cell is derived from cells taken from a subject, such as a cell line. A wide variety of cell lines for tissue culture are known in the art.
- cell lines include, but are not limited to, C8161 , CCRF-CEM, MOLT, mIMCD-3, NHDF, HeLa-S3, Huhl, Huh4, Huh7, HUVEC, HASMC, HEKn, HEKa, MiaPaCell, Panel, PC-3, TFL CTLL-2, CIR, Rat6, CV1 , RPTE, A10, T24, J82, A375, ARH-77, Calul, SW480, SW620, SK.OV3, SK-UT, CaCo2, P388D1, SEM-K2, WEHI-231, HB56, ⁇ 55, Jurkat, J45.01 , LRMB, Bcl-1, BC-3, IC21, DLD2, Raw264.7, NRK, NR.K-52E, MRC5, MEF, Hep G2, HeLa B, HeLa T4, COS, COS-1 , COS-6, COS-M6A, BS-C-1 monkey kidney epitheli
- a cell transfected with one or more vectors described herein is used to establish a new cell line comprising one or more vector-derived sequences.
- a cell transiently transfected with the components of a CR1SPR system as described herein is used to establish a new cell line comprising cells containing the modification but lacking any other exogenous sequence.
- cells transiently or non-transiently transfected with one or more vectors described herein, or cell lines derived from such cells are used in assessing one or more test compounds.
- one or more vectors described herein are used to produce a non-human transgenic animal or transgenic plant.
- the transgenic animal is a mammal, such as a mouse, rat, or rabbit.
- Methods for producing transgenic plants and animals are known in the art, and generally begin with a method of cell transfection, such as described herein.
- the contents and disclosure of Morrell et al “Crop genomics: advances and applications” Nat Rev Genet. 2011 Dec 29;13(2):85-96 are also herein incorporated by reference in their entirety.
- the CRISPR/Cas9 system is used to engineer microalgae. That the CRISPR-Cas system is able to be employed in plant systems is also provided in the manuscript "Efficient Genome Editing in Plants using a CRJSPR/Cas System", by Feng et al.
- the invention provides for methods of modifying a target polynucleotide in a eukaryotic cell, which may be in vivo, ex vivo or in vitro.
- the method comprises sampling a cell or population of cells from a human or non- human animal or plant (including micro-algae), and modifying the cell or cells. Culturing may occur at any stage ex vivo.
- the cell or cells may even be re -introduced into the non-human animal or plant (including micro-algae).
- the cells are stem cells,
- the method comprises allowing a CRISPR complex to bind to the target polynucleotide to effect cleavage of said target polynucleotide thereby modifying the target polynucleotide, wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said target polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- the invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises allowing a CRISPR complex to bind to the polynucleotide such that said binding results in increased or decreased expression of said polynucleotide; wherein the CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within said polynucleotide, wherein said guide sequence is linked to a tracr mate sequence which in turn hybridizes to a tracr sequence.
- Similar considerations and conditions apply as above for methods of modifying a target polynucleotide. In fact, these sampling, culturing and re -introduction options apply across the aspects of the present invention.
- the CRISPR complex may comprise a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence, wherein said guide sequence may be linked to a tracr mate sequence which in turn may hybridize to a tracr sequence. Similar considerations and conditions apply as above for methods of modifying a target polynucleotide.
- kits containing any one or more of the elements disclosed in the above methods and compositions. Elements may be provided individually or in combinations, and may be provided in any suitable container, such as a vial, a bottle, or a tube. In some embodiments, the kit includes instructions in one or more languages, for example in more than one language.
- a kit comprises one or more reagents for use in a process utilizing one or more of the elements described herein.
- Reagents may be provided in any suitable container.
- a kit may provide one or more reaction or storage buffers.
- Reagents may be provided in a form that is usable in a particular assay, or in a form that requires addition of one or more other components before use (e.g. in concentrate or lyophilized form).
- a buffer can be any buffer, , including but not limited to a sodium carbonate buffer, a sodium bicarbonate buffer, a borate buffer, a Tris buffer, a MOPS buffer, a tIEPES buffer, and combinations thereof.
- the buffer is alkaline.
- the buffer has a pH from about 7 to about 10.
- the kit comprises one or more oligonucleotides corresponding to a guide sequence for insertion into a vector so as to operably link the guide sequence and a regulatory element.
- the kit comprises a homologous recombination template polynucleotide.
- the invention provides methods for using one or more elements of a CRISPR system.
- the CRISPR complex of the invention provides an effective means for modifying a target polynucleotide.
- the CRISPR complex of the invention has a wide variety of utility including modifying (e.g., deleting, inserting, translocating, inactivating, activating) a target polynucleotide in a multiplicity of cell types.
- the CRISPR complex of the invention has a broad spectrum of applications in, e.g., gene therapy, drug screening, disease diagnosis, and prognosis.
- An exemplary CRISPR complex comprises a CRISPR enzyme complexed with a guide sequence hybridized to a target sequence within the target polynucleotide.
- the guide sequence is linked to a tracr mate sequence, which in turn hybridizes to a tracr sequence.
- this invention provides a method of cleaving a target polynucleotide.
- the method comprises modifying a target polynucleotide using a CRISPR complex that binds to the target polynucleotide and effect cleavage of said target polynucleotide.
- the CRISP R complex of the invention when introduced into a cell, creates a break (e.g., a single or a double strand break) in the genome sequence.
- the method can be used to cleave a disease gene in a cell.
- the break created by the CRISPR complex can be repaired by a repair processes such as the error prone non-homologous end joining (NHEJ) pathway or the high fidelity homology - directed repair (HDR) ( Figure 11).
- NHEJ error prone non-homologous end joining
- HDR high fidelity homology - directed repair
- an exogenous polynucleotide template can be introduced into the genome sequence.
- the HDR process is used modify genome sequence.
- an exogenous polynucleotide template comprising a sequence to be integrated flanked by an upstream sequence and a downstream sequence is introduced into a cell.
- the upstream and downstream sequences share sequence similarity with either side of the site of integration in the chromosome.
- a donor polynucleotide can be DNA, e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer.
- DNA e.g., a DNA plasmid, a bacterial artificial chromosome (BAC), a yeast artificial chromosome (YAC), a viral vector, a linear piece of DNA, a PCR fragment, a naked nucleic acid, or a nucleic acid complexed with a delivery vehicle such as a liposome or poloxamer.
- the exogenous polynucleotide template comprises a sequence to be integrated (e.g., a mutated gene).
- the sequence for integration may be a sequence endogenous or exogenous to the cell.
- Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding RNA (e.g., a micro NA).
- the sequence for integration may be operably linked to an appropriate control sequence or sequences.
- the sequence to be integrated may provide a regulatory function.
- the upstream and downstream sequences in the exogenous polynucleotide template are selected to promote recombination between the chromosomal sequence of interest and the donor polynucleotide.
- the upstream sequence is a nucleic acid sequence that shares sequence similarity with the genome sequence upstream of the targeted site for integration.
- the downstream sequence is a nucleic acid sequence that shares sequence similarity with the chromosomal sequence downstream of the targeted site of integration.
- the upstream and downstream sequences in the exogenous polynucleotide template can have 75%, 80%, 85%, 90%, 95%, or 100% sequence identity with the targeted genome sequence.
- the upstream and downstream sequences in the exogenous polynucleotide template have about 95%, 96%, 97%, 98%, 99%), or 100% sequence identity with the targeted genome sequence.
- the upstream and downstream sequences in the exogenous polynucleotide template have about 99%> or 100% sequence identity with the targeted genome sequence.
- An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp.
- the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000 bp.
- the exogenous polynucleotide template may further comprise a marker.
- a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers.
- the exogenous polynucleotide template of the invention can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et ai, 1996).
- a double stranded break is introduced into the genome sequence by the CRISPR complex, the break is repaired via homologous recombination by an exogenous polynucleotide template such that the template is integrated into the genome.
- the presence of a double-stranded break facilitates integration of the templ ate.
- this invention provides a method of modifying expression of a polynucleotide in a eukaryotic cell.
- the method comprises increasing or decreasing expression of a target polynucleotide by using a CRISPR complex that binds to the polynucleotide.
- a target polynucleotide can be inactivated to effect the modification of the expression in a cell. For example, upon the binding of a CRISPR complex to a target sequence in a cell, the target polynucleotide is inactivated such that the sequence is not transcribed, the coded protein is not produced, or the sequence does not function as the wild-type sequence does. For example, a protein or microRNA coding sequence may be inactivated such that the protein is not produced.
- control sequence refers to any nucleic acid sequence that effects the transcription, translation, or accessibility of a nucleic acid sequence.
- control sequence include, a promoter, a transcription terminator, and an enhancer are control sequences,
- the inactivated target sequence may include a deletion mutation (i.e., deletion of one or more nucleotides), an insertion mutation (i.e., insertion of one or more nucleotides), or a nonsense mutation (i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced).
- a deletion mutation i.e., deletion of one or more nucleotides
- an insertion mutation i.e., insertion of one or more nucleotides
- a nonsense mutation i.e., substitution of a single nucleotide for another nucleotide such that a stop codon is introduced.
- a method of the invention may be used to create a plant, an animal or cell that may be used as a disease model.
- disease refers to a disease, disorder, or indication in a subject.
- a method of the invention may be used to create an animal or cell that comprises a modification in one or more nucleic acid sequences associated with a disease, or a plant, animal or cell in which the expression of one or more nucleic acid sequences associated with a disease are altered.
- Such a nucleic acid sequence may encode a disease associated protein sequence or may be a disease associated control sequence.
- a plant, subject, patient, organism or cell can be a non-human subject, patient, organism or cell.
- the invention provides a plant, animal or ceil, produced by the present methods, or a progeny thereof.
- the progeny may be a clone of the produced plant or animal, or may result from sexual reproduction by crossing with other individuals of the same species to introgress further desirable traits into their offspring.
- the cell may be in vivo or ex vivo in the cases of multicellular organisms, particularly animals or plants.
- a cell line may be established if appropriate culturing conditions are met and preferably if the cell is suitably adapted for this purpose (for instance a stem cell).
- Bacterial cell lines produced by the invention are also envisaged. Hence, cell lines are also envisaged.
- the disease model can be used to study the effects of mutations on the animal or cell and development and/or progression of the disease using measures commonly used in the study of the disease.
- a disease model is useful for studying the effect of a pharmaceu tically acti ve compound on the disease.
- the disease model can be used to assess the efficacy of a potential gene therapy strategy. That is, a disease-associated gene or polynucleotide can be modified such that the disease development and/or progression is inhibited or reduced, in particular, the method comprises modifying a disease-associated gene or polynucleotide such that an altered protein is produced and, as a result, the animal or cell has an altered response. Accordingly, in some methods, a genetically modified animal may be compared with an animal predisposed to development of the disease such that the effect of the gene therapy event may be assessed.
- this invention provides a method of developing a biologically active agent that modulates a cell signaling event associated with a disease gene.
- the method comprises contacting a test compound with a cell comprising one or more vectors that drive expression of one or more of a CRISPR enzyme, a guide sequence linked to a tracr mate sequence, and a tracr sequence; and detecting a change in a readout that is indicative of a reduction or an augmentation of a cell signaling event associated with, e.g., a mutation in a disease gene contained in the cell.
- a cell model or animal model can be constructed in combination with the method of the invention for screening a cellular function change.
- a model may be used to study the effects of a genome sequence modified by the CRISPR complex of the invention on a cellular function of interest.
- a cellular function model may be used to stud)' the effect of a modified genome sequence on intracellular signaling or extracellular signaling.
- a cellular function model may be used to study the effects of a modified genome sequence on sensory perception.
- one or more genome sequences associated with a signaling biochemical pathway in the model are modified.
- An altered expression of one or more genome sequences associated with a signaling biochemical pathway can be deteimined by assaying for a difference in the mRNA levels of the corresponding genes between the test model cell and a control cell, when they are contacted with a candidate agent.
- the differential expression of the sequences associated with a signaling biochemical pathway is determined by detecting a difference in the level of the encoded polypeptide or gene product.
- nucleic acid contained in a sample is first extracted according to standard methods in the art.
- mRNA can be isolated using various lytic enzymes or chemical solutions according to the procedures set forth in Sambrook et al. (1989), or extracted by nucleic-acid-binding resins following the accompanying instructions provided by the manufacturers.
- the mRNA contained in the extracted nucleic acid sample is then detected by amplification procedures or conventional hybridization assays (e.g. Northern blot analysis) according to methods widely known in the art or based on the methods exemplified herein.
- amplification means any method employing a primer and a polymerase capable of replicating a target sequence with reasonable fidelity.
- Amplification may be carried out by natural or recombinant DNA polymerases such as TaqGoidTM, T7 DNA polymerase, Klenow fragment of E.coli DNA polymerase, and reverse transcriptase.
- a preferred amplification method is PGR.
- the isolated RNA can be subjected to a reverse transcription assay that is coupled with a quantitative polymerase chain reaction (RT-PCR) in order to quantify the expression level of a sequence associated with a signaling biochemical pathway.
- RT-PCR quantitative polymerase chain reaction
- Detection of the gene expression level can be conducted in real time in an amplification assay.
- the amplified products can be directly visualized with fluorescent DMA-binding agents including but not limited to DNA intercalators and DNA groove binders. Because the amount of the intercalators incorporated into the double-stranded DNA molecules is typically proportional to the amount of the amplified DNA products, one can conveniently determine the amount of the amplified products by quantifying the fluorescence of the intercalated dye using conventional optical systems in the art.
- DNA -binding dye suitable for this application include SYBR green, SYBR blue, DAPI, propidium iodine, Hoeste, SYBR gold, etbidium bromide, acridines, proflavine, acridine orange, acriflavine, fluorcoumanin, ellipticine, daunomycin, chloroquine, distamycin D, chromomycin, homidium, mithramycin, ruthenium polypyridyls, anthramycin, and the like.
- probe-based quantitative amplification relies on the sequence-specific detection of a desired amplified product. It utilizes fluorescent, target-specific probes (e.g., TaqMan® probes) resulting in increased specificity and sensitivity. Methods for performing probe-based quantitative amplification are well established in the art and are taught in U.S. Patent No. 5,210,015.
- conventional hybridization assays using hybridization probes that share sequence homology with, sequences associated with a signaling biochemical pathway can be performed.
- probes are allowed to form stable complexes with the sequences associated with a signaling biochemical pathway contained within the biological sample derived from the test subject in a hybridization reaction.
- the target polynucleotides provided in the sample are chosen to be complementary to sequences of the antisense nucleic acids.
- the target polynucleotide probe is a sense nucleic acid
- the target polynucleotide is selected to be complementary to sequences of the sense nucleic acid.
- Hybridization can be performed under conditions of various stringency. Suitable hybridization conditions for the practice of the present invention are such that the recognition interaction between the probe and sequences associated with a signaling biochemical pathway is both sufficiently specific and sufficiently stable. Conditions that increase the stringency of a hybridization reaction are widely known and published in the art. See, for example, (Sambrook, et al., (1989); Nonradioactive In Situ Hybridization Application Manual, Boeliringer Mannheim, second edition).
- the hybridization assay can be formed using probes immobilized on any solid support, including but are not limited to nitrocellulose, glass, silicon, and a variety of gene arrays. A preferred hybridization assay is conducted on high-density gene chips as described in U.S. Patent No. 5,445,934.
- the nucleotide probes are conjugated to a detectable label.
- Detectable labels suitable for use in the present invention include any composition detectable by photochemical, biochemical, spectroscopic, immunochemical, electrical, optical or chemical means, A wide variety of appropriate detectable labels are known in the art, which include fluorescent or chemiluminescent labels, radioactive isotope labels, enzymatic or other ligands. In preferred embodiments, one will likely desire to employ a fluorescent label or an enzyme tag, such as digoxigenin, B-galactosidase, urease, alkaline phosphatase or peroxidase, avidin/biotin complex.
- the detection methods used to detect or quantify the hybridization intensity will typically depend upon the label selected above.
- radioiabels may be detected using photographic film or a phosphoimager.
- Fluorescent markers may be detected and quantified using a photodetector to detect emitted light.
- Enzymatic labels are typically detected by providing the enzyme with a substrate and measuring the reaction product produced by the action of the enzyme on the substrate; and finally colorimetric labels are detected by simply visualizing the colored label.
- An agent-induced change in expression of sequences associated with a signaling biochemical pathway can also be determined by examining the corresponding gene products. Determining the protein level typically involves a) contacting the protein contained in a biological sample with an agent that specifically bind to a protein associated with a signaling biochemical pathway; and (b) identifying any agentprotein complex so formed.
- the agent that specifically binds a protein associated with a signaling biochemical pathway is an antibody, preferably a monoclonal antibody.
- the reaction is performed by contacting the agent with a sample of the proteins associated with a signaling biochemical pathway derived from the test samples under conditions that will allow a complex to form between the agent and the proteins associated with a signaling biochemical pathway.
- the formation of the complex can be detected directly or indirectly according to standard procedures in the art.
- the agents are supplied with a detectable label and unreacted agents may be removed from the complex; the amount of remaining label thereby indicating the amount of complex formed.
- an indirect detection procedure may use an agent that contains a label introduced either chemically or enzymatically. A desirable label generally does not interfere with binding or the stability of the resulting agentpolypeptide complex.
- the label is typically designed to be accessible to an antibody for an effective binding and hence generating a detectable signal.
- a wide variety of labels suitable for detecting protein levels are known in the art. Non-limiting examples include radioisotopes, enzymes, colloidal metals, fluorescent compounds, bioluminescent compounds, and chemi luminescent compounds.
- agentpolypeptide complexes formed during the binding reaction can be quantified by standard quantitative assays. As illustrated above, the formation of agentpolypeptide complex can be measured directly by the amount of label remained at the site of binding.
- the protein associated with a signaling biochemical pathway is tested for its ability to compete with a labeled analog for binding sites on the specific agent, in this competitive assay, the amount of label captured is inversely proportional to the amount of protein sequences associated with a signaling biochemical pathway present in a test sample.
- a number of techniques for protein analysis based on the general principles outlined above are available in the art. They include but are not limited to radioimmunoassays, ELISA (enzyme linked immuiioradiometric assays), "sandwich” immunoassays, immimoradiometric assays, in situ immunoassays (using e.g., colloidal gold, enzyme or radioisotope labels), western blot analysis, immunoprecipitatioii assays, immunofiuorescent assays, and SDS-PAGE.
- radioimmunoassays ELISA (enzyme linked immuiioradiometric assays), "sandwich” immunoassays, immimoradiometric assays, in situ immunoassays (using e.g., colloidal gold, enzyme or radioisotope labels), western blot analysis, immunoprecipitatioii assays, immunofiuorescent assays
- Antibodies that specifically recognize or bind to proteins associated with a signaling biochemical pathway are preferable for conducting the aforementioned protein analyses.
- antibodies that recognize a specific type of post-translational modifications e.g., signaling biochemical pathway inducible modifications
- Post-translational modifications include but are not limited to glycosyiatioii, lipidation, acetylation, and phosphorylation.
- These antibodies may be purchased from commercial vendors.
- anti-phosphotyrosine antibodies that specifically recognize tyrosine-phosphorylated proteins are available from a number of vendors including Invitrogen and Perkin Elmer.
- Anti- phosphotyrosine antibodies are particularly useful in detecting proteins that are differentially phosphorylated on their tyrosine residues in response to an ER stress.
- proteins include but are not limited to eukaryotic translation initiation factor 2 alpha (eIF-2a).
- eIF-2a eukaryotic translation initiation factor 2 alpha
- these antibodies can be generated using conventional polyclonal or monoclonal antibody technologies by immunizing a host animal or an antibody-producing cell with a target protein that exhibits the desired post-translational modification.
- An altered expression of a gene associated with a signaling biochemical pathway can also be determined by examining a change in activity of the gene product relative to a control ceil.
