WO2014198848A2 - Compounds - Google Patents
Compounds Download PDFInfo
- Publication number
- WO2014198848A2 WO2014198848A2 PCT/EP2014/062280 EP2014062280W WO2014198848A2 WO 2014198848 A2 WO2014198848 A2 WO 2014198848A2 EP 2014062280 W EP2014062280 W EP 2014062280W WO 2014198848 A2 WO2014198848 A2 WO 2014198848A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- orthophosphoric acid
- tris
- egta
- compound
- assays
- Prior art date
Links
- 150000001875 compounds Chemical class 0.000 title claims abstract description 66
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims abstract description 22
- 239000001257 hydrogen Substances 0.000 claims abstract description 21
- 229910052739 hydrogen Inorganic materials 0.000 claims abstract description 21
- 102000001253 Protein Kinase Human genes 0.000 claims abstract description 18
- 108060006633 protein kinase Proteins 0.000 claims abstract description 18
- 238000011282 treatment Methods 0.000 claims abstract description 18
- 229910052757 nitrogen Inorganic materials 0.000 claims abstract description 14
- 230000000694 effects Effects 0.000 claims abstract description 13
- 125000004435 hydrogen atom Chemical class [