- the assay for an agent-induced change in the activity of a protein associated with a signaling biochemical pathway will dependent on the biological activity and/or the signal transduction pathway that is under investigation.
- a change in its ability to phosphorylate the downstream substrate(s) can be determined by a variety of assays known in the art. Representative assays include but are not limited to immunob lotting and immunoprecipitation with antibodies such as anti-phosphotyrosine antibodies that recognize phosphorylated proteins.
- kinase activity can be detected by high throughput chemiluminescent assays such as AlphaScreenTM (available from Perkin Elmer) and eTagTM assay (Chan-Hui, et al. (2003) Clinical Immunology 111 : 162-174).
- high throughput chemiluminescent assays such as AlphaScreenTM (available from Perkin Elmer) and eTagTM assay (Chan-Hui, et al. (2003) Clinical Immunology 111 : 162-174).
- pH sensitive molecules such as fluorescent pH dyes can be used as the reporter molecules.
- the protein associated with a signaling biochemical pathway is an ion channel
- fluctuations in membrane potential and/or intracellular ion concentration can be monitored.
- Representative instruments include FLIPRTM (Molecular Devices, Inc.) and VIPR (Aurora Biosciences). These instruments are capable of detecting reactions in over 1000 sample w r elis of a micro late simultaneously, and providing real-time measurement and functional data within a second or even a mimsecond.
- a suitable vector can be introduced to a cell or an embryo via one or more methods known in the art, including without limitation, microinjection, electroporation, sonoporation, biolistics, calcium phosphate-mediated transfection, cationic transfection, liposome transfection, dendrimer transfection, heat shock transfection, nucleofection transfection, magnetofection, lipofection, impalefection, optical transfection, proprietary agent-enhanced uptake of nucleic acids, and delivery via liposomes, immunoliposomes, virosomes, or artificial virions.
- the vector is introduced into an embryo by microinjection.
- the vector or vectors may be micro injected into the nucleus or the cytoplasm of the embryo.
- the vector or vectors may be introduced into a cell by nucleofection.
- the target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell.
- the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell.
- the target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
- target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
- target polynucleotides include a disease associated gene or polynucleotide.
- a "disease-associated" gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control.
- A. disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage disequilibrium with a gene(s) that is responsible for the etiology of a disease.
- the transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
- the target polynucleotide of a CRISPR complex can be any polynucleotide endogenous or exogenous to the eukaryotic cell.
- the target polynucleotide can be a polynucleotide residing in the nucleus of the eukaryotic cell.
- the target polynucleotide can be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulator ⁇ ' polynucleotide or a junk DNA).
- the target polynucleotide of a CRISPR complex may include a number of disease- associated genes and polynucleotides as well as signaling biochemical pathway-associated genes and polynucleotides as listed in US provisional patent applications 61/736,527 and 61/748,42.7 having Broad reference BI-201 1/008/WSGR Docket No. 44063-701.101 and BI- 2011/008/WSGR Docket No. 44063-701.102 respectively, both entitled SYSTEMS METHODS AND COMPOSITIONS FOR SEQUENCE MANIPULATION filed on December 12, 2012 and January 2, 2013, respectively, the contents of all of which are herein incorporated by reference in their entirety.
- target polynucleotides include a sequence associated with a signaling biochemical pathway, e.g., a signaling biochemical pathway-associated gene or polynucleotide.
- target polynucleotides include a disease associated gene or polynucleotide.
- a "disease-associated" gene or polynucleotide refers to any gene or polynucleotide which is yielding transcription or translation products at an abnormal level or in an abnormal form in cells derived from a disease-affected tissues compared with tissues or cells of a non disease control.
- a disease-associated gene also refers to a gene possessing mutation(s) or genetic variation that is directly responsible or is in linkage d sequilibrium with a gene(s) that is responsible for the etiology of a disease.
- the transcribed or translated products may be known or unknown, and may be at a normal or abnormal level.
- Parkinson's Disease x-S nuclein DJ-1 ; LRRK2; Parkin; PIN 1
- Blood and Anemia CDANl, CDAl, RPS19, DBA, PKLR, PKl, NT5C3, UMPHl, coagulation diseases PS 1, RHAG, RH50A, NRAMP2, SPTB, ALAS2, ANH 1 , ASB, and disorders ABCB7, ABC7, ASAT); Bare lymphocyte syndrome (TAPBP, TPSN,
- FANCB FANCC
- FACC BRCA2
- FANCD1 FANCD2
- FANCD FACD
- FAD FANCE
- FACE FANCF
- XRCC9 FANCG
- BRIP1 BACHl
- FA CJ FA CJ
- PHF9 FA CL
- FANCM KIAA 1596
- BCL7A BCL7
- Leukemia TALI, and oncology TCL5, SCL, TAJ .2.
- FLT3 NBS1 , NBS, ZNFNIAI, IK I .
- LYF 1 diseases and disorders HOXD4, HQX4B, BCR, CML, PHL, ALL, ARNT, K RAS2.
- RASK2 B-ceil non-Hodgkin lymphoma
- GMPS GMPS, AF10, ARHGEF12, LARG, KIAA0382, CALM, CLTH, CEBPA, CEBP, CH 1C2, BTL, FLT3, KIT, PBT, ! PP.
- Inflammation and AIDS KJR3DL1, N AT3, NKBl, AMBl 1 , KIR3DS1 , IFNG, CXCL12, immune related SDFI; Autoimmune lymphoproliferative syndrome (TNFRSF6, APTl, diseases and disorders FAS, CD95, ALPS 1 A); Combined immunodeficiency, (IL2RG,
- SCIDXl SCIDX, IMD4
- HIV-l CCL5, SCYA5, D17S136E, TCP228)
- HIV susceptibility or infection ILIO, CSIF, CMKBR2, CCR2,
- IL-13 IL-17
- IL-17a CLA8
- IL-17b CTL8
- IL-17c IL-17A IL-17f
- II-23 Cx3crl
- ptpn22 TNFa
- NOD2/ CARD 15 for IBD, IL-6, IL-12 ( 11 - 12a. IL-12b), CTLA4, Cx3cil
- Severe combined immunodeficiencies (SC!Ds)(JA.K3, JAKL, DCLRETC, ARTEMIS, SCIDA, RAG1, RAG2, ADA, PTPRC, CD45, LCA, IL7R, CD3D, T3D, IL2RG, SCIDXl , SCIDX, IMD4).
- CF CF, MRP7; Glycogen storage diseases (SLC2A2, GLUT2, G6PC, G6PT, G6PT1 , GAA, LAMP2, LAMPB, AGL, GDE, GBE1 , GYS2, PYGL, PFKM); Hepatic adenoma, 142330 (TCFI, HNF1A, MODY3), Hepatic failure, early onset, and neurologic disorder (SCOD1 , SCOl), Hepatic lipase deficiency (LIPC), Hepatoblastoma, cancer and carcinomas (CTNNB 1 , PDGFRL, PDGRL, PRLTS, AXIN l, AXIN, CTNNB1 , TPS 3, P53, LFS1, IGF2R, MPRI, MET, CASP8, MCH5; Medullar cystic kidney disease (UMOD, HNFJ, FJHN, MCKD2,
- ADMCKD2 Phenylketonuria
- PH Phenylketonuria
- PKU1 Phenylketonuria
- DHPR DHPR
- PTS Polycystic kidney and hepatic disease
- FCYT PKHD 1 , ARPKD, PKD1, P ().?.. PKD4, P DTS, PRKCSH, G19P1, PCLD, SEC63).
- DMD Muscular / Skeletal Becker muscular dystrophy
- DMD Duchemie Muscular diseases and disorders Dystrophy
- LMNA Emery-Dreifuss muscular dystrophy
- LRP5 BMND1, LRP7, LR3, OPPG, VBCH2, CLCN7, CLC7, OPTA2, OSTM1, GL, TCIRG1, TI
- Neurological and ALS SOD1, ALS2, STEX, FUS, TARDBP, VEGF (VEGF-a, VEGF-b, neuronal diseases and VEGF-c); Alzheimer disease (APP, AAA, CVAP, AD1, APOE, AD2, disorders PSEN2, AD4, STM2, APBB2, FE65L1, NOS3, PLAU, URK, ACE,
- Occular diseases and Age-related macular degeneration Abcr, Ccl2, Cc2, cp (ceruiopiasmin), disorders Timp3, caihepsiiiD, Vldlr, Ccr2); Cataract (CRYAA, CRYAl, CRYBB2,
- Corneal clouding and dystrophy (APOA1, TGFBI, CSD2, CDGG1 , CSD, BIGH3, CDG2, TACSTD2, TROP2, MlSl, VSXL RINX, PPCD, PPD, KTCN, COL8A2, FECD, PPCD2, PIP5K3, CFD); Cornea plana congenital (KERA, CNA2); Glaucoma (MYOC, TIGR, GLCl A, JO AG, GPOA, OPTN, GLC1E, FIP2, HYPL, NRP, CYP1BL GLC3A, OPAL NTG, NPG, CYP1B1, GLC3A); Leber congenital amaurosis (CRB1, RP12, CRX, CORD2, CRD, RPGRIPl, LCA6, CORD9, RPE65, RP20, AIPLl, LCA4, GUCY2D, GUC2D, LCA1, CORD6, RDH12, LCA3)
- MAPK9 ABCB1; TRAF2; MAPKl 4; TNF; RAFl; IKBKG;
- PRKD1 PRKD1
- MAPKl 0 RELA
- PRKCI PRK9
- ABCB1 PRKD1
- MAPKl 0 RELA
- PRKCI MAPK9
- ABCB1 ABCB1
- PIK3CA PRKCI; PTK2; FOS; PIK3CB; PIK3C3; MAPK8;
- IGF HI insulin HI
- IRS1 MAPK3
- IGFBP7 IGFBP7
- KRAS PIK3C2A
- PDPK1 MAP2KI; IGFBP2; SFN; JUN; CYR6I; AKT3;
- NRF2-mediated PRKCE EP300; SOD2; PRKCZ; MAPKl; SQSTM1;
- PRKD1 PRKD1; MAPK3; KRAS; PRKCD; GSTP1; MAPK9; FTL;
- MAP2K2 AKT1; PIK3R1 ; MAP2K1; PPIB; JUN; KEAP1;
- GSK3B ATF4; PRKCA; EIF2A.K3; HSP90AA1
- IGF1R IGF1R
- IL6R RELA
- TLR4 PDGFRB
- TNF RELB
- IL8 IL8
- PDGFRA NFKBl
- TGFBR1 TGFBR1
- SMAD4 VEGFA
- BAX BAX
- IL1RI IL1RI
- CC 1.2 HGF
- VI Ml' I STAT1
- IL6 IL6
- CTGF MMP9
- PPARGCI A PDGFRB; TNF; INSR; RAFl; IKBKG;
- MAPK9 MAPK9; PIK3C2A; BTK; MAPKl 4; TNF; RAFl; FYN;
- MAP2K2 MAP2K2; AKT1; PIK3R1; PDPK1; MAP2K1; AKT3;
- PIK3CA Receptor Signaling PIK3CA; CREB1; GNAQ; NFKB2; CAMK2A; PIK3CB;
- PIK3C3 MAPK3; KRAS; RELA; SRC; PIK3C2A; RAFl;
- Trpal Pome; Cgrp; Crf; Pka; Era; Nr2b; TRPM5; Prkaca;
- Wnt2b Wnt3a; Wnt4; Wnt5a; Wnt6; Wnt7b; WntSb;
- Embodiments of the invention also relate to methods and compositions related to knocking out genes, amplifying genes and repairing particular mutations associated with DNA repeat instability and neurological disorders (Robert D. Wells, Tetsuo Ashizawa, Genetic Instabilities and Neurological Diseases, Second Edition, Academic Press, Oct 13, 201 1 - Medical). Specific aspects of tandem repeat sequences have been found to be responsible for more than twenty human diseases (New insights into repeat instability: role of RNA*DNA hybrids, Mclvor EI, Polak U, Napierala M. NA Biol. 2010 Sep-Oct;7(5):551-8). The CRISPR- Cas system may be harnessed to correct these defects of genomic instability.
- a further aspect of the invention relates to utilizing the CRISPR-Cas system for correcting defects in the EMP2A and EMP2B genes that have been identified to be associated with Lafora disease.
- Lafora disease is an autosomal recessive condition which is characterized by progressive myoclonus epilepsy which may start as epileptic seizures in adolescence. A few cases of the disease may be caused by mutations in genes yet to be identified. The disease causes seizures, muscle spasms, difficulty walking, dementia, and eventually death. There is currently no therapy that has proven effective against disease progression.
- the CRISPR-Cas system may be used to correct ocular defects that arise from several genetic mutations further described in Genetic Diseases of the Eye, Second Edition, edited by Elias I. Traboulsi, Oxford University Press, 2012.
- the genetic brain diseases may include but are not limited to Adrenoleukodystrophy, Agenesis of the Corpus Callosum, Aicardi Syndrome, Alpers' Disease, Alzheimer's Disease, Barth Syndrome, Batten Disease, CADASIL, Cerebellar Degeneration, Fabry's Disease, Gerstmann-Straussier-Scheinker Disease, Huntington's Disease and other Triplet Repeat Disorders, Leigh's Disease, Lesch-Nyhan Syndrome, Menkes Disease, Mitochondrial Myopathies and NF DS Colpocephaly. These diseases are further described on the website of the National institutes of Health under the subsection Genetic Brain Disorders.
- the condition may be neoplasia.
- the genes to be targeted are any of those listed in Table A (in this case PTEN and so forth).
- the condition may be Age-related Macular Degeneration,
- the condition may be a Schizophrenic Disorder.
- the condition may be a Trinucleotide Repeat Disorder.
- the condition may be Fragile X Syndrome.
- the condition may be a Secretase
- the condition may be a Prion - related disorder.
- the condition may be ALS.
- the condition may be a drug addiction.
- the condition may be Autism.
- the condition may be Alzheimer's Disease.
- the condition may be inflammation.
- the condition may be Parkinson's Disease.
- proteins associated with Parkinson's disease include but are not limited to a-synucieiii, DJ-1, LRRK2, PINK1, Parkin, UCHL1, Synphilin-I, and URRl .
- Examples of addiction-related proteins may include ABAT for example.
- inflammation-related proteins may include the monocyte chemoattractant protein-] (MCP1 ) encoded by the Ccr2 gene, the C-C chernokine receptor type 5
- CCR5 encoded by the Ccr5 gene
- FCGR2b also termed CD32
- FCERlg Fc epsiion Rig
- cardiovascular diseases associated proteins may include IL1B (interleukm 1 , beta), XDH (xanthine dehydrogenase), TPS 3 (tumor protein p53), PTGIS (prostaglandin 12 (prostacyclin) synthase), MB (myoglobin), IL4 (interleukm 4), ANGPT1 (angiopoietin 1), ABCG8 (ATP-binding cassette, sub-family G (WHITE), member 8), or CTS (cathepsin ), for example.
- IL1B interleukm 1 , beta
- XDH xanthine dehydrogenase
- TPS 3 tumor protein p53
- PTGIS prostaglandin 12 (prostacyclin) synthase)
- MB myoglobin
- IL4 interleukm 4
- ANGPT1 angiopoietin 1
- ABCG8 ATP-binding cassette, sub-family G (WHITE), member 8
- Examples of Alzheimer's disease associated proteins may include the very low density lipoprotein receptor protein (VLDLR) encoded by the VLDLR gene, the ubiquitin-like modifier activating enzyme I (UBA1) encoded by the UBA1 gene, or the NEDD8 -activating enzyme El catalytic subunit protein (UBE1C) encoded by the UBA3 gene, for example.
- VLDLR very low density lipoprotein receptor protein
- UBA1 ubiquitin-like modifier activating enzyme I
- UBE1C El catalytic subunit protein
- proteins associated Autism Spectrum Disorder may include the benzodiazapine receptor (peripheral) associated protein 1 (BZRAPl ) encoded by the BZRAP1 gene, the AF4/FMR2 family member 2 protein (AFF2) encoded by the AFF2 gene (also termed MFR2), the fragile X mental retardation autosomal homo log 1 protein (FXRl) encoded by the FXR1 gene, or the fragile X mental retardation autosomal homolog 2 protein (FXR2) encoded by the FXR2 gene, for example.
- BZRAPl benzodiazapine receptor (peripheral) associated protein 1
- AFF2 AF4/FMR2 family member 2 protein
- FXRl fragile X mental retardation autosomal homo log 1 protein
- FXR2 fragile X mental retardation autosomal homolog 2 protein
- proteins associated Macular Degeneration may include the ATP-binding cassette, sub-family A (ABC1) member 4 protein (ABCA4) encoded by the ABCR gene, the apolipoprotein E protein (APOE) encoded by the APOE gene, or the chemokine (C-C motif) Ligand 2 protein (CCL2) encoded by the CCL2 gene, for example.
- ABC1 sub-family A
- APOE apolipoprotein E protein
- CCL2 Ligand 2 protein
- proteins associated Schizophrenia may include NRGl, ErbB4, CPLXl, TPH1, TPH2, NRXN1, GS 3A, BDNF, DISCI, GSK3B, and combinations thereof.
- proteins involved in tumor suppression may include ATM (ataxia telangiectasia mutated), ATR (ataxia telangiectasia and Rad3 related), EGFR (epidermal growth factor receptor), ERBB2 (v ⁇ erh-b2 erythroblastic leukemia viral oncogene homolog 2), ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3), ERBB4 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 4), Notch 1, Notch2, Notch 3, or Notch 4, for example.
- ATM ataxia telangiectasia mutated
- ATR ataxia telangiectasia and Rad3 related
- EGFR epidermatitise
- ERBB2 v ⁇ erh-b2 erythroblastic leukemia viral oncogene homolog 2
- ERBB3 v-erb-b2 erythroblastic leukemia viral on
- proteins associated with a secretase disorder may include PSENEN (presenilin enhancer 2 homolog (C. elegans)), CTSB (cathepsin B), PSEN1 (presenilin 1 ), APP (amyloid beta (A4) precursor protein), APH1B (anterior pharynx defective 1 homolog B (C. elegans)), PSEN2 (presenilin 2 (Alzheimer disease 4)), or BACE1 (beta-site APP-cieaving enzyme 1), for example.
- proteins associated with Amyotrophic Lateral Sclerosis may include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
- proteins associated with prion diseases may include SOD1 (superoxide dismutase 1), ALS2 (amyotrophic lateral sclerosis 2), FUS (fused in sarcoma), TARDBP (TAR DNA binding protein), VAGFA (vascular endothelial growth factor A), VAGFB (vascular endothelial growth factor B), and VAGFC (vascular endothelial growth factor C), and any combination thereof.
- proteins related to neurodegenerative conditions in prion disorders may include A2M (Alpha-2-MacroglobuIin), AATF (Apoptosis antagonizing transcription factor), ACPP (Acid phosphatase prostate), ACTA2 (Ac-tin alpha 2 smooth muscle aorta), ADAM 22 (ADAM metailopeptidase domain), ADORA3 (Adenosine A3 receptor), or ADRA1D (Alpha-ID adrenergic receptor for Alpha- ID adrenoreceptor), for example.
- proteins associated with Immunodeficiency may include A2M [alpha-2- macroglobulin]; AANAT [arylalkylamine N-acetyltransferase] ; ABCAI [ATP -binding cassette, sub-family A (ABCl), member 1]; ABCA2 [ATP-binding cassette, sub-family A (ABC l), member 2]; or ABCA3 [ATP-binding cassette, sub-family A (ABCl), member 3]; for example, [0360]
- proteins associated with Trinucleotide Repeat Disorders include AR (androgen receptor), FMR1 (fragile mental retardation 1), HTT (huntingtin), or DMP (dystrophia myotonica-protein kinase), F.XN (frataxin), A.TXN2 (ataxvn 2), for example.
- proteins associated with Neurotransmission Disorders include SST (somatostatin), OS1 (nitric oxide synthase 1 (neuronal)), ADRA2A (adrenergic, alpha ⁇ 2A ⁇ , receptor), ADRA2C (adrenergic, alpha-2C-, receptor), TACR1 (tachykinin receptor 1), or HTR2c (5-hydroxytryptamine (serotonin) receptor 2C), for example,
- neurodevelopmental-associated sequences include A2BP1 [ataxin 2- binding protein 1], AADAT [aminoadipate aminotransferase], AANAT [arylalkylamine N ⁇ acetyltransferase] , ABAT [4-aminobutyrate aminotransferase], ABCAl [ATP-binding cassette, sub-family A (ABCl), member 1], or ABCA13 [ATP-binding cassette, sub-family A (ABCl), member 13], for example.
- A2BP1 ataxin 2- binding protein 1
- AADAT aminoadipate aminotransferase
- AANAT arylalkylamine N ⁇ acetyltransferase
- ABAT 4-aminobutyrate aminotransferase
- ABCAl ATP-binding cassette, sub-family A (ABCl), member 1
- ABCA13 ATP-binding cassette, sub-family A (ABCl), member 13
- FIG. 1 Aicardi-Goutieres Syndrome; Alexander Disease; Allan-Herndon-Dudley Syndrome; POLG-Related Disorders; Aipha-Mannosidosis (Type II and II S ); Alstrom Syndrome; Angelman; Syndrome; Ataxia-Telangiectasia; Neuronal Ceroid-Lipofuscinoses; Beta- Thalassemia; Bilateral Optic Atrophy and (Infantile) Optic Atrophy Type 1; Retinoblastoma (bilateral); Canavan Disease; Cerebrooculofacioskeletal Syndrome 1 [COFSl]; Cerebrotendinous Xanthomatosis; Cornelia de Lange Syndrome; MAPT-Related Disorders; Genetic Prion Diseases; Dravet Syndrome; Early-Onset Familial Alzheimer Disease; Friedreich Ataxia [FRDA]; Fryns Syndrome; Fucosidosis; Fukuyama Congenital Muscular Dystrophy; Galac
- the present system can be used to target any polynucleotide sequence of interest.
- Some examples of conditions or diseases that might be usefully treated using the present system are included in the Tables above and examples of genes currently associated with those conditions are also provided there. However, the genes exemplified are not exhaustive.
- wild type StCas9 refers to wild type Cas9 from S tbermophilus, the protem sequence of which is given in the SwissProt database under accession number G3ECR1.
- S pyogenes Cas9 is included in SwissProt under accession number Q99ZW2.
- Example 1 Methodological improvement to simplify cloning and delivery.
- Applicants Rather than encoding the U6-promoter and guide RNA on a plasmid, Applicants amplified the U6 promoter with a DNA oligo to add on the guide RNA. The resulting PCR product may be transfected into cells to drive expression of the guide RNA..
- Reverse Primer (carrying the guide RNA, which is underlined): acctctagAAAAAAAGCACCGACTCGGTGCCACTTTTTCAAGTTGATAACGGACTAGC CTTATTTTAACTTGCTATGCTGTTTTGTTTCCAAAACAGCATAGCTCTAAAACCCC TAGTCAXrGGAGGTGACGGTGTTTCGTCCTTTCCACaag
- Example 2 Methodological improvement to improve activity:
- RNA polymerase III e.g. U6 or HI promoters
- T7 polymerase in eukaryotic cells to drive expression of guide RNAs using the T7 promoter.
- One example of this system may involve introduction of three pieces of DNA:
- Example 3 Methodological improvement to reduce toxicity of Cas9: Delivery of Cas9 in the form of mRNA, [0377] Delivery of Cas9 in the form of mRNA enables transient expression of Cas9 in cells, to reduce toxicity.
- humanized SpCas9 may be amplified using the following primer pair:
- Applicants transfect the Cas9 mRNA into cells with either guide RNA in the form of RNA or DNA cassettes to drive guide RNA expression in eukaryotic cells.
- Example 4 Methodological improvement to reduce toxicity of Cas9: Use of an inducible promoter
- Applicants transiently turn on Cas9 expression only when it is needed for carrying out genome modification.
- inducible system include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or cryptochrome).
- Most Cas9 homologs are fairly large.
- the SpCas9 is around 1368aa long, which is too large to be easily packaged into viral vectors for delivery.
- a graph representing the length distribution of Cas9 homologs is generated from sequences deposited in GenBank ( Figure 5). Some of the sequences may have been mis-annotated and therefore the exact frequency for each length may not necessarily be accurate. Nevertheless it provides a glimpse at distribution of Cas9 proteins and suggest that there are shorter Cas9 homologs.
- the putative tracrRNA element for this CjCas9 is:
- Applicants For enhanced function or to develop new functions, Applicants generate chimer Cas9 proteins by combining fragments from different Cas9 homologs. For example, two examp chimeric Cas9 proteins: [0393] For example, Applicants fused the N-term of StlCas9 (fragment from this protein is in bold) with C-term of SpCas9 (fragment from this protein is underlined).
- Example 7 Utilization ofCas9 as a generic DNA binding protein
- D10 and H840 catalytic domains responsible for cleaving both strands of the DNA target.
- VP64 transcriptional activation domain
- Applicants use these constructs to assess transcriptional activation (VP64 fused constructs) and repression (Cas9 only) by RT-qPCR. Applicants assess the cellular localization of each construct using anti-His antibody, nuclease activity using a Surveyor nuclease assay, and DNA binding affinity using a gel shift assay. In a preferred embodiment of the invention, the gel shift assay is an EMS A gel shift assay.
- Example 8 Cas9 transgenic and knock in mice
- pCAG is the promoter
- NLS is a nuclear localization signal
- P2A is the peptide cleavage sequence
- EGFP is enhanced green fluorescent protein
- WPRE is the woodchuck hepatitis virus posttranscriptional regulatory element
- bGHpolyA is the bovine growth hormone poly- A signal sequence ( Figures 7A-B).
- the conditional version has one additional stop cassette element, loxP-SV40 polyA x3-loxP, after the promoter and before NLS-Cas9-NLS (i.e. pCAG-loxP-SV40polyAx3-ioxP-NLS-Cas9-NLS- P2A-EGFP-WPRE-bGHpolyA).
- the important expression elements can be visualized as in Figure 8.
- the constitutive construct should be expressed in all cell types throughout development, whereas, the conditional construct will only allow Cas9 expression when the same cell is expressing the Cre recombinase. This latter version will allow for tissue specific expression of Cas9 when Cre is under the expression of a tissue specific promoter.
- Cas9 expression could be induced in adult mice by putting Cre under the expression of an inducible promoter such as the TET on or off system.
- Each plasmid was functionally validated in three ways: 1) transient transfection in 293 cells followed by confirmation of GFP expression; 2) transient transfection in 293 cells followed by immunofluorescence using an antibody recognizing the P2A sequence; and 3) transient transfection followed by Surveyor nuclease assay.
- the 293 cells may be 293FT or 293 T cells depending on the cells that are of interest. In a preferred embodiment the cells are 293FT cells.
- the results of the Surveyor were run out on the top and bottom row of the gel for the conditional and constitutive constructs, respectively. Each was tested in the presence and absence of chimeric RNA targeted to the hEMXl locus (chimeric RNA hEMXl.l).
- Transgenic Cas9 mouse To generate transgenic mice with constructs, Applicants inject pure, linear DNA into the pronucleus of a zygote from a pseudo pregnant CB56 female. Founders are identified, genotyped, and backcrossed to CBS 7 mice. The constructs were successfully cloned and verified by Sanger sequencing.
- the CRISPR-Cas system is an adaptive immune mechanism against invading exogenous DNA employed by diverse species across bacteria and archaea.
- the type II CRISPR- Cas system consists of a set of genes encoding proteins responsible for the "acquisition" of foreign DNA into the CRISPR locus, as well as a set of genes encoding the "execution” of the DNA cleavage mechanism; these include the DNA nuclease (Cas9), a non-coding transaetivating cr-RNA (tracrRNA), and an array of foreign DNA-derived spacers flanked by direct repeats (crRNAs).
- the tracrRNA and crRNA duplex guide the Cas9 nuclease to a target DNA sequence specified by the spacer guide sequences, and mediates double-stranded breaks in the DN A near a short sequence motif in the target DNA that is required for cleavage and specific to each CRISPR-Cas system.
- the type II CRISPR-Cas systems are found throughout the bacterial kingdom and highly diverse in in Cas9 protein sequence and size, tracrRNA and crRNA direct repeat sequence, genome organization of these elements, and the motif requirement for target cleavage.
- One species may have multiple distinct CRISPR-Cas systems.
- Applicants provide sequences showing where the mutation points are located within the SpCas9 gene ( Figure 6A-M). Applicants also show that the nickases are still able to mediate homologous recombination. Furthermore, Applicants show that SpCas9 with these mutations (individually) do not induce double strand break.
- Cas9 orthologs ail share the general organization of 3-4 RuvC domains and a HNH domain. The 5' most RuvC domain cleaves the non-complementary strand, and the HNH domain cleaves the complementary strand. All notations are in reference to the guide sequence.
- the catalytic residue in the 5' RuvC domain is identified through homology comparison of the Cas9 of interest with other Cas9 orthologs (from S. pyogenes type ⁇ CRISPR locus, S. thermophilus CRISPR locus 1, S. thermophilus CRISPR locus 3, and Franciscilla novicida type II CRISPR locus), and the conserved Asp residue is mutated to alanine to convert Cas9 into a complementary-strand nicking enzyme. Similarly, the conserved His and Asn residues in the HN H domains are mutated to Alanine to convert Cas9 into a non-complementary- strand nicking enzyme.
- a second generation of constructs have been designed and are in the pipeline to be tested (Table 1). These constructs will be used to assess transcriptional activation (VP64 fused constructs) and repression (Cas9 only) by RT-qPCR. Applicants will also assess the cellular localization of each construct using anti-His antibody,, nuclease activity using a Surveyor nuclease assay, and DNA binding affinity using a gel shift assay.
- Cas Repressor It has been shown previously that dCas9 can be used as a generic DNA binding domain to repress gene expression. Applicants report an improved dCas9 design as well as dCas9 fusions to the repressor domains KRAB and SID4x.
- dCas9 repressor piasmid was co-transfected with two guide RNAs targeted to the coding strand of the beta-catenin gene.
- RNA was isolated 72 hours after transfection and gene expression was quantified by RT-qPCR.
- the endogenous control gene was GAPDH.
- Two validated shRNAs were used as positive controls. Negative controls were certain plasmids transfected without gRNA, these are denoted as "pXRP## control".
- the plasmids pXRP28, pXRP29, pXRP48, and pXRP49 could repress the beta-catenin gene when using the specified targeting strategy.
- These plasmids correspond to dCas9 without a functional domain (pXRP28 and pXRP28) and dCas9 fused to SID4x (pXRP48 and pXRP49).
- Example 12 Targeted deletion of genes involved in cholesterol biosynthesis, fatty acid biosynthesis, and other metabolic disorders, genes encoding mis-folded proteins involved in amyloid and other diseases, oncogenes leading to cellular transformation, latent viral genes, and genes leading to dominant-negative disorders, amongst other disorders.
- Applicants demonstrate gene delivery of a CRISPR-Cas system in the liver, brain, ocular, epithelial, hematopoetic, or another tissue of a subject or a patient in need thereof, suffering from metabolic disorders, amyloidosis and protein-aggregation related diseases, cellular transformation arising from genetic mutations and translocations, dominant negative effects of gene mutations, latent viral infections, and other related symptoms, using either viral or nanoparticle delivery system.
- Study Design Subjects or patients in need thereof suffering from metabolic disorders, amyloidosis and protein aggregation related disease which include but are not limited to human, non-primate human, canine, feline, bovine, equine, other domestic animals and related mammals.
- the CRISPR-Cas system is guided by a chimeric guide RNA and targets a specific site of the human genomic loci to be cleaved. After cleavage and non-homologous end-joining mediated repair, frame-shift mutation results in knock out of genes.
- Applicants select guide-RNAs targeting genes involved in above-mentioned disorders to be specific to endogenous loci with minimal off-target activity.
- TWO or more guide RNAs may be encoded into a single CRISPR array to induce simultaneous double-stranded breaks in DNA leading to micro-deletions of affected genes or chromosomal regions.
- Applicants sel ect DNA sequences of interest include protein-coding exons, sequences including and flanking known dominant negative mutation sites, sequences including and flanking pathological repetitive sequences.
- early coding exons closest to the start codon offer best options for achieving complete knockout and minimize possibility of truncated protein products retaining partial function.
- Applicants analyze sequences of interest for all possible targetabie 20-bp sequences immediately 5' to a NGG motif (for SpCas9 system) or a NNAGAAW (for StlCas9 system). Applicants choose sequences for unique, single RNA- guided Cas9 recognition in the genome to minimize off-target effects based on computational algorithm to determine specificity.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Crystallography & Structural Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Virology (AREA)
- Bioinformatics & Computational Biology (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
Abstract
Description
Claims
Priority Applications (12)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP14734708.2A EP3011029B1 (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
KR1020167001305A KR20160044457A (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
DK14734708.2T DK3011029T3 (en) | 2013-06-17 | 2014-06-10 | ADMINISTRATION, MODIFICATION AND OPTIMIZATION OF TANDEM GUIDE SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION |
ES14734708T ES2777217T3 (en) | 2013-06-17 | 2014-06-10 | Supply, modification and optimization of tandem guidance systems, methods and compositions for sequence manipulation |
JP2016521449A JP6625971B2 (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for array manipulation |
AU2014281026A AU2014281026B2 (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
CA2915834A CA2915834A1 (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
EP19212058.2A EP3674411A1 (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
CN201480045695.3A CN106062197A (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
US14/972,927 US11008588B2 (en) | 2013-06-17 | 2015-12-17 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
HK16111709.1A HK1223646A1 (en) | 2013-06-17 | 2016-10-11 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
US17/321,872 US20210292794A1 (en) | 2013-06-17 | 2021-05-17 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
Applications Claiming Priority (14)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361836123P | 2013-06-17 | 2013-06-17 | |
US61/836,123 | 2013-06-17 | ||
US201361847537P | 2013-07-17 | 2013-07-17 | |
US61/847,537 | 2013-07-17 | ||
US201361862355P | 2013-08-05 | 2013-08-05 | |
US201361862468P | 2013-08-05 | 2013-08-05 | |
US61/862,355 | 2013-08-05 | ||
US61/862,468 | 2013-08-05 | ||
US201361871301P | 2013-08-28 | 2013-08-28 | |
US61/871,301 | 2013-08-28 | ||
US201361915407P | 2013-12-12 | 2013-12-12 | |
US61/915,407 | 2013-12-12 | ||
US201461979942P | 2014-04-15 | 2014-04-15 | |
US61/979,942 | 2014-04-15 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/972,927 Continuation-In-Part US11008588B2 (en) | 2013-06-17 | 2015-12-17 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
Publications (3)
Publication Number | Publication Date |
---|---|
WO2014204724A1 true WO2014204724A1 (en) | 2014-12-24 |
WO2014204724A8 WO2014204724A8 (en) | 2015-12-23 |
WO2014204724A9 WO2014204724A9 (en) | 2016-03-24 |
Family
ID=51059658
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2014/041800 WO2014204724A1 (en) | 2013-06-17 | 2014-06-10 | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
Country Status (11)
Country | Link |
---|---|
US (2) | US11008588B2 (en) |
EP (2) | EP3011029B1 (en) |
JP (2) | JP6625971B2 (en) |
KR (1) | KR20160044457A (en) |
CN (1) | CN106062197A (en) |
AU (1) | AU2014281026B2 (en) |
CA (1) | CA2915834A1 (en) |
DK (1) | DK3011029T3 (en) |
ES (1) | ES2777217T3 (en) |
HK (1) | HK1223646A1 (en) |
WO (1) | WO2014204724A1 (en) |
Cited By (192)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9068179B1 (en) | 2013-12-12 | 2015-06-30 | President And Fellows Of Harvard College | Methods for correcting presenilin point mutations |
US9228207B2 (en) | 2013-09-06 | 2016-01-05 | President And Fellows Of Harvard College | Switchable gRNAs comprising aptamers |
WO2016028682A1 (en) * | 2014-08-17 | 2016-02-25 | The Broad Institute Inc. | Genome editing using cas9 nickases |
WO2016049163A2 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
WO2016049251A1 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes |
US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
US9322006B2 (en) | 2011-07-22 | 2016-04-26 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
WO2016069591A2 (en) | 2014-10-27 | 2016-05-06 | The Broad Institute Inc. | Compositions, methods and use of synthetic lethal screening |
US20160139124A1 (en) * | 2014-11-04 | 2016-05-19 | Bloodcenter Research Foundaton | Method to bioengineer designer platelets using gene editing and stem cell methodologies |
WO2016086197A1 (en) | 2014-11-25 | 2016-06-02 | The Brigham And Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
WO2016094867A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Protected guide rnas (pgrnas) |
WO2016094880A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs) |
WO2016094872A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Dead guides for crispr transcription factors |
WO2016094874A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Escorted and functionalized guides for crispr-cas systems |
WO2016100974A1 (en) | 2014-12-19 | 2016-06-23 | The Broad Institute Inc. | Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing |
WO2016106244A1 (en) | 2014-12-24 | 2016-06-30 | The Broad Institute Inc. | Crispr having or associated with destabilization domains |
WO2016106236A1 (en) | 2014-12-23 | 2016-06-30 | The Broad Institute Inc. | Rna-targeting system |
WO2016108926A1 (en) | 2014-12-30 | 2016-07-07 | The Broad Institute Inc. | Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis |
WO2016130697A1 (en) * | 2015-02-11 | 2016-08-18 | Memorial Sloan Kettering Cancer Center | Methods and kits for generating vectors that co-express multiple target molecules |
WO2016138488A2 (en) | 2015-02-26 | 2016-09-01 | The Broad Institute Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
WO2016182893A1 (en) | 2015-05-08 | 2016-11-17 | Teh Broad Institute Inc. | Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
WO2016205745A2 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Cell sorting |
WO2016205764A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
WO2016205728A1 (en) | 2015-06-17 | 2016-12-22 | Massachusetts Institute Of Technology | Crispr mediated recording of cellular events |
WO2016205749A1 (en) * | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
WO2016186772A3 (en) * | 2015-05-16 | 2017-01-05 | Genzyme Corporation | Gene editing of deep intronic mutations |
US9546384B2 (en) | 2013-12-11 | 2017-01-17 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a mouse genome |
WO2017023974A1 (en) * | 2015-08-03 | 2017-02-09 | President And Fellows Of Harvard College | Cas9 genome editing and transcriptional regulation |
JP2017504312A (en) * | 2013-12-12 | 2017-02-09 | ザ・ブロード・インスティテュート・インコーポレイテッド | Delivery, use and therapeutic application of CRISPR-Cas systems and compositions for genome editing |
WO2017070605A1 (en) | 2015-10-22 | 2017-04-27 | The Broad Institute Inc. | Type vi-b crispr enzymes and systems |
WO2017069958A2 (en) | 2015-10-09 | 2017-04-27 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
WO2017074788A1 (en) | 2015-10-27 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for targeting cancer-specific sequence variations |
WO2017075294A1 (en) | 2015-10-28 | 2017-05-04 | The Board Institute Inc. | Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction |
WO2017075478A2 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures |
WO2017075451A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1 |
WO2017075465A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3 |
WO2017087708A1 (en) | 2015-11-19 | 2017-05-26 | The Brigham And Women's Hospital, Inc. | Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity |
WO2017053431A3 (en) * | 2015-09-21 | 2017-06-01 | Arcturus Therapeutics, Inc. | Allele selective gene editing and uses thereof |
WO2017114497A1 (en) | 2015-12-30 | 2017-07-06 | Novartis Ag | Immune effector cell therapies with enhanced efficacy |
WO2017131926A1 (en) * | 2016-01-26 | 2017-08-03 | Cedars-Sinai Medical Center | SYSTEMS AND METHODS FOR IN VIVO DUAL RECOMBINASE-MEDIATED CASSETTE EXCHANGE (dRMCE) AND DISEASE MODELS THEREOF |
WO2017147196A1 (en) | 2016-02-22 | 2017-08-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating immune phenotypes |
EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
WO2017161325A1 (en) | 2016-03-17 | 2017-09-21 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
WO2017189308A1 (en) * | 2016-04-19 | 2017-11-02 | The Broad Institute Inc. | Novel crispr enzymes and systems |
US9822372B2 (en) | 2012-12-12 | 2017-11-21 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
WO2017219027A1 (en) | 2016-06-17 | 2017-12-21 | The Broad Institute Inc. | Type vi crispr orthologs and systems |
WO2017216392A1 (en) * | 2016-09-23 | 2017-12-21 | Dsm Ip Assets B.V. | A guide-rna expression system for a host cell |
CN107532161A (en) * | 2015-03-03 | 2018-01-02 | 通用医疗公司 | The specific engineering CRISPR Cas9 nucleases of PAM with change |
JP2018500037A (en) * | 2014-12-31 | 2018-01-11 | シンセティック ジェノミクス インコーポレーテッド | Compositions and methods for highly efficient in vivo genome editing |
WO2018013840A1 (en) | 2016-07-13 | 2018-01-18 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
JP2018503386A (en) * | 2015-01-28 | 2018-02-08 | パイオニア ハイ−ブレッド インターナショナル, インコーポレイテッド | CRISPR hybrid DNA / RNA polynucleotides and methods of use |
WO2018035364A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute Inc. | Product and methods useful for modulating and evaluating immune responses |
WO2018035250A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
WO2018049025A2 (en) | 2016-09-07 | 2018-03-15 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses |
WO2018054911A1 (en) | 2016-09-23 | 2018-03-29 | Bayer Cropscience Nv | Targeted genome optimization in plants |
WO2018067991A1 (en) | 2016-10-07 | 2018-04-12 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
WO2018083606A1 (en) | 2016-11-01 | 2018-05-11 | Novartis Ag | Methods and compositions for enhancing gene editing |
US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
WO2018170515A1 (en) | 2017-03-17 | 2018-09-20 | The Broad Institute, Inc. | Methods for identifying and modulating co-occurant cellular phenotypes |
WO2018170333A1 (en) | 2017-03-15 | 2018-09-20 | The Broad Institute, Inc. | Novel cas13b orthologues crispr enzymes and systems |
WO2018172556A1 (en) * | 2017-03-24 | 2018-09-27 | Curevac Ag | Nucleic acids encoding crispr-associated proteins and uses thereof |
US10093910B2 (en) | 2015-08-28 | 2018-10-09 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
WO2018191388A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Novel type vi crispr orthologs and systems |
WO2018191750A2 (en) | 2017-04-14 | 2018-10-18 | The Broad Institute Inc. | Novel delivery of large payloads |
WO2018191520A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
WO2018191553A1 (en) | 2017-04-12 | 2018-10-18 | Massachusetts Eye And Ear Infirmary | Tumor signature for metastasis, compositions of matter methods of use thereof |
WO2018195486A1 (en) | 2017-04-21 | 2018-10-25 | The Broad Institute, Inc. | Targeted delivery to beta cells |
WO2018195019A1 (en) | 2017-04-18 | 2018-10-25 | The Broad Institute Inc. | Compositions for detecting secretion and methods of use |
US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
US10138476B2 (en) | 2013-03-15 | 2018-11-27 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
US10167457B2 (en) | 2015-10-23 | 2019-01-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
WO2019003193A1 (en) | 2017-06-30 | 2019-01-03 | Novartis Ag | Methods for the treatment of disease with gene editing systems |
WO2019005884A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | Crispr/cas-adenine deaminase based compositions, systems, and methods for targeted nucleic acid editing |
WO2019060746A1 (en) | 2017-09-21 | 2019-03-28 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
WO2019071054A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
EP3514246A1 (en) | 2014-02-27 | 2019-07-24 | The Broad Institute Inc. | T cell balance gene expression and methods of use thereof |
WO2019143675A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
WO2019143677A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
WO2019143678A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
US10385359B2 (en) | 2013-04-16 | 2019-08-20 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
WO2019204585A1 (en) | 2018-04-19 | 2019-10-24 | Massachusetts Institute Of Technology | Single-stranded break detection in double-stranded dna |
US10457960B2 (en) | 2014-11-21 | 2019-10-29 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification using paired guide RNAs |
EP3560330A1 (en) | 2018-04-24 | 2019-10-30 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
WO2019210268A2 (en) | 2018-04-27 | 2019-10-31 | The Broad Institute, Inc. | Sequencing-based proteomics |
WO2019213660A2 (en) | 2018-05-04 | 2019-11-07 | The Broad Institute, Inc. | Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses |
US10494621B2 (en) | 2015-06-18 | 2019-12-03 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
WO2019232542A2 (en) | 2018-06-01 | 2019-12-05 | Massachusetts Institute Of Technology | Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients |
US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
WO2019237399A1 (en) * | 2018-06-16 | 2019-12-19 | 深圳市博奥康生物科技有限公司 | Method for specifically knocking out human c2orf40 gene by crispr-cas9 and specific sgrna thereof |
WO2020006036A1 (en) | 2018-06-26 | 2020-01-02 | Massachusetts Institute Of Technology | Crispr effector system based amplification methods, systems, and diagnostics |
WO2020006049A1 (en) | 2018-06-26 | 2020-01-02 | The Broad Institute, Inc. | Crispr/cas and transposase based amplification compositions, systems and methods |
US10526591B2 (en) | 2015-08-28 | 2020-01-07 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
US10550372B2 (en) | 2013-12-12 | 2020-02-04 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
WO2020028555A2 (en) | 2018-07-31 | 2020-02-06 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
WO2020033601A1 (en) | 2018-08-07 | 2020-02-13 | The Broad Institute, Inc. | Novel cas12b enzymes and systems |
WO2020041387A1 (en) | 2018-08-20 | 2020-02-27 | The Brigham And Women's Hospital, Inc. | Degradation domain modifications for spatio-temporal control of rna-guided nucleases |
WO2020041380A1 (en) | 2018-08-20 | 2020-02-27 | The Broad Institute, Inc. | Methods and compositions for optochemical control of crispr-cas9 |
US10577630B2 (en) | 2013-06-17 | 2020-03-03 | The Broad Institute, Inc. | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy |
WO2020051507A1 (en) | 2018-09-06 | 2020-03-12 | The Broad Institute, Inc. | Nucleic acid assemblies for use in targeted delivery |
WO2020077236A1 (en) | 2018-10-12 | 2020-04-16 | The Broad Institute, Inc. | Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues |
WO2020081730A2 (en) | 2018-10-16 | 2020-04-23 | Massachusetts Institute Of Technology | Methods and compositions for modulating microenvironment |
US10648020B2 (en) | 2015-06-18 | 2020-05-12 | The Broad Institute, Inc. | CRISPR enzymes and systems |
US10662425B2 (en) | 2017-11-21 | 2020-05-26 | Crispr Therapeutics Ag | Materials and methods for treatment of autosomal dominant retinitis pigmentosa |
US10669540B2 (en) | 2015-06-18 | 2020-06-02 | The Board Institute, Inc. | CRISPR enzymes and systems |
WO2020131586A2 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Methods for identifying neoantigens |
WO2020131862A1 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Crispr-associated transposase systems and methods of use thereof |
US10711285B2 (en) | 2013-06-17 | 2020-07-14 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
US10781444B2 (en) | 2013-06-17 | 2020-09-22 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
WO2020206036A1 (en) | 2019-04-01 | 2020-10-08 | The Broad Institute, Inc. | Novel nucleic acid modifier |
WO2020229533A1 (en) | 2019-05-13 | 2020-11-19 | KWS SAAT SE & Co. KGaA | Drought tolerance in corn |
WO2020236972A2 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Non-class i multi-component nucleic acid targeting systems |
WO2020236967A1 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
US10851357B2 (en) | 2013-12-12 | 2020-12-01 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
WO2020243661A1 (en) | 2019-05-31 | 2020-12-03 | The Broad Institute, Inc. | Methods for treating metabolic disorders by targeting adcy5 |
WO2020239680A2 (en) | 2019-05-25 | 2020-12-03 | KWS SAAT SE & Co. KGaA | Haploid induction enhancer |
WO2021003432A1 (en) | 2019-07-02 | 2021-01-07 | Fred Hutchinson Cancer Research Center | Recombinant ad35 vectors and related gene therapy improvements |
EP3772542A1 (en) | 2019-08-07 | 2021-02-10 | KWS SAAT SE & Co. KGaA | Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2 |
US10930367B2 (en) | 2012-12-12 | 2021-02-23 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof |
WO2021041922A1 (en) | 2019-08-30 | 2021-03-04 | The Broad Institute, Inc. | Crispr-associated mu transposase systems |
US10946108B2 (en) | 2013-06-17 | 2021-03-16 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components |
WO2021055874A1 (en) | 2019-09-20 | 2021-03-25 | The Broad Institute, Inc. | Novel type vi crispr enzymes and systems |
WO2021074367A1 (en) | 2019-10-17 | 2021-04-22 | KWS SAAT SE & Co. KGaA | Enhanced disease resistance of crops by downregulation of repressor genes |
US11001829B2 (en) | 2014-09-25 | 2021-05-11 | The Broad Institute, Inc. | Functional screening with optimized functional CRISPR-Cas systems |
US11008588B2 (en) | 2013-06-17 | 2021-05-18 | The Broad Institute, Inc. | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
US11041173B2 (en) | 2012-12-12 | 2021-06-22 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
US11053482B2 (en) | 2015-04-16 | 2021-07-06 | Wageningen Universiteit | Vector systems for nuclease-mediated genome editing |
US11092607B2 (en) | 2015-10-28 | 2021-08-17 | The Board Institute, Inc. | Multiplex analysis of single cell constituents |
EP3872190A1 (en) | 2020-02-26 | 2021-09-01 | Antibodies-Online GmbH | A method of using cut&run or cut&tag to validate crispr-cas targeting |
US11149267B2 (en) | 2013-10-28 | 2021-10-19 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
US11155795B2 (en) | 2013-12-12 | 2021-10-26 | The Broad Institute, Inc. | CRISPR-Cas systems, crystal structure and uses thereof |
WO2021239986A1 (en) | 2020-05-29 | 2021-12-02 | KWS SAAT SE & Co. KGaA | Plant haploid induction |
US11214800B2 (en) | 2015-08-18 | 2022-01-04 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
US11286468B2 (en) | 2017-08-23 | 2022-03-29 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
US11286478B2 (en) | 2016-04-19 | 2022-03-29 | The Broad Institute, Inc. | Cpf1 complexes with reduced indel activity |
US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
US11306309B2 (en) | 2015-04-06 | 2022-04-19 | The Board Of Trustees Of The Leland Stanford Junior University | Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation |
US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
RU2771826C2 (en) * | 2015-06-18 | 2022-05-12 | Дзе Брод Инститьют Инк. | New crispr enzymes and systems |
US11332736B2 (en) | 2017-12-07 | 2022-05-17 | The Broad Institute, Inc. | Methods and compositions for multiplexing single cell and single nuclei sequencing |
EP4001429A1 (en) | 2020-11-16 | 2022-05-25 | Antibodies-Online GmbH | Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq) |
US11352647B2 (en) | 2016-08-17 | 2022-06-07 | The Broad Institute, Inc. | Crispr enzymes and systems |
US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
US11414657B2 (en) | 2015-06-29 | 2022-08-16 | Ionis Pharmaceuticals, Inc. | Modified CRISPR RNA and modified single CRISPR RNA and uses thereof |
US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
US11547614B2 (en) | 2017-10-31 | 2023-01-10 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
WO2023006933A1 (en) | 2021-07-30 | 2023-02-02 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
US11578312B2 (en) | 2015-06-18 | 2023-02-14 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
US11578118B2 (en) | 2017-10-20 | 2023-02-14 | Fred Hutchinson Cancer Center | Systems and methods to produce B cells genetically modified to express selected antibodies |
US11591601B2 (en) | 2017-05-05 | 2023-02-28 | The Broad Institute, Inc. | Methods for identification and modification of lncRNA associated with target genotypes and phenotypes |
US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
US11603544B2 (en) | 2017-06-05 | 2023-03-14 | Fred Hutchinson Cancer Center | Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies |
US11624077B2 (en) | 2017-08-08 | 2023-04-11 | Peking University | Gene knockout method |
US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
WO2023093862A1 (en) | 2021-11-26 | 2023-06-01 | Epigenic Therapeutics Inc. | Method of modulating pcsk9 and uses thereof |
US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
US11680296B2 (en) | 2017-10-16 | 2023-06-20 | Massachusetts Institute Of Technology | Mycobacterium tuberculosis host-pathogen interaction |
EP3898983A4 (en) * | 2018-12-20 | 2023-07-19 | Peking University | Compositions and methods for highly efficient genetic screening using barcoded guide rna constructs |
US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
EP4268831A2 (en) | 2018-09-12 | 2023-11-01 | Fred Hutchinson Cancer Center | Reducing cd33 expression to selectively protect therapeutic cells |
US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
US11866697B2 (en) | 2017-05-18 | 2024-01-09 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
WO2024020352A1 (en) * | 2022-07-18 | 2024-01-25 | Vertex Pharmaceuticals Incorporated | Tandem guide rnas (tg-rnas) and their use in genome editing |
US11897953B2 (en) | 2017-06-14 | 2024-02-13 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
US11897920B2 (en) | 2017-08-04 | 2024-02-13 | Peking University | Tale RVD specifically recognizing DNA base modified by methylation and application thereof |
US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
WO2024042199A1 (en) | 2022-08-26 | 2024-02-29 | KWS SAAT SE & Co. KGaA | Use of paired genes in hybrid breeding |
US11920128B2 (en) | 2013-09-18 | 2024-03-05 | Kymab Limited | Methods, cells and organisms |
US11957695B2 (en) | 2018-04-26 | 2024-04-16 | The Broad Institute, Inc. | Methods and compositions targeting glucocorticoid signaling for modulating immune responses |
US11963966B2 (en) | 2017-03-31 | 2024-04-23 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating ovarian tumors |
US11981922B2 (en) | 2019-10-03 | 2024-05-14 | Dana-Farber Cancer Institute, Inc. | Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment |
US11994512B2 (en) | 2018-01-04 | 2024-05-28 | Massachusetts Institute Of Technology | Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity |
Families Citing this family (46)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2728782T3 (en) | 2012-05-25 | 2019-10-28 | Univ California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed transcription modulation |
EP3494997B1 (en) * | 2012-07-25 | 2019-09-18 | The Broad Institute, Inc. | Inducible dna binding proteins and genome perturbation tools and applications thereof |
CN116064532A (en) | 2012-10-23 | 2023-05-05 | 基因工具股份有限公司 | Composition for cleaving target DNA and use thereof |
WO2015066119A1 (en) | 2013-10-30 | 2015-05-07 | North Carolina State University | Compositions and methods related to a type-ii crispr-cas system in lactobacillus buchneri |
US10787654B2 (en) | 2014-01-24 | 2020-09-29 | North Carolina State University | Methods and compositions for sequence guiding Cas9 targeting |
CN106460003A (en) | 2014-04-08 | 2017-02-22 | 北卡罗来纳州立大学 | Methods and compositions for RNA-directed repression of transcription using CRISPR-associated genes |
EP3186375A4 (en) | 2014-08-28 | 2019-03-13 | North Carolina State University | Novel cas9 proteins and guiding features for dna targeting and genome editing |
AU2015332451A1 (en) | 2014-10-15 | 2017-04-20 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for generating or maintaining pluripotent cells |
AU2015355546B2 (en) | 2014-12-03 | 2021-10-14 | Agilent Technologies, Inc. | Guide RNA with chemical modifications |
CA2969847A1 (en) | 2014-12-10 | 2016-06-16 | Regents Of The University Of Minnesota | Genetically modified cells, tissues, and organs for treating disease |
EP4039816A1 (en) | 2015-05-29 | 2022-08-10 | North Carolina State University | Methods for screening bacteria, archaea, algae, and yeast using crispr nucleic acids |
EP3307872B1 (en) | 2015-06-15 | 2023-09-27 | North Carolina State University | Methods and compositions for efficient delivery of nucleic acids and rna-based antimicrobials |
CN108472314A (en) | 2015-07-31 | 2018-08-31 | 明尼苏达大学董事会 | The cell and therapy of modification |
EP3356533A1 (en) | 2015-09-28 | 2018-08-08 | North Carolina State University | Methods and compositions for sequence specific antimicrobials |
US11542466B2 (en) | 2015-12-22 | 2023-01-03 | North Carolina State University | Methods and compositions for delivery of CRISPR based antimicrobials |
US10767175B2 (en) | 2016-06-08 | 2020-09-08 | Agilent Technologies, Inc. | High specificity genome editing using chemically modified guide RNAs |
WO2018020050A1 (en) * | 2016-07-29 | 2018-02-01 | MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. | Targeted in situ protein diversification by site directed dna cleavage and repair |
KR102594051B1 (en) * | 2016-08-20 | 2023-10-26 | 아벨리노 랩 유에스에이, 인크. | Single guide RNA, CRISPR/Cas9 system, and methods of use thereof |
CN110520530A (en) | 2016-10-18 | 2019-11-29 | 明尼苏达大学董事会 | Tumor infiltrating lymphocyte and treatment method |
RU2022105597A (en) * | 2016-11-14 | 2022-04-04 | Тулджен Инкорпорейтед | ARTIFICIALLY CREATED SC FUNCTION CONTROL SYSTEM |
WO2018129486A2 (en) * | 2017-01-06 | 2018-07-12 | President And Fellows Of Harvard College | Composition and methods for enhanced knock-in reporter gene expression |
CN110312797A (en) * | 2017-02-10 | 2019-10-08 | 齐默尔根公司 | The modular universal plasmid layout strategy of assembling and editor for multiple DNA constructs of multiple hosts |
GB201702847D0 (en) * | 2017-02-22 | 2017-04-05 | Cancer Res Tech Ltd | Cell labelling, tracking and retrieval |
EP3630975A4 (en) * | 2017-05-26 | 2021-03-10 | North Carolina State University | Altered guide rnas for modulating cas9 activity and methods of use |
EP3645021A4 (en) | 2017-06-30 | 2021-04-21 | Intima Bioscience, Inc. | Adeno-associated viral vectors for gene therapy |
IL271883B1 (en) * | 2017-07-12 | 2024-04-01 | Refuge Biotechnologies Inc | Methods and systems for conditionally regulating gene expression |
CN108424934A (en) * | 2018-04-16 | 2018-08-21 | 和元生物技术(上海)股份有限公司 | A kind of slow virus CAG-CMV double-promoters transformation vector construction and application |
EP3578658A1 (en) * | 2018-06-08 | 2019-12-11 | Johann Wolfgang Goethe-Universität Frankfurt | Method for generating a gene editing vector with fixed guide rna pairs |
CN108846258B (en) * | 2018-06-08 | 2021-05-18 | 中国人民解放军军事科学院军事医学研究院 | Method for automatically detecting reassortment of segmented RNA viruses |
US10711267B2 (en) | 2018-10-01 | 2020-07-14 | North Carolina State University | Recombinant type I CRISPR-Cas system |
WO2020097360A1 (en) * | 2018-11-07 | 2020-05-14 | The Regents Of The University Of Colorado, A Body Corporate | Methods and compositions for genome-wide analysis and use of genome cutting and repair |
CN111349654B (en) * | 2018-12-20 | 2023-01-24 | 北京大学 | Compositions and methods for efficient gene screening using tagged guide RNA constructs |
CN111812066B (en) * | 2019-04-10 | 2023-04-28 | 华东理工大学 | Biosensor based on CRISPR/Cas12a system, kit and application thereof in small molecule detection |
CN112168808B (en) * | 2019-07-02 | 2023-01-24 | 深圳市第二人民医院 | Cell nucleus targeting drug delivery system based on CRISPR |
US20220275359A1 (en) * | 2019-08-01 | 2022-09-01 | Astellas Pharma Inc. | Guide rna for editing target, with functional nucleotide sequence added |
CN111979266A (en) * | 2020-08-28 | 2020-11-24 | 江苏集萃药康生物科技有限公司 | Construction method and application of PCSK9 humanized mouse model |
EP4232925A1 (en) * | 2020-10-21 | 2023-08-30 | Verint Americas Inc. | System and method of automated determination of use of sensitive information and corrective action for improper use |
CN114606196A (en) * | 2020-12-04 | 2022-06-10 | 南京大学 | Cell therapy for siRNA expression and in vivo delivery |
CN112899306B (en) * | 2020-12-21 | 2023-06-30 | 南京启真基因工程有限公司 | CRISPR system and application thereof in construction of GABRG2 gene mutation cloned pig nuclear donor cells |
WO2023039586A1 (en) | 2021-09-10 | 2023-03-16 | Agilent Technologies, Inc. | Guide rnas with chemical modification for prime editing |
WO2023077148A1 (en) | 2021-11-01 | 2023-05-04 | Tome Biosciences, Inc. | Single construct platform for simultaneous delivery of gene editing machinery and nucleic acid cargo |
WO2023122764A1 (en) | 2021-12-22 | 2023-06-29 | Tome Biosciences, Inc. | Co-delivery of a gene editor construct and a donor template |
WO2023205744A1 (en) | 2022-04-20 | 2023-10-26 | Tome Biosciences, Inc. | Programmable gene insertion compositions |
WO2023215831A1 (en) | 2022-05-04 | 2023-11-09 | Tome Biosciences, Inc. | Guide rna compositions for programmable gene insertion |
WO2023225670A2 (en) | 2022-05-20 | 2023-11-23 | Tome Biosciences, Inc. | Ex vivo programmable gene insertion |
WO2024020587A2 (en) | 2022-07-22 | 2024-01-25 | Tome Biosciences, Inc. | Pleiopluripotent stem cell programmable gene insertion |
Family Cites Families (165)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4217344A (en) | 1976-06-23 | 1980-08-12 | L'oreal | Compositions containing aqueous dispersions of lipid spheres |
US4235871A (en) | 1978-02-24 | 1980-11-25 | Papahadjopoulos Demetrios P | Method of encapsulating biologically active materials in lipid vesicles |
US4186183A (en) | 1978-03-29 | 1980-01-29 | The United States Of America As Represented By The Secretary Of The Army | Liposome carriers in chemotherapy of leishmaniasis |
US4261975A (en) | 1979-09-19 | 1981-04-14 | Merck & Co., Inc. | Viral liposome particle |
US4485054A (en) | 1982-10-04 | 1984-11-27 | Lipoderm Pharmaceuticals Limited | Method of encapsulating biologically active materials in multilamellar lipid vesicles (MLV) |
US4501728A (en) | 1983-01-06 | 1985-02-26 | Technology Unlimited, Inc. | Masking of liposomes from RES recognition |
US5049386A (en) | 1985-01-07 | 1991-09-17 | Syntex (U.S.A.) Inc. | N-ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)Alk-1-YL-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
US4897355A (en) | 1985-01-07 | 1990-01-30 | Syntex (U.S.A.) Inc. | N[ω,(ω-1)-dialkyloxy]- and N-[ω,(ω-1)-dialkenyloxy]-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
US4946787A (en) | 1985-01-07 | 1990-08-07 | Syntex (U.S.A.) Inc. | N-(ω,(ω-1)-dialkyloxy)- and N-(ω,(ω-1)-dialkenyloxy)-alk-1-yl-N,N,N-tetrasubstituted ammonium lipids and uses therefor |
US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
US4774085A (en) | 1985-07-09 | 1988-09-27 | 501 Board of Regents, Univ. of Texas | Pharmaceutical administration systems containing a mixture of immunomodulators |
DE122007000007I2 (en) | 1986-04-09 | 2010-12-30 | Genzyme Corp | Genetically transformed animals secreting a desired protein in milk |
US4837028A (en) | 1986-12-24 | 1989-06-06 | Liposome Technology, Inc. | Liposomes with enhanced circulation time |
US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
US5143854A (en) | 1989-06-07 | 1992-09-01 | Affymax Technologies N.V. | Large scale photolithographic solid phase synthesis of polypeptides and receptor binding screening thereof |
US5264618A (en) | 1990-04-19 | 1993-11-23 | Vical, Inc. | Cationic lipids for intracellular delivery of biologically active molecules |
AU7979491A (en) | 1990-05-03 | 1991-11-27 | Vical, Inc. | Intracellular delivery of biologically active substances by means of self-assembling lipid complexes |
US5210015A (en) | 1990-08-06 | 1993-05-11 | Hoffman-La Roche Inc. | Homogeneous assay system using the nuclease activity of a nucleic acid polymerase |
US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
US7150982B2 (en) | 1991-09-09 | 2006-12-19 | Third Wave Technologies, Inc. | RNA detection assays |
US5587308A (en) | 1992-06-02 | 1996-12-24 | The United States Of America As Represented By The Department Of Health & Human Services | Modified adeno-associated virus vector capable of expression from a novel promoter |
US7745416B2 (en) | 1995-04-11 | 2010-06-29 | The Regents Of The University Of California | Method for in vivo regulation of cardiac muscle contractility |
WO1996039154A1 (en) | 1995-06-06 | 1996-12-12 | Isis Pharmaceuticals, Inc. | Oligonucleotides having phosphorothioate linkages of high chiral purity |
US5985662A (en) | 1995-07-13 | 1999-11-16 | Isis Pharmaceuticals Inc. | Antisense inhibition of hepatitis B virus replication |
US5622856A (en) | 1995-08-03 | 1997-04-22 | Avigen | High efficiency helper system for AAV vector production |
US5846946A (en) | 1996-06-14 | 1998-12-08 | Pasteur Merieux Serums Et Vaccins | Compositions and methods for administering Borrelia DNA |
US6251677B1 (en) | 1997-08-25 | 2001-06-26 | The Trustees Of The University Of Pennsylvania | Hybrid adenovirus-AAV virus and methods of use thereof |
ATE341621T1 (en) | 1997-10-24 | 2006-10-15 | Invitrogen Corp | RECOMBINATORY CLONING USING NUCLIC ACIDS HAVING RECOMBINATION SITE |
US6750059B1 (en) | 1998-07-16 | 2004-06-15 | Whatman, Inc. | Archiving of vectors |
US6534261B1 (en) | 1999-01-12 | 2003-03-18 | Sangamo Biosciences, Inc. | Regulation of endogenous gene expression in cells using zinc finger proteins |
US7868149B2 (en) | 1999-07-20 | 2011-01-11 | Monsanto Technology Llc | Plant genome sequence and uses thereof |
US6603061B1 (en) | 1999-07-29 | 2003-08-05 | Monsanto Company | Agrobacterium-mediated plant transformation method |
JP3454818B1 (en) | 2001-03-16 | 2003-10-06 | 直哉 小林 | Liver cell proliferation method, liver cell obtained by the method, and use thereof |
ES2404689T3 (en) | 2001-04-05 | 2013-05-28 | The Johns Hopkins University | Chimeric vaccines comprising the lumenal domain of LAMP-1 or LAMP-2 |
KR101021695B1 (en) | 2001-07-12 | 2011-03-15 | 유니버시티 오브 매사추세츠 | IN VIVO PRODUCTION OF SMALL INTERFERING RNAs THAT MEDIATE GENE SILENCING |
AU2002327430A1 (en) | 2001-08-08 | 2003-02-24 | Genzyme Corporation | Methods for treating diabetes and other blood sugar disorders |
WO2003016338A1 (en) | 2001-08-15 | 2003-02-27 | Parker Hughes Institute | Crystal structure of the btk kinase domain |
US7776321B2 (en) | 2001-09-26 | 2010-08-17 | Mayo Foundation For Medical Education And Research | Mutable vaccines |
US20090100536A1 (en) | 2001-12-04 | 2009-04-16 | Monsanto Company | Transgenic plants with enhanced agronomic traits |
WO2003087993A2 (en) | 2002-04-09 | 2003-10-23 | Beattie Kenneth L | Oligonucleotide probes for genosensor chips |
US20070020627A1 (en) | 2002-06-11 | 2007-01-25 | The Scripps Research Institute | Artificial transcription factors |
US20080226553A1 (en) | 2002-09-27 | 2008-09-18 | Cold Spring Harbor Laboratory | Cell-Based Rna Interference and Related Methods and Compositions |
AU2003290937A1 (en) | 2002-11-15 | 2004-06-15 | Trustees Of Boston University | Cis/trans riboregulators |
US20060178297A1 (en) | 2003-01-28 | 2006-08-10 | Troy Carol M | Systems and methods for silencing expression of a gene in a cell and uses thereof |
EP1644534A4 (en) | 2003-07-03 | 2006-08-09 | Univ California | Genome mapping of functional dna elements and cellular proteins |
DK2927318T3 (en) | 2003-08-08 | 2020-08-03 | Sangamo Therapeutics Inc | Method and compositions for targeted cleavage and recombination |
WO2005035718A2 (en) | 2003-10-03 | 2005-04-21 | Welgen, Inc. | Biderectional promoters for small rna expression |
FR2862659B1 (en) | 2003-11-21 | 2006-02-10 | Pasteur Institut | GENOME OF LEGIONELLA PNEUMOPHILA SOUCHE PARIS- DIAGNOSTIC AND EPIDEMIOLOGICAL APPLICATIONS |
US8053232B2 (en) | 2004-01-23 | 2011-11-08 | Virxsys Corporation | Correction of alpha-1-antitrypsin genetic defects using spliceosome mediated RNA trans splicing |
WO2005074511A2 (en) | 2004-01-27 | 2005-08-18 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and compositions for homozygous gene inactivation using collections of pre-defined nucleotide sequences complementary to chromosomal transcripts |
US20050220796A1 (en) | 2004-03-31 | 2005-10-06 | Dynan William S | Compositions and methods for modulating DNA repair |
FR2872170B1 (en) | 2004-06-25 | 2006-11-10 | Centre Nat Rech Scient Cnrse | NON-INTERACTIVE AND NON-REPLICATIVE LENTIVIRUS, PREPARATION AND USES |
EP2397490B1 (en) | 2004-07-16 | 2013-09-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES | Vaccine constructs and combinations of vaccines designed to improve the breadth of the immune response to diverse strains and clades of HIV |
WO2006116756A1 (en) | 2005-04-28 | 2006-11-02 | Benitec, Limited. | Multiple-rnai expression cassettes for simultaneous delivery of rnai agents related to heterozygotic expression patterns |
US7892224B2 (en) | 2005-06-01 | 2011-02-22 | Brainlab Ag | Inverse catheter planning |
SG10201508995QA (en) | 2005-07-26 | 2015-11-27 | Sangamo Biosciences Inc | Targeted integration and expression of exogenous nucleic acid sequences |
WO2007025097A2 (en) | 2005-08-26 | 2007-03-01 | Danisco A/S | Use |
US8362229B2 (en) * | 2006-02-08 | 2013-01-29 | Quark Pharmaceuticals, Inc. | Tandem siRNAS |
WO2007106690A2 (en) | 2006-03-15 | 2007-09-20 | Siemens Healthcare Diagnostics Inc. | Degenerate nucleobase analogs |
US7605251B2 (en) | 2006-05-11 | 2009-10-20 | Alnylam Pharmaceuticals, Inc. | Compositions and methods for inhibiting expression of the PCSK9 gene |
US8748567B2 (en) | 2006-05-22 | 2014-06-10 | Children's Medical Center Corporation | Method for delivery across the blood brain barrier |
WO2008093152A1 (en) | 2007-02-01 | 2008-08-07 | Cellectis | Obligate heterodimer meganucleases and uses thereof |
EP2126130B1 (en) | 2007-03-02 | 2015-03-25 | DuPont Nutrition Biosciences ApS | Cultures with improved phage resistance |
PE20090064A1 (en) | 2007-03-26 | 2009-03-02 | Novartis Ag | DOUBLE-CHAIN RIBONUCLEIC ACID TO INHIBIT THE EXPRESSION OF THE HUMAN E6AP GENE AND THE PHARMACEUTICAL COMPOSITION THAT INCLUDES IT |
CN101970051A (en) | 2007-12-31 | 2011-02-09 | 纳诺科尔治疗公司 | Rna interference for the treatment of heart failure |
WO2009105690A2 (en) | 2008-02-21 | 2009-08-27 | Targeted Genetics Corporation | Devices and methods for delivering polynucleotides into retinal cells of the macula and fovea |
US8546553B2 (en) | 2008-07-25 | 2013-10-01 | University Of Georgia Research Foundation, Inc. | Prokaryotic RNAi-like system and methods of use |
US20100076057A1 (en) | 2008-09-23 | 2010-03-25 | Northwestern University | TARGET DNA INTERFERENCE WITH crRNA |
US9404098B2 (en) | 2008-11-06 | 2016-08-02 | University Of Georgia Research Foundation, Inc. | Method for cleaving a target RNA using a Cas6 polypeptide |
WO2010053572A2 (en) | 2008-11-07 | 2010-05-14 | Massachusetts Institute Of Technology | Aminoalcohol lipidoids and uses thereof |
WO2010065123A1 (en) | 2008-12-04 | 2010-06-10 | Sangamo Biosciences, Inc. | Genome editing in rats using zinc-finger nucleases |
US20110016540A1 (en) | 2008-12-04 | 2011-01-20 | Sigma-Aldrich Co. | Genome editing of genes associated with trinucleotide repeat expansion disorders in animals |
NZ593618A (en) | 2008-12-10 | 2013-02-22 | Alnylam Pharmaceuticals Inc | Gnaq targeted dsrna compositions and methods for inhibiting expression |
WO2010075424A2 (en) | 2008-12-22 | 2010-07-01 | The Regents Of University Of California | Compositions and methods for downregulating prokaryotic genes |
EP2206723A1 (en) | 2009-01-12 | 2010-07-14 | Bonas, Ulla | Modular DNA-binding domains |
US20110239315A1 (en) | 2009-01-12 | 2011-09-29 | Ulla Bonas | Modular dna-binding domains and methods of use |
WO2011036510A1 (en) | 2009-09-24 | 2011-03-31 | Cellectis | Meganuclease variants cleaving the genome of the herpes simplex virus and uses thereof |
WO2010143917A2 (en) | 2009-06-11 | 2010-12-16 | Toolgen Incorporation | Targeted genomic rearrangements using site-specific nucleases |
AU2010275432A1 (en) | 2009-07-24 | 2012-02-02 | Sigma-Aldrich Co. Llc. | Method for genome editing |
US9234016B2 (en) | 2009-07-28 | 2016-01-12 | Sangamo Biosciences, Inc. | Engineered zinc finger proteins for treating trinucleotide repeat disorders |
WO2011028929A2 (en) | 2009-09-03 | 2011-03-10 | The Regents Of The University Of California | Nitrate-responsive promoter |
US8889394B2 (en) | 2009-09-07 | 2014-11-18 | Empire Technology Development Llc | Multiple domain proteins |
JP5944320B2 (en) | 2009-11-27 | 2016-07-05 | ビーエーエスエフ プラント サイエンス カンパニー ゲーエムベーハー | Optimized endonuclease and its use |
US8933046B2 (en) | 2009-12-23 | 2015-01-13 | Max-Planck-Gesellschaft Zur Foerderung Der Wissenschaften E.V. | Influenza targets |
JP2013518602A (en) * | 2010-02-09 | 2013-05-23 | サンガモ バイオサイエンシーズ, インコーポレイテッド | Targeted genome modification by partially single-stranded donor molecules |
US10087431B2 (en) | 2010-03-10 | 2018-10-02 | The Regents Of The University Of California | Methods of generating nucleic acid fragments |
US8927514B2 (en) | 2010-04-30 | 2015-01-06 | City Of Hope | Recombinant adeno-associated vectors for targeted treatment |
CN103038338B (en) | 2010-05-10 | 2017-03-08 | 加利福尼亚大学董事会 | Endoribonuclease compositionss and its using method |
EP3156062A1 (en) | 2010-05-17 | 2017-04-19 | Sangamo BioSciences, Inc. | Novel dna-binding proteins and uses thereof |
CN103168101A (en) * | 2010-07-23 | 2013-06-19 | 西格马-奥尔德里奇有限责任公司 | Genome editing using targeting endonucleases and single-stranded nucleic acids |
EP2601611B1 (en) | 2010-08-02 | 2020-12-09 | Integrated Dna Technologies, Inc. | Methods for predicting stability and melting temperatures of nucleic acid duplexes |
US9549901B2 (en) | 2010-09-03 | 2017-01-24 | The Brigham And Women's Hospital, Inc. | Lipid-polymer hybrid particles |
RU2608643C2 (en) | 2010-10-12 | 2017-01-23 | Дзе Чилдрен`З Хоспитал Оф Филадельфия | Methods and compositions for treating hemophilia b |
US9405700B2 (en) | 2010-11-04 | 2016-08-02 | Sonics, Inc. | Methods and apparatus for virtualization in an integrated circuit |
DK2699270T3 (en) | 2011-04-22 | 2017-10-02 | Univ California | ADENO-ASSOCIATED VIRUS VIRUSES WITH VARIANT CAPSID AND METHODS FOR USING IT |
MX351043B (en) | 2011-04-27 | 2017-09-29 | Amyris Inc | Methods for genomic modification. |
US20140113376A1 (en) | 2011-06-01 | 2014-04-24 | Rotem Sorek | Compositions and methods for downregulating prokaryotic genes |
US9394545B2 (en) | 2011-09-21 | 2016-07-19 | Sangamo Biosciences, Inc. | Methods and compositions for regulation of transgene expression |
JP2014530603A (en) | 2011-10-06 | 2014-11-20 | サンガモ バイオサイエンシーズ, インコーポレイテッド | Methods and compositions for controlling HIV infection |
EP2591770B1 (en) | 2011-11-14 | 2016-03-16 | Silenseed Ltd | Compositions for siRNA delivery and methods of manufacturing and using same |
WO2013071440A1 (en) | 2011-11-18 | 2013-05-23 | UNIVERSITé LAVAL | Methods and products for increasing frataxin levels and uses thereof |
WO2013078400A1 (en) | 2011-11-22 | 2013-05-30 | The Children's Hospital Of Philadelphia | Virus vectors for highly efficient transgene delivery |
US8450107B1 (en) | 2011-11-30 | 2013-05-28 | The Broad Institute Inc. | Nucleotide-specific recognition sequences for designer TAL effectors |
GB201122458D0 (en) | 2011-12-30 | 2012-02-08 | Univ Wageningen | Modified cascade ribonucleoproteins and uses thereof |
CN108285491B (en) | 2012-02-29 | 2021-08-10 | 桑格摩生物科学股份有限公司 | Methods and compositions for treating huntington's disease |
US9637739B2 (en) * | 2012-03-20 | 2017-05-02 | Vilnius University | RNA-directed DNA cleavage by the Cas9-crRNA complex |
WO2013141680A1 (en) | 2012-03-20 | 2013-09-26 | Vilnius University | RNA-DIRECTED DNA CLEAVAGE BY THE Cas9-crRNA COMPLEX |
AU2013204327B2 (en) | 2012-04-20 | 2016-09-01 | Aviagen | Cell transfection method |
ES2728782T3 (en) * | 2012-05-25 | 2019-10-28 | Univ California | Methods and compositions for RNA-directed target DNA modification and for RNA-directed transcription modulation |
CA2874828A1 (en) | 2012-06-01 | 2013-12-05 | Drexel University | Modulation of hepatitis b virus cccdna transcription |
EP3763810A3 (en) | 2012-10-10 | 2021-07-14 | Sangamo Therapeutics, Inc. | T cell modifying compounds and uses thereof |
CN116064532A (en) | 2012-10-23 | 2023-05-05 | 基因工具股份有限公司 | Composition for cleaving target DNA and use thereof |
KR102243092B1 (en) | 2012-12-06 | 2021-04-22 | 시그마-알드리치 컴퍼니., 엘엘씨 | Crispr-based genome modification and regulation |
WO2014093479A1 (en) | 2012-12-11 | 2014-06-19 | Montana State University | Crispr (clustered regularly interspaced short palindromic repeats) rna-guided control of gene regulation |
US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
EP4286404A3 (en) | 2012-12-12 | 2024-02-14 | The Broad Institute Inc. | Crispr-cas component systems, methods and compositions for sequence manipulation |
US20140310830A1 (en) | 2012-12-12 | 2014-10-16 | Feng Zhang | CRISPR-Cas Nickase Systems, Methods And Compositions For Sequence Manipulation in Eukaryotes |
EP3064585B1 (en) | 2012-12-12 | 2020-02-05 | The Broad Institute, Inc. | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
EP2931892B1 (en) | 2012-12-12 | 2018-09-12 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
DK3327127T3 (en) | 2012-12-12 | 2021-06-28 | Broad Inst Inc | PERFORMANCE, MODIFICATION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION AND THERAPEUTIC APPLICATIONS |
AU2013359212B2 (en) | 2012-12-12 | 2017-01-19 | Massachusetts Institute Of Technology | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation |
EP2931899A1 (en) | 2012-12-12 | 2015-10-21 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof |
IL307735A (en) | 2012-12-12 | 2023-12-01 | Broad Inst Inc | Engineering of systems, methods and optimized guide compositions for sequence manipulation |
ES2576128T3 (en) | 2012-12-12 | 2016-07-05 | The Broad Institute, Inc. | Modification by genetic technology and optimization of systems, methods and compositions for the manipulation of sequences with functional domains |
IL308158A (en) | 2012-12-17 | 2023-12-01 | Harvard College | Rna-guided human genome engineering |
AU2014207618A1 (en) | 2013-01-16 | 2015-08-06 | Emory University | Cas9-nucleic acid complexes and uses related thereto |
US10660943B2 (en) | 2013-02-07 | 2020-05-26 | The Rockefeller University | Sequence specific antimicrobials |
US9163837B2 (en) | 2013-02-27 | 2015-10-20 | Siemens Aktiengesellschaft | Flow conditioner in a combustor of a gas turbine engine |
CN105980575A (en) | 2013-03-14 | 2016-09-28 | 卡里布生物科学公司 | Compositions and methods of nucleic acid-targeting nucleic acids |
JP6980380B2 (en) | 2013-03-15 | 2021-12-15 | ザ ジェネラル ホスピタル コーポレイション | Increased specificity of RNA-induced genome editing with shortened guide RNA (tru-gRNA) |
PL2979143T3 (en) | 2013-03-27 | 2018-02-28 | Wilco Ag | Method of inline inspecting and/or testing devices and apparatus to perform such method |
US11274305B2 (en) | 2013-04-04 | 2022-03-15 | Trustees Of Dartmouth College | Compositions and methods for in vivo excision of HIV-1 proviral DNA |
CN105683376A (en) | 2013-05-15 | 2016-06-15 | 桑格摩生物科学股份有限公司 | Methods and compositions for treatment of a genetic condition |
JP7065564B2 (en) | 2013-05-29 | 2022-05-12 | セレクティス | Methods for Providing Accurate DNA Cleavage Using CAS9 Nickase Activity |
MX2015016798A (en) | 2013-06-04 | 2016-10-26 | Harvard College | Rna-guideded transcriptional regulation. |
US9267135B2 (en) | 2013-06-04 | 2016-02-23 | President And Fellows Of Harvard College | RNA-guided transcriptional regulation |
AU2014274840B2 (en) | 2013-06-05 | 2020-03-12 | Duke University | RNA-guided gene editing and gene regulation |
BR112015031611A2 (en) | 2013-06-17 | 2017-12-12 | Massachusetts Inst Technology | application, manipulation and optimization of systems, methods and compositions for targeting and modeling post-mitotic cell diseases and disorders |
CA2915834A1 (en) | 2013-06-17 | 2014-12-24 | Massachusetts Institute Of Technology | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
EP3011033B1 (en) | 2013-06-17 | 2020-02-19 | The Broad Institute, Inc. | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof |
EP4245853A3 (en) | 2013-06-17 | 2023-10-18 | The Broad Institute, Inc. | Optimized crispr-cas double nickase systems, methods and compositions for sequence manipulation |
DK3011031T3 (en) | 2013-06-17 | 2020-12-21 | Broad Inst Inc | PERFORMANCE AND APPLICATION OF CRISPR-CAS SYSTEMS, VECTORS AND COMPOSITIONS FOR LIVER TARGET DIRECTION AND THERAPY |
WO2014204729A1 (en) | 2013-06-17 | 2014-12-24 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using viral components |
DK3019619T3 (en) | 2013-07-11 | 2021-10-11 | Modernatx Inc | COMPOSITIONS INCLUDING SYNTHETIC POLYNUCLEOTIDES CODING CRISPR-RELATED PROTEINS, SYNTHETIC SGRNAs, AND USES OF USE |
CN103388006B (en) * | 2013-07-26 | 2015-10-28 | 华东师范大学 | A kind of construction process of site-directed point mutation |
CN106102781A (en) | 2013-08-29 | 2016-11-09 | 英联邦高等教育系统天普大学 | Methods and compositions for rna-guided treatment of hiv infection |
US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
US9737604B2 (en) | 2013-09-06 | 2017-08-22 | President And Fellows Of Harvard College | Use of cationic lipids to deliver CAS9 |
US20160237455A1 (en) | 2013-09-27 | 2016-08-18 | Editas Medicine, Inc. | Crispr-related methods and compositions |
WO2015065964A1 (en) | 2013-10-28 | 2015-05-07 | The Broad Institute Inc. | Functional genomics using crispr-cas systems, compositions, methods, screens and applications thereof |
PT3066201T (en) | 2013-11-07 | 2018-06-04 | Massachusetts Inst Technology | Crispr-related methods and compositions with governing grnas |
CA2930877A1 (en) | 2013-11-18 | 2015-05-21 | Crispr Therapeutics Ag | Crispr-cas system materials and methods |
WO2015089419A2 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for targeting disorders and diseases using particle delivery components |
WO2015089351A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Compositions and methods of use of crispr-cas systems in nucleotide repeat disorders |
WO2015089364A1 (en) | 2013-12-12 | 2015-06-18 | The Broad Institute Inc. | Crystal structure of a crispr-cas system, and uses thereof |
EP3080260B1 (en) | 2013-12-12 | 2019-03-06 | The Broad Institute, Inc. | Crispr-cas systems and methods for altering expression of gene products, structural information and inducible modular cas enzymes |
CN103668472B (en) | 2013-12-31 | 2014-12-24 | 北京大学 | Method for constructing eukaryon gene knockout library by using CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats)/Cas9 system |
US10354746B2 (en) | 2014-01-27 | 2019-07-16 | Georgia Tech Research Corporation | Methods and systems for identifying CRISPR/Cas off-target sites |
JP6323228B2 (en) | 2014-07-18 | 2018-05-16 | 富士電機株式会社 | Power converter |
US9932566B2 (en) | 2014-08-07 | 2018-04-03 | Agilent Technologies, Inc. | CIS-blocked guide RNA |
EP3686279B1 (en) | 2014-08-17 | 2023-01-04 | The Broad Institute, Inc. | Genome editing using cas9 nickases |
WO2016141224A1 (en) | 2015-03-03 | 2016-09-09 | The General Hospital Corporation | Engineered crispr-cas9 nucleases with altered pam specificity |
TWI813532B (en) | 2015-06-18 | 2023-09-01 | 美商博得學院股份有限公司 | Crispr enzyme mutations reducing off-target effects |
US9512446B1 (en) | 2015-08-28 | 2016-12-06 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
JP6186470B2 (en) | 2016-04-20 | 2017-08-23 | パイオニア株式会社 | Acoustic device, volume control method, volume control program, and recording medium |
-
2014
- 2014-06-10 CA CA2915834A patent/CA2915834A1/en not_active Abandoned
- 2014-06-10 CN CN201480045695.3A patent/CN106062197A/en active Pending
- 2014-06-10 EP EP14734708.2A patent/EP3011029B1/en active Active
- 2014-06-10 EP EP19212058.2A patent/EP3674411A1/en active Pending
- 2014-06-10 AU AU2014281026A patent/AU2014281026B2/en active Active
- 2014-06-10 DK DK14734708.2T patent/DK3011029T3/en active
- 2014-06-10 JP JP2016521449A patent/JP6625971B2/en active Active
- 2014-06-10 KR KR1020167001305A patent/KR20160044457A/en not_active Application Discontinuation
- 2014-06-10 ES ES14734708T patent/ES2777217T3/en active Active
- 2014-06-10 WO PCT/US2014/041800 patent/WO2014204724A1/en active Application Filing
-
2015
- 2015-12-17 US US14/972,927 patent/US11008588B2/en active Active
-
2016
- 2016-10-11 HK HK16111709.1A patent/HK1223646A1/en unknown
-
2019
- 2019-11-28 JP JP2019215361A patent/JP2020054354A/en active Pending
-
2021
- 2021-05-17 US US17/321,872 patent/US20210292794A1/en active Pending
Non-Patent Citations (16)
Title |
---|
BLAKE WIEDENHEFT ET AL: "RNA-guided genetic silencing systems in bacteria and archaea", NATURE, vol. 482, no. 7385, 15 February 2012 (2012-02-15), pages 331 - 338, XP055116249, ISSN: 0028-0836, DOI: 10.1038/nature10886 * |
ELITZA DELTCHEVA ET AL: "CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III", NATURE, vol. 471, no. 7340, 31 March 2011 (2011-03-31), pages 602 - 607, XP055068535, ISSN: 0028-0836, DOI: 10.1038/nature09886 * |
G. GASIUNAS ET AL: "PNAS Plus: Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 109, no. 39, 25 September 2012 (2012-09-25), pages E2579 - E2586, XP055068588, ISSN: 0027-8424, DOI: 10.1073/pnas.1208507109 * |
GAJ THOMAS ET AL: "ZFN, TALEN, and CRISPR/Cas-based methods for genome engineering", TRENDS IN BIOTECHNOLOGY, vol. 31, no. 7, 1 July 2013 (2013-07-01), pages 397 - 405, XP028571313, ISSN: 0167-7799, DOI: 10.1016/J.TIBTECH.2013.04.004 * |
HSU PATRICK D ET AL: "Development and Applications of CRISPR-Cas9 for Genome Engineering", CELL, vol. 157, no. 6, 5 June 2014 (2014-06-05), pages 1262 - 1278, XP028849523, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2014.05.010 * |
JIANG WENYAN ET AL: "RNA-guided editing of bacterial genomes using CRISPR-Cas systems", NATURE BIOTECHNOLOGY,, vol. 31, no. 3, 29 January 2013 (2013-01-29), pages 233 - 239, XP002699849 * |
KRZYSZTOF CHYLINSKI ET AL: "The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems", RNA BIOLOGY, vol. 10, no. 5, 1 May 2013 (2013-05-01), pages 726 - 737, XP055116068, ISSN: 1547-6286, DOI: 10.4161/rna.24321 * |
L. CONG ET AL: "Multiplex Genome Engineering Using CRISPR/Cas Systems", SCIENCE, vol. 339, no. 6121, 15 February 2013 (2013-02-15), pages 819 - 823, XP055102030, ISSN: 0036-8075, DOI: 10.1126/science.1231143 * |
L. CONG ET AL: "Supplementary Material to : Multiplex Genome Engineering Using CRISPR/Cas Systems", SCIENCE, vol. 339, no. 6121, 3 January 2013 (2013-01-03), pages 819 - 823, ISSN: 0036-8075, DOI: 10.1126/science.1231143 * |
LUKE A. GILBERT ET AL: "CRISPR-Mediated Modular RNA-Guided Regulation of Transcription in Eukaryotes", CELL, vol. 154, no. 2, 1 July 2013 (2013-07-01), pages 442 - 451, XP055115843, ISSN: 0092-8674, DOI: 10.1016/j.cell.2013.06.044 * |
M. JINEK ET AL: "A Programmable Dual-RNA-Guided DNA Endonuclease in Adaptive Bacterial Immunity (Supplementary Material)", SCIENCE, vol. 337, no. 6096, 28 June 2012 (2012-06-28), pages 816 - 821, XP055067747, ISSN: 0036-8075, DOI: 10.1126/science.1225829 * |
M. JINEK ET AL: "A Programmable Dual-RNA-Guided DNA Endonuclease in Adaptive Bacterial Immunity", SCIENCE, vol. 337, no. 6096, 17 August 2012 (2012-08-17), pages 816 - 821, XP055067740, ISSN: 0036-8075, DOI: 10.1126/science.1225829 * |
MICHAEL P TERNS ET AL: "CRISPR-based adaptive immune systems", CURRENT OPINION IN MICROBIOLOGY, vol. 14, no. 3, 1 June 2011 (2011-06-01), pages 321 - 327, XP055097823, ISSN: 1369-5274, DOI: 10.1016/j.mib.2011.03.005 * |
S. J. J. BROUNS: "A Swiss Army Knife of Immunity", SCIENCE, vol. 337, no. 6096, 17 August 2012 (2012-08-17), pages 808 - 809, XP055113718, ISSN: 0036-8075, DOI: 10.1126/science.1227253 * |
WANG HAOYI ET AL: "One-Step Generation of Mice Carrying Mutations in Multiple Genes by CRISPR/Cas-Mediated Genome Engineering", CELL, vol. 153, no. 4, 9 May 2013 (2013-05-09), pages 910 - 918, XP028538358, ISSN: 0092-8674, DOI: 10.1016/J.CELL.2013.04.025 * |
WOONG Y HWANG ET AL: "Efficient genome editing in zebrafish using a CRISPR-Cas system", NATURE BIOTECHNOLOGY, vol. 31, no. 3, 29 January 2013 (2013-01-29), pages 227 - 229, XP055086625, ISSN: 1087-0156, DOI: 10.1038/nbt.2501 * |
Cited By (315)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US9322006B2 (en) | 2011-07-22 | 2016-04-26 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
US9840713B2 (en) | 2012-12-12 | 2017-12-12 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
US9822372B2 (en) | 2012-12-12 | 2017-11-21 | The Broad Institute Inc. | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
US11041173B2 (en) | 2012-12-12 | 2021-06-22 | The Broad Institute, Inc. | Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications |
US10930367B2 (en) | 2012-12-12 | 2021-02-23 | The Broad Institute, Inc. | Methods, models, systems, and apparatus for identifying target sequences for Cas enzymes or CRISPR-Cas systems for target sequences and conveying results thereof |
US11168338B2 (en) | 2013-03-15 | 2021-11-09 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
US10844403B2 (en) * | 2013-03-15 | 2020-11-24 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
US10138476B2 (en) | 2013-03-15 | 2018-11-27 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
US11634731B2 (en) | 2013-03-15 | 2023-04-25 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
US11098326B2 (en) | 2013-03-15 | 2021-08-24 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
US10378027B2 (en) | 2013-03-15 | 2019-08-13 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
US10415059B2 (en) | 2013-03-15 | 2019-09-17 | The General Hospital Corporation | Using truncated guide RNAs (tru-gRNAs) to increase specificity for RNA-guided genome editing |
US11920152B2 (en) | 2013-03-15 | 2024-03-05 | The General Hospital Corporation | Increasing specificity for RNA-guided genome editing |
US10760064B2 (en) | 2013-03-15 | 2020-09-01 | The General Hospital Corporation | RNA-guided targeting of genetic and epigenomic regulatory proteins to specific genomic loci |
US10544433B2 (en) | 2013-03-15 | 2020-01-28 | The General Hospital Corporation | Using RNA-guided FokI nucleases (RFNs) to increase specificity for RNA-guided genome editing |
US10385359B2 (en) | 2013-04-16 | 2019-08-20 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
US10975390B2 (en) | 2013-04-16 | 2021-04-13 | Regeneron Pharmaceuticals, Inc. | Targeted modification of rat genome |
US11008588B2 (en) | 2013-06-17 | 2021-05-18 | The Broad Institute, Inc. | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation |
US11597949B2 (en) | 2013-06-17 | 2023-03-07 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
US10781444B2 (en) | 2013-06-17 | 2020-09-22 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
US10577630B2 (en) | 2013-06-17 | 2020-03-03 | The Broad Institute, Inc. | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy |
US10711285B2 (en) | 2013-06-17 | 2020-07-14 | The Broad Institute, Inc. | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation |
US10946108B2 (en) | 2013-06-17 | 2021-03-16 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for targeting disorders and diseases using viral components |
US10954548B2 (en) | 2013-08-09 | 2021-03-23 | President And Fellows Of Harvard College | Nuclease profiling system |
US10508298B2 (en) | 2013-08-09 | 2019-12-17 | President And Fellows Of Harvard College | Methods for identifying a target site of a CAS9 nuclease |
US11920181B2 (en) | 2013-08-09 | 2024-03-05 | President And Fellows Of Harvard College | Nuclease profiling system |
US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
US11046948B2 (en) | 2013-08-22 | 2021-06-29 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
US10227581B2 (en) | 2013-08-22 | 2019-03-12 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
US10858639B2 (en) | 2013-09-06 | 2020-12-08 | President And Fellows Of Harvard College | CAS9 variants and uses thereof |
US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
US9526784B2 (en) | 2013-09-06 | 2016-12-27 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
US9228207B2 (en) | 2013-09-06 | 2016-01-05 | President And Fellows Of Harvard College | Switchable gRNAs comprising aptamers |
US9999671B2 (en) | 2013-09-06 | 2018-06-19 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
US9340799B2 (en) | 2013-09-06 | 2016-05-17 | President And Fellows Of Harvard College | MRNA-sensing switchable gRNAs |
US9340800B2 (en) | 2013-09-06 | 2016-05-17 | President And Fellows Of Harvard College | Extended DNA-sensing GRNAS |
US10682410B2 (en) | 2013-09-06 | 2020-06-16 | President And Fellows Of Harvard College | Delivery system for functional nucleases |
US9737604B2 (en) | 2013-09-06 | 2017-08-22 | President And Fellows Of Harvard College | Use of cationic lipids to deliver CAS9 |
US10912833B2 (en) | 2013-09-06 | 2021-02-09 | President And Fellows Of Harvard College | Delivery of negatively charged proteins using cationic lipids |
US10597679B2 (en) | 2013-09-06 | 2020-03-24 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
US11299755B2 (en) | 2013-09-06 | 2022-04-12 | President And Fellows Of Harvard College | Switchable CAS9 nucleases and uses thereof |
US9388430B2 (en) | 2013-09-06 | 2016-07-12 | President And Fellows Of Harvard College | Cas9-recombinase fusion proteins and uses thereof |
US11920128B2 (en) | 2013-09-18 | 2024-03-05 | Kymab Limited | Methods, cells and organisms |
US11149267B2 (en) | 2013-10-28 | 2021-10-19 | The Broad Institute, Inc. | Functional genomics using CRISPR-Cas systems, compositions, methods, screens and applications thereof |
US10640788B2 (en) | 2013-11-07 | 2020-05-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAs |
US11390887B2 (en) | 2013-11-07 | 2022-07-19 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
US10190137B2 (en) | 2013-11-07 | 2019-01-29 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
US9834791B2 (en) | 2013-11-07 | 2017-12-05 | Editas Medicine, Inc. | CRISPR-related methods and compositions with governing gRNAS |
US11820997B2 (en) | 2013-12-11 | 2023-11-21 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a genome |
US10711280B2 (en) | 2013-12-11 | 2020-07-14 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a mouse ES cell genome |
US9546384B2 (en) | 2013-12-11 | 2017-01-17 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a mouse genome |
US10208317B2 (en) | 2013-12-11 | 2019-02-19 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for the targeted modification of a mouse embryonic stem cell genome |
US9068179B1 (en) | 2013-12-12 | 2015-06-30 | President And Fellows Of Harvard College | Methods for correcting presenilin point mutations |
US10465176B2 (en) | 2013-12-12 | 2019-11-05 | President And Fellows Of Harvard College | Cas variants for gene editing |
US11597919B2 (en) | 2013-12-12 | 2023-03-07 | The Broad Institute Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
JP2017504312A (en) * | 2013-12-12 | 2017-02-09 | ザ・ブロード・インスティテュート・インコーポレイテッド | Delivery, use and therapeutic application of CRISPR-Cas systems and compositions for genome editing |
US11053481B2 (en) | 2013-12-12 | 2021-07-06 | President And Fellows Of Harvard College | Fusions of Cas9 domains and nucleic acid-editing domains |
US11124782B2 (en) | 2013-12-12 | 2021-09-21 | President And Fellows Of Harvard College | Cas variants for gene editing |
US11407985B2 (en) | 2013-12-12 | 2022-08-09 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-Cas systems and compositions for genome editing |
US9840699B2 (en) | 2013-12-12 | 2017-12-12 | President And Fellows Of Harvard College | Methods for nucleic acid editing |
US11155795B2 (en) | 2013-12-12 | 2021-10-26 | The Broad Institute, Inc. | CRISPR-Cas systems, crystal structure and uses thereof |
US10550372B2 (en) | 2013-12-12 | 2020-02-04 | The Broad Institute, Inc. | Systems, methods and compositions for sequence manipulation with optimized functional CRISPR-Cas systems |
US10851357B2 (en) | 2013-12-12 | 2020-12-01 | The Broad Institute, Inc. | Compositions and methods of use of CRISPR-Cas systems in nucleotide repeat disorders |
EP3514246A1 (en) | 2014-02-27 | 2019-07-24 | The Broad Institute Inc. | T cell balance gene expression and methods of use thereof |
US11209440B2 (en) | 2014-02-27 | 2021-12-28 | The Broad Institute, Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
US10704062B2 (en) | 2014-07-30 | 2020-07-07 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
US11578343B2 (en) | 2014-07-30 | 2023-02-14 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
WO2016028682A1 (en) * | 2014-08-17 | 2016-02-25 | The Broad Institute Inc. | Genome editing using cas9 nickases |
EP3686279A1 (en) | 2014-08-17 | 2020-07-29 | The Broad Institute, Inc. | Genome editing using cas9 nickases |
US11197467B2 (en) | 2014-09-24 | 2021-12-14 | The Broad Institute, Inc. | Delivery, use and therapeutic applications of the CRISPR-cas systems and compositions for modeling mutations in leukocytes |
WO2016049163A2 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Use and production of chd8+/- transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
WO2016049251A1 (en) | 2014-09-24 | 2016-03-31 | The Broad Institute Inc. | Delivery, use and therapeutic applications of the crispr-cas systems and compositions for modeling mutations in leukocytes |
US11459557B2 (en) | 2014-09-24 | 2022-10-04 | The Broad Institute, Inc. | Use and production of CHD8+/− transgenic animals with behavioral phenotypes characteristic of autism spectrum disorder |
US11001829B2 (en) | 2014-09-25 | 2021-05-11 | The Broad Institute, Inc. | Functional screening with optimized functional CRISPR-Cas systems |
WO2016069591A2 (en) | 2014-10-27 | 2016-05-06 | The Broad Institute Inc. | Compositions, methods and use of synthetic lethal screening |
US10725041B2 (en) * | 2014-11-04 | 2020-07-28 | Versiti Blood Research Institute Foundation, Inc. | Method to bioengineer designer platelets using gene editing and stem cell methodologies |
US20160139124A1 (en) * | 2014-11-04 | 2016-05-19 | Bloodcenter Research Foundaton | Method to bioengineer designer platelets using gene editing and stem cell methodologies |
US11680268B2 (en) | 2014-11-07 | 2023-06-20 | Editas Medicine, Inc. | Methods for improving CRISPR/Cas-mediated genome-editing |
US10457960B2 (en) | 2014-11-21 | 2019-10-29 | Regeneron Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification using paired guide RNAs |
US11697828B2 (en) | 2014-11-21 | 2023-07-11 | Regeneran Pharmaceuticals, Inc. | Methods and compositions for targeted genetic modification using paired guide RNAs |
EP3626832A2 (en) | 2014-11-25 | 2020-03-25 | The Brigham and Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
WO2016086197A1 (en) | 2014-11-25 | 2016-06-02 | The Brigham And Women's Hospital, Inc. | Method of identifying and treating a person having a predisposition to or afflicted with a cardiometabolic disease |
EP3889260A1 (en) | 2014-12-12 | 2021-10-06 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
WO2016094874A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Escorted and functionalized guides for crispr-cas systems |
WO2016094872A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Dead guides for crispr transcription factors |
EP3985115A1 (en) | 2014-12-12 | 2022-04-20 | The Broad Institute, Inc. | Protected guide rnas (pgrnas) |
WO2016094880A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Delivery, use and therapeutic applications of crispr systems and compositions for genome editing as to hematopoietic stem cells (hscs) |
WO2016094867A1 (en) | 2014-12-12 | 2016-06-16 | The Broad Institute Inc. | Protected guide rnas (pgrnas) |
US11624078B2 (en) | 2014-12-12 | 2023-04-11 | The Broad Institute, Inc. | Protected guide RNAS (pgRNAS) |
US10696986B2 (en) | 2014-12-12 | 2020-06-30 | The Board Institute, Inc. | Protected guide RNAS (PGRNAS) |
WO2016100974A1 (en) | 2014-12-19 | 2016-06-23 | The Broad Institute Inc. | Unbiased identification of double-strand breaks and genomic rearrangement by genome-wide insert capture sequencing |
WO2016106236A1 (en) | 2014-12-23 | 2016-06-30 | The Broad Institute Inc. | Rna-targeting system |
WO2016106244A1 (en) | 2014-12-24 | 2016-06-30 | The Broad Institute Inc. | Crispr having or associated with destabilization domains |
EP3702456A1 (en) | 2014-12-24 | 2020-09-02 | The Broad Institute, Inc. | Crispr having or associated with destabilization domains |
WO2016108926A1 (en) | 2014-12-30 | 2016-07-07 | The Broad Institute Inc. | Crispr mediated in vivo modeling and genetic screening of tumor growth and metastasis |
JP2018500037A (en) * | 2014-12-31 | 2018-01-11 | シンセティック ジェノミクス インコーポレーテッド | Compositions and methods for highly efficient in vivo genome editing |
JP7046139B2 (en) | 2014-12-31 | 2022-04-01 | シンセティック ジェノミクス インコーポレーテッド | Compositions and Methods for Efficient In Vivo Genome Editing |
US11339399B2 (en) | 2014-12-31 | 2022-05-24 | Viridos, Inc. | Compositions and methods for high efficiency in vivo genome editing |
JP2021036866A (en) * | 2014-12-31 | 2021-03-11 | シンセティック ジェノミクス インコーポレーテッド | Composition and method for high efficiency in vivo genome editing |
US10988781B2 (en) | 2015-01-28 | 2021-04-27 | Caribou Biosciences, Inc. | Method of target cleaving using CRISPR hybrid DNA/RNA polynucleotides |
JP2018503386A (en) * | 2015-01-28 | 2018-02-08 | パイオニア ハイ−ブレッド インターナショナル, インコーポレイテッド | CRISPR hybrid DNA / RNA polynucleotides and methods of use |
US10519468B2 (en) | 2015-01-28 | 2019-12-31 | Pioneer Hi-Bred International, Inc. | Cells containing CRISPR hybrid DNA/RNA polynucleotides |
JP2019162140A (en) * | 2015-01-28 | 2019-09-26 | パイオニア ハイ−ブレッド インターナショナル, インコーポレイテッド | Crispr hybrid dna/rna polynucleotides and methods of use |
US11236364B2 (en) | 2015-01-28 | 2022-02-01 | Caribou Biosciences, Inc. | CRISPR hybrid DNA/RNA polynucleotides and methods of use |
US11459588B2 (en) | 2015-01-28 | 2022-10-04 | Caribou Biosciences, Inc. | Methods of use of CRISPR CPF1 hybrid DNA/RNA polynucleotides |
WO2016130697A1 (en) * | 2015-02-11 | 2016-08-18 | Memorial Sloan Kettering Cancer Center | Methods and kits for generating vectors that co-express multiple target molecules |
US11427869B2 (en) | 2015-02-26 | 2022-08-30 | The Broad Institute, Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
WO2016138488A2 (en) | 2015-02-26 | 2016-09-01 | The Broad Institute Inc. | T cell balance gene expression, compositions of matters and methods of use thereof |
US11220678B2 (en) | 2015-03-03 | 2022-01-11 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
US11859220B2 (en) | 2015-03-03 | 2024-01-02 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
CN107532161A (en) * | 2015-03-03 | 2018-01-02 | 通用医疗公司 | The specific engineering CRISPR Cas9 nucleases of PAM with change |
US11306309B2 (en) | 2015-04-06 | 2022-04-19 | The Board Of Trustees Of The Leland Stanford Junior University | Chemically modified guide RNAs for CRISPR/CAS-mediated gene regulation |
US11053482B2 (en) | 2015-04-16 | 2021-07-06 | Wageningen Universiteit | Vector systems for nuclease-mediated genome editing |
US11760985B2 (en) | 2015-04-16 | 2023-09-19 | Wageningen Universiteit | CRISPR-Cas complex |
US11479761B2 (en) | 2015-04-16 | 2022-10-25 | Wageningen Universiteit | Nuclease-mediated genome editing |
WO2016182893A1 (en) | 2015-05-08 | 2016-11-17 | Teh Broad Institute Inc. | Functional genomics using crispr-cas systems for saturating mutagenesis of non-coding elements, compositions, methods, libraries and applications thereof |
US11390884B2 (en) | 2015-05-11 | 2022-07-19 | Editas Medicine, Inc. | Optimized CRISPR/cas9 systems and methods for gene editing in stem cells |
IL255654B2 (en) * | 2015-05-16 | 2023-02-01 | Genzyme Corp | Gene editing of deep intronic mutations |
IL255654B (en) * | 2015-05-16 | 2022-10-01 | Genzyme Corp | Gene editing of deep intronic mutations |
WO2016186772A3 (en) * | 2015-05-16 | 2017-01-05 | Genzyme Corporation | Gene editing of deep intronic mutations |
JP2018516978A (en) * | 2015-05-16 | 2018-06-28 | ジェンザイム・コーポレーション | Gene editing of deep intron mutations |
US11896651B2 (en) | 2015-05-16 | 2024-02-13 | Genzyme Corporation | Gene editing of deep intronic mutations |
US11911415B2 (en) | 2015-06-09 | 2024-02-27 | Editas Medicine, Inc. | CRISPR/Cas-related methods and compositions for improving transplantation |
US11643669B2 (en) | 2015-06-17 | 2023-05-09 | Massachusetts Institute Of Technology | CRISPR mediated recording of cellular events |
WO2016205728A1 (en) | 2015-06-17 | 2016-12-22 | Massachusetts Institute Of Technology | Crispr mediated recording of cellular events |
EP3666895A1 (en) | 2015-06-18 | 2020-06-17 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
US11421250B2 (en) | 2015-06-18 | 2022-08-23 | The Broad Institute, Inc. | CRISPR enzymes and systems |
US11091798B2 (en) | 2015-06-18 | 2021-08-17 | The Broad Institute, Inc. | CRISPR enzymes and systems |
EP4159856A1 (en) | 2015-06-18 | 2023-04-05 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
WO2016205749A1 (en) * | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
US10876100B2 (en) | 2015-06-18 | 2020-12-29 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
WO2016205764A1 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Novel crispr enzymes and systems |
US11060115B2 (en) | 2015-06-18 | 2021-07-13 | The Broad Institute, Inc. | CRISPR enzymes and systems |
RU2777988C2 (en) * | 2015-06-18 | 2022-08-12 | Дзе Брод Инститьют Инк. | New enzymes and crispr systems |
US10648020B2 (en) | 2015-06-18 | 2020-05-12 | The Broad Institute, Inc. | CRISPR enzymes and systems |
US20180127745A1 (en) * | 2015-06-18 | 2018-05-10 | The Broad Institute Inc. | Cell sorting |
US10669540B2 (en) | 2015-06-18 | 2020-06-02 | The Board Institute, Inc. | CRISPR enzymes and systems |
US11781172B2 (en) | 2015-06-18 | 2023-10-10 | The Broad Institute, Inc. | Crispr enzymes and systems |
RU2771826C9 (en) * | 2015-06-18 | 2022-08-03 | Дзе Брод Инститьют Инк. | Novel crispr enzymes and systems |
US11180751B2 (en) | 2015-06-18 | 2021-11-23 | The Broad Institute, Inc. | CRISPR enzymes and systems |
US11634755B2 (en) | 2015-06-18 | 2023-04-25 | The Broad Institute, Inc. | Crispr enzymes and systems |
RU2777988C9 (en) * | 2015-06-18 | 2022-09-28 | Дзе Брод Инститьют Инк. | Novel crispr enzymes and systems |
US11773432B2 (en) | 2015-06-18 | 2023-10-03 | The Broad Institute Inc. | CRISPR enzymes and systems |
RU2771826C2 (en) * | 2015-06-18 | 2022-05-12 | Дзе Брод Инститьют Инк. | New crispr enzymes and systems |
US11236327B2 (en) | 2015-06-18 | 2022-02-01 | The Broad Institute, Inc. | Cell sorting |
US11773412B2 (en) | 2015-06-18 | 2023-10-03 | The Broad Institute, Inc. | Crispr enzymes and systems |
US10494621B2 (en) | 2015-06-18 | 2019-12-03 | The Broad Institute, Inc. | Crispr enzyme mutations reducing off-target effects |
US11578312B2 (en) | 2015-06-18 | 2023-02-14 | The Broad Institute Inc. | Engineering and optimization of systems, methods, enzymes and guide scaffolds of CAS9 orthologs and variants for sequence manipulation |
WO2016205745A2 (en) | 2015-06-18 | 2016-12-22 | The Broad Institute Inc. | Cell sorting |
US11414657B2 (en) | 2015-06-29 | 2022-08-16 | Ionis Pharmaceuticals, Inc. | Modified CRISPR RNA and modified single CRISPR RNA and uses thereof |
US20180230450A1 (en) * | 2015-08-03 | 2018-08-16 | President And Fellows Of Harvard College | Cas9 Genome Editing and Transcriptional Regulation |
WO2017023974A1 (en) * | 2015-08-03 | 2017-02-09 | President And Fellows Of Harvard College | Cas9 genome editing and transcriptional regulation |
US11214800B2 (en) | 2015-08-18 | 2022-01-04 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
US10633642B2 (en) | 2015-08-28 | 2020-04-28 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
US11060078B2 (en) | 2015-08-28 | 2021-07-13 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
US10093910B2 (en) | 2015-08-28 | 2018-10-09 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
US10526591B2 (en) | 2015-08-28 | 2020-01-07 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases |
WO2017053431A3 (en) * | 2015-09-21 | 2017-06-01 | Arcturus Therapeutics, Inc. | Allele selective gene editing and uses thereof |
CN108350454B (en) * | 2015-09-21 | 2022-05-10 | 阿克丘勒斯治疗公司 | Allele-selective gene editing and uses thereof |
US10369232B2 (en) | 2015-09-21 | 2019-08-06 | Arcturus Therapeutics, Inc. | Allele selective gene editing and uses thereof |
CN108350454A (en) * | 2015-09-21 | 2018-07-31 | 阿克丘勒斯治疗公司 | Allele selective gene editing and application thereof |
US11667911B2 (en) | 2015-09-24 | 2023-06-06 | Editas Medicine, Inc. | Use of exonucleases to improve CRISPR/CAS-mediated genome editing |
WO2017069958A2 (en) | 2015-10-09 | 2017-04-27 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
WO2017070605A1 (en) | 2015-10-22 | 2017-04-27 | The Broad Institute Inc. | Type vi-b crispr enzymes and systems |
US10167457B2 (en) | 2015-10-23 | 2019-01-01 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
US11214780B2 (en) | 2015-10-23 | 2022-01-04 | President And Fellows Of Harvard College | Nucleobase editors and uses thereof |
WO2017074788A1 (en) | 2015-10-27 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for targeting cancer-specific sequence variations |
US11180730B2 (en) | 2015-10-28 | 2021-11-23 | The Broad Institute, Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting GATA3 |
WO2017075478A2 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by use of immune cell gene signatures |
US11092607B2 (en) | 2015-10-28 | 2021-08-17 | The Board Institute, Inc. | Multiplex analysis of single cell constituents |
WO2017075294A1 (en) | 2015-10-28 | 2017-05-04 | The Board Institute Inc. | Assays for massively combinatorial perturbation profiling and cellular circuit reconstruction |
WO2017075465A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3 |
US11186825B2 (en) | 2015-10-28 | 2021-11-30 | The Broad Institute, Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting POU2AF1 |
WO2017075451A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1 |
US11884717B2 (en) | 2015-11-19 | 2024-01-30 | The Brigham And Women's Hospital, Inc. | Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein |
US11001622B2 (en) | 2015-11-19 | 2021-05-11 | The Brigham And Women's Hospital, Inc. | Method of treating autoimmune disease with lymphocyte antigen CD5-like (CD5L) protein |
WO2017087708A1 (en) | 2015-11-19 | 2017-05-26 | The Brigham And Women's Hospital, Inc. | Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity |
WO2017114497A1 (en) | 2015-12-30 | 2017-07-06 | Novartis Ag | Immune effector cell therapies with enhanced efficacy |
EP4219689A2 (en) | 2015-12-30 | 2023-08-02 | Novartis AG | Immune effector cell therapies with enhanced efficacy |
WO2017131926A1 (en) * | 2016-01-26 | 2017-08-03 | Cedars-Sinai Medical Center | SYSTEMS AND METHODS FOR IN VIVO DUAL RECOMBINASE-MEDIATED CASSETTE EXCHANGE (dRMCE) AND DISEASE MODELS THEREOF |
US11466290B2 (en) | 2016-01-26 | 2022-10-11 | Cedars-Sinai Medical Center | Systems and methods for in vivo dual recombinase-mediated cassette exchange (dRMCE) and disease models thereof |
JP2019511243A (en) * | 2016-01-26 | 2019-04-25 | シーダーズ−サイナイ メディカル センター | Systems and methods for in vivo dual recombinase-mediated cassette exchange (dRMCE) and disease models thereof |
JP2022091801A (en) * | 2016-01-26 | 2022-06-21 | シーダーズ-サイナイ メディカル センター | Systems and methods for in vivo dual recombinase-mediated cassette exchange (dRMCE) and disease models thereof |
WO2017147196A1 (en) | 2016-02-22 | 2017-08-31 | Massachusetts Institute Of Technology | Methods for identifying and modulating immune phenotypes |
WO2017158153A1 (en) | 2016-03-17 | 2017-09-21 | Imba - Institut Für Molekulare Biotechnologie Gmbh | Conditional crispr sgrna expression |
EP3219799A1 (en) | 2016-03-17 | 2017-09-20 | IMBA-Institut für Molekulare Biotechnologie GmbH | Conditional crispr sgrna expression |
US11427861B2 (en) | 2016-03-17 | 2022-08-30 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
WO2017161325A1 (en) | 2016-03-17 | 2017-09-21 | Massachusetts Institute Of Technology | Methods for identifying and modulating co-occurant cellular phenotypes |
US11597924B2 (en) | 2016-03-25 | 2023-03-07 | Editas Medicine, Inc. | Genome editing systems comprising repair-modulating enzyme molecules and methods of their use |
US11236313B2 (en) | 2016-04-13 | 2022-02-01 | Editas Medicine, Inc. | Cas9 fusion molecules, gene editing systems, and methods of use thereof |
WO2017189308A1 (en) * | 2016-04-19 | 2017-11-02 | The Broad Institute Inc. | Novel crispr enzymes and systems |
US11286478B2 (en) | 2016-04-19 | 2022-03-29 | The Broad Institute, Inc. | Cpf1 complexes with reduced indel activity |
WO2017219027A1 (en) | 2016-06-17 | 2017-12-21 | The Broad Institute Inc. | Type vi crispr orthologs and systems |
US11788083B2 (en) | 2016-06-17 | 2023-10-17 | The Broad Institute, Inc. | Type VI CRISPR orthologs and systems |
EP4219462A1 (en) | 2016-07-13 | 2023-08-02 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
WO2018013840A1 (en) | 2016-07-13 | 2018-01-18 | Vertex Pharmaceuticals Incorporated | Methods, compositions and kits for increasing genome editing efficiency |
US10947530B2 (en) | 2016-08-03 | 2021-03-16 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
US11702651B2 (en) | 2016-08-03 | 2023-07-18 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
US10113163B2 (en) | 2016-08-03 | 2018-10-30 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
US11661590B2 (en) | 2016-08-09 | 2023-05-30 | President And Fellows Of Harvard College | Programmable CAS9-recombinase fusion proteins and uses thereof |
WO2018035250A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute, Inc. | Methods for identifying class 2 crispr-cas systems |
WO2018035364A1 (en) | 2016-08-17 | 2018-02-22 | The Broad Institute Inc. | Product and methods useful for modulating and evaluating immune responses |
US11352647B2 (en) | 2016-08-17 | 2022-06-07 | The Broad Institute, Inc. | Crispr enzymes and systems |
US11630103B2 (en) | 2016-08-17 | 2023-04-18 | The Broad Institute, Inc. | Product and methods useful for modulating and evaluating immune responses |
US11542509B2 (en) | 2016-08-24 | 2023-01-03 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
WO2018049025A2 (en) | 2016-09-07 | 2018-03-15 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses |
CN109715804A (en) * | 2016-09-23 | 2019-05-03 | 帝斯曼知识产权资产管理有限公司 | Guide RNA expression system for host cell |
WO2017216392A1 (en) * | 2016-09-23 | 2017-12-21 | Dsm Ip Assets B.V. | A guide-rna expression system for a host cell |
WO2018054911A1 (en) | 2016-09-23 | 2018-03-29 | Bayer Cropscience Nv | Targeted genome optimization in plants |
WO2018067991A1 (en) | 2016-10-07 | 2018-04-12 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
US11306324B2 (en) | 2016-10-14 | 2022-04-19 | President And Fellows Of Harvard College | AAV delivery of nucleobase editors |
WO2018083606A1 (en) | 2016-11-01 | 2018-05-11 | Novartis Ag | Methods and compositions for enhancing gene editing |
US10745677B2 (en) | 2016-12-23 | 2020-08-18 | President And Fellows Of Harvard College | Editing of CCR5 receptor gene to protect against HIV infection |
US11820969B2 (en) | 2016-12-23 | 2023-11-21 | President And Fellows Of Harvard College | Editing of CCR2 receptor gene to protect against HIV infection |
US11466271B2 (en) | 2017-02-06 | 2022-10-11 | Novartis Ag | Compositions and methods for the treatment of hemoglobinopathies |
US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
EP4361261A2 (en) | 2017-03-15 | 2024-05-01 | The Broad Institute Inc. | Novel cas13b orthologues crispr enzymes and systems |
US11739308B2 (en) | 2017-03-15 | 2023-08-29 | The Broad Institute, Inc. | Cas13b orthologues CRISPR enzymes and systems |
WO2018170333A1 (en) | 2017-03-15 | 2018-09-20 | The Broad Institute, Inc. | Novel cas13b orthologues crispr enzymes and systems |
WO2018170515A1 (en) | 2017-03-17 | 2018-09-20 | The Broad Institute, Inc. | Methods for identifying and modulating co-occurant cellular phenotypes |
US11268082B2 (en) | 2017-03-23 | 2022-03-08 | President And Fellows Of Harvard College | Nucleobase editors comprising nucleic acid programmable DNA binding proteins |
RU2775176C2 (en) * | 2017-03-24 | 2022-06-28 | Куревак Аг | Nucleic acids encoding crispr-associated proteins, and their use |
US11739335B2 (en) | 2017-03-24 | 2023-08-29 | CureVac SE | Nucleic acids encoding CRISPR-associated proteins and uses thereof |
WO2018172556A1 (en) * | 2017-03-24 | 2018-09-27 | Curevac Ag | Nucleic acids encoding crispr-associated proteins and uses thereof |
US11963966B2 (en) | 2017-03-31 | 2024-04-23 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating ovarian tumors |
US11913075B2 (en) | 2017-04-01 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
WO2018191520A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Respiratory and sweat gland ionocytes |
WO2018191553A1 (en) | 2017-04-12 | 2018-10-18 | Massachusetts Eye And Ear Infirmary | Tumor signature for metastasis, compositions of matter methods of use thereof |
WO2018191388A1 (en) | 2017-04-12 | 2018-10-18 | The Broad Institute, Inc. | Novel type vi crispr orthologs and systems |
WO2018191750A2 (en) | 2017-04-14 | 2018-10-18 | The Broad Institute Inc. | Novel delivery of large payloads |
WO2018195019A1 (en) | 2017-04-18 | 2018-10-25 | The Broad Institute Inc. | Compositions for detecting secretion and methods of use |
WO2018195486A1 (en) | 2017-04-21 | 2018-10-25 | The Broad Institute, Inc. | Targeted delivery to beta cells |
US11499151B2 (en) | 2017-04-28 | 2022-11-15 | Editas Medicine, Inc. | Methods and systems for analyzing guide RNA molecules |
US11591601B2 (en) | 2017-05-05 | 2023-02-28 | The Broad Institute, Inc. | Methods for identification and modification of lncRNA associated with target genotypes and phenotypes |
US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
US11866697B2 (en) | 2017-05-18 | 2024-01-09 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
US11603544B2 (en) | 2017-06-05 | 2023-03-14 | Fred Hutchinson Cancer Center | Genomic safe harbors for genetic therapies in human stem cells and engineered nanoparticles to provide targeted genetic therapies |
US11098297B2 (en) | 2017-06-09 | 2021-08-24 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
US10428319B2 (en) | 2017-06-09 | 2019-10-01 | Editas Medicine, Inc. | Engineered Cas9 nucleases |
US11897953B2 (en) | 2017-06-14 | 2024-02-13 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
WO2019005884A1 (en) | 2017-06-26 | 2019-01-03 | The Broad Institute, Inc. | Crispr/cas-adenine deaminase based compositions, systems, and methods for targeted nucleic acid editing |
WO2019003193A1 (en) | 2017-06-30 | 2019-01-03 | Novartis Ag | Methods for the treatment of disease with gene editing systems |
US11866726B2 (en) | 2017-07-14 | 2024-01-09 | Editas Medicine, Inc. | Systems and methods for targeted integration and genome editing and detection thereof using integrated priming sites |
US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
US11897920B2 (en) | 2017-08-04 | 2024-02-13 | Peking University | Tale RVD specifically recognizing DNA base modified by methylation and application thereof |
US11624077B2 (en) | 2017-08-08 | 2023-04-11 | Peking University | Gene knockout method |
US11624058B2 (en) | 2017-08-23 | 2023-04-11 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
US11286468B2 (en) | 2017-08-23 | 2022-03-29 | The General Hospital Corporation | Engineered CRISPR-Cas9 nucleases with altered PAM specificity |
US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
WO2019060746A1 (en) | 2017-09-21 | 2019-03-28 | The Broad Institute, Inc. | Systems, methods, and compositions for targeted nucleic acid editing |
WO2019071054A1 (en) | 2017-10-04 | 2019-04-11 | The Broad Institute, Inc. | Methods and compositions for altering function and structure of chromatin loops and/or domains |
US11795443B2 (en) | 2017-10-16 | 2023-10-24 | The Broad Institute, Inc. | Uses of adenosine base editors |
US11680296B2 (en) | 2017-10-16 | 2023-06-20 | Massachusetts Institute Of Technology | Mycobacterium tuberculosis host-pathogen interaction |
US11578118B2 (en) | 2017-10-20 | 2023-02-14 | Fred Hutchinson Cancer Center | Systems and methods to produce B cells genetically modified to express selected antibodies |
US11547614B2 (en) | 2017-10-31 | 2023-01-10 | The Broad Institute, Inc. | Methods and compositions for studying cell evolution |
WO2019087113A1 (en) | 2017-11-01 | 2019-05-09 | Novartis Ag | Synthetic rnas and methods of use |
US10662425B2 (en) | 2017-11-21 | 2020-05-26 | Crispr Therapeutics Ag | Materials and methods for treatment of autosomal dominant retinitis pigmentosa |
US11332736B2 (en) | 2017-12-07 | 2022-05-17 | The Broad Institute, Inc. | Methods and compositions for multiplexing single cell and single nuclei sequencing |
US11994512B2 (en) | 2018-01-04 | 2024-05-28 | Massachusetts Institute Of Technology | Single-cell genomic methods to generate ex vivo cell systems that recapitulate in vivo biology with improved fidelity |
WO2019143678A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
WO2019143677A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Quinoxalinone compounds, compositions, methods, and kits for increasing genome editing efficiency |
WO2019143675A1 (en) | 2018-01-17 | 2019-07-25 | Vertex Pharmaceuticals Incorporated | Dna-pk inhibitors |
WO2019204585A1 (en) | 2018-04-19 | 2019-10-24 | Massachusetts Institute Of Technology | Single-stranded break detection in double-stranded dna |
EP3560330A1 (en) | 2018-04-24 | 2019-10-30 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
WO2019206927A1 (en) | 2018-04-24 | 2019-10-31 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
US11957695B2 (en) | 2018-04-26 | 2024-04-16 | The Broad Institute, Inc. | Methods and compositions targeting glucocorticoid signaling for modulating immune responses |
WO2019210268A2 (en) | 2018-04-27 | 2019-10-31 | The Broad Institute, Inc. | Sequencing-based proteomics |
WO2019213660A2 (en) | 2018-05-04 | 2019-11-07 | The Broad Institute, Inc. | Compositions and methods for modulating cgrp signaling to regulate innate lymphoid cell inflammatory responses |
WO2019232542A2 (en) | 2018-06-01 | 2019-12-05 | Massachusetts Institute Of Technology | Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients |
WO2019237399A1 (en) * | 2018-06-16 | 2019-12-19 | 深圳市博奥康生物科技有限公司 | Method for specifically knocking out human c2orf40 gene by crispr-cas9 and specific sgrna thereof |
WO2020006036A1 (en) | 2018-06-26 | 2020-01-02 | Massachusetts Institute Of Technology | Crispr effector system based amplification methods, systems, and diagnostics |
WO2020006049A1 (en) | 2018-06-26 | 2020-01-02 | The Broad Institute, Inc. | Crispr/cas and transposase based amplification compositions, systems and methods |
WO2020028555A2 (en) | 2018-07-31 | 2020-02-06 | The Broad Institute, Inc. | Novel crispr enzymes and systems |
WO2020033601A1 (en) | 2018-08-07 | 2020-02-13 | The Broad Institute, Inc. | Novel cas12b enzymes and systems |
WO2020041380A1 (en) | 2018-08-20 | 2020-02-27 | The Broad Institute, Inc. | Methods and compositions for optochemical control of crispr-cas9 |
WO2020041387A1 (en) | 2018-08-20 | 2020-02-27 | The Brigham And Women's Hospital, Inc. | Degradation domain modifications for spatio-temporal control of rna-guided nucleases |
WO2020051507A1 (en) | 2018-09-06 | 2020-03-12 | The Broad Institute, Inc. | Nucleic acid assemblies for use in targeted delivery |
EP4268831A2 (en) | 2018-09-12 | 2023-11-01 | Fred Hutchinson Cancer Center | Reducing cd33 expression to selectively protect therapeutic cells |
US11447527B2 (en) | 2018-09-18 | 2022-09-20 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
US11505578B2 (en) | 2018-09-18 | 2022-11-22 | Vnv Newco Inc. | Endogenous Gag-based capsids and uses thereof |
WO2020077236A1 (en) | 2018-10-12 | 2020-04-16 | The Broad Institute, Inc. | Method for extracting nuclei or whole cells from formalin-fixed paraffin-embedded tissues |
WO2020081730A2 (en) | 2018-10-16 | 2020-04-23 | Massachusetts Institute Of Technology | Methods and compositions for modulating microenvironment |
US11384344B2 (en) | 2018-12-17 | 2022-07-12 | The Broad Institute, Inc. | CRISPR-associated transposase systems and methods of use thereof |
WO2020131586A2 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Methods for identifying neoantigens |
WO2020131862A1 (en) | 2018-12-17 | 2020-06-25 | The Broad Institute, Inc. | Crispr-associated transposase systems and methods of use thereof |
EP3898983A4 (en) * | 2018-12-20 | 2023-07-19 | Peking University | Compositions and methods for highly efficient genetic screening using barcoded guide rna constructs |
US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
WO2020206036A1 (en) | 2019-04-01 | 2020-10-08 | The Broad Institute, Inc. | Novel nucleic acid modifier |
WO2020229533A1 (en) | 2019-05-13 | 2020-11-19 | KWS SAAT SE & Co. KGaA | Drought tolerance in corn |
WO2020236972A2 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Non-class i multi-component nucleic acid targeting systems |
WO2020236967A1 (en) | 2019-05-20 | 2020-11-26 | The Broad Institute, Inc. | Random crispr-cas deletion mutant |
WO2020239680A2 (en) | 2019-05-25 | 2020-12-03 | KWS SAAT SE & Co. KGaA | Haploid induction enhancer |
WO2020243661A1 (en) | 2019-05-31 | 2020-12-03 | The Broad Institute, Inc. | Methods for treating metabolic disorders by targeting adcy5 |
WO2021003432A1 (en) | 2019-07-02 | 2021-01-07 | Fred Hutchinson Cancer Research Center | Recombinant ad35 vectors and related gene therapy improvements |
EP3772542A1 (en) | 2019-08-07 | 2021-02-10 | KWS SAAT SE & Co. KGaA | Modifying genetic variation in crops by modulating the pachytene checkpoint protein 2 |
WO2021041922A1 (en) | 2019-08-30 | 2021-03-04 | The Broad Institute, Inc. | Crispr-associated mu transposase systems |
WO2021055874A1 (en) | 2019-09-20 | 2021-03-25 | The Broad Institute, Inc. | Novel type vi crispr enzymes and systems |
US11981922B2 (en) | 2019-10-03 | 2024-05-14 | Dana-Farber Cancer Institute, Inc. | Methods and compositions for the modulation of cell interactions and signaling in the tumor microenvironment |
WO2021074367A1 (en) | 2019-10-17 | 2021-04-22 | KWS SAAT SE & Co. KGaA | Enhanced disease resistance of crops by downregulation of repressor genes |
EP3872190A1 (en) | 2020-02-26 | 2021-09-01 | Antibodies-Online GmbH | A method of using cut&run or cut&tag to validate crispr-cas targeting |
US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
WO2021239986A1 (en) | 2020-05-29 | 2021-12-02 | KWS SAAT SE & Co. KGaA | Plant haploid induction |
EP4001429A1 (en) | 2020-11-16 | 2022-05-25 | Antibodies-Online GmbH | Analysis of crispr-cas binding and cleavage sites followed by high-throughput sequencing (abc-seq) |
WO2023006933A1 (en) | 2021-07-30 | 2023-02-02 | KWS SAAT SE & Co. KGaA | Plants with improved digestibility and marker haplotypes |
WO2023093862A1 (en) | 2021-11-26 | 2023-06-01 | Epigenic Therapeutics Inc. | Method of modulating pcsk9 and uses thereof |
WO2024020352A1 (en) * | 2022-07-18 | 2024-01-25 | Vertex Pharmaceuticals Incorporated | Tandem guide rnas (tg-rnas) and their use in genome editing |
WO2024042199A1 (en) | 2022-08-26 | 2024-02-29 | KWS SAAT SE & Co. KGaA | Use of paired genes in hybrid breeding |
US11999947B2 (en) | 2023-02-24 | 2024-06-04 | President And Fellows Of Harvard College | Adenosine nucleobase editors and uses thereof |
Also Published As
Publication number | Publication date |
---|---|
DK3011029T3 (en) | 2020-03-16 |
AU2014281026A9 (en) | 2016-06-16 |
EP3011029B1 (en) | 2019-12-11 |
JP2016521993A (en) | 2016-07-28 |
KR20160044457A (en) | 2016-04-25 |
ES2777217T3 (en) | 2020-08-04 |
AU2014281026B2 (en) | 2020-05-28 |
CA2915834A1 (en) | 2014-12-24 |
EP3674411A1 (en) | 2020-07-01 |
AU2014281026A1 (en) | 2016-01-28 |
JP2020054354A (en) | 2020-04-09 |
HK1223646A1 (en) | 2017-08-04 |
US11008588B2 (en) | 2021-05-18 |
WO2014204724A8 (en) | 2015-12-23 |
US20160186213A1 (en) | 2016-06-30 |
JP6625971B2 (en) | 2019-12-25 |
US20210292794A1 (en) | 2021-09-23 |
WO2014204724A9 (en) | 2016-03-24 |
EP3011029A1 (en) | 2016-04-27 |
CN106062197A (en) | 2016-10-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11597949B2 (en) | Optimized CRISPR-Cas double nickase systems, methods and compositions for sequence manipulation | |
US20210292794A1 (en) | Delivery, engineering and optimization of tandem guide systems, methods and compositions for sequence manipulation | |
AU2019236591B2 (en) | Engineering and optimization of improved systems, methods and enzyme compositions for sequence manipulation | |
US20200165601A1 (en) | Functional genomics using crispr-cas systems, compositions, methods, knock out libraries and applications thereof | |
US20190106710A1 (en) | Oncogenic Models Based on Delivery and Use of the CRISPR-Cas Systems, Vectors and Compositions | |
US10577630B2 (en) | Delivery and use of the CRISPR-Cas systems, vectors and compositions for hepatic targeting and therapy | |
EP3011033A1 (en) | Functional genomics using crispr-cas systems, compositions methods, screens and applications thereof | |
WO2014093694A1 (en) | Crispr-cas nickase systems, methods and compositions for sequence manipulation in eukaryotes | |
WO2014093655A2 (en) | Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains | |
Class et al. | Patent application title: FUNCTIONAL GENOMICS USING CRISPR-CAS SYSTEMS, COMPOSITIONS, METHODS, KNOCK OUT LIBRARIES AND APPLICATIONS THEREOF Inventors: Feng Zhang (Cambridge, MA, US) Feng Zhang (Cambridge, MA, US) Neville Espi Sanjana (Cambridge, MA, US) Ophir Shalem (Boston, MA, US) |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14734708 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2915834 Country of ref document: CA Ref document number: 2016521449 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 20167001305 Country of ref document: KR Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2014734708 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2014281026 Country of ref document: AU Date of ref document: 20140610 Kind code of ref document: A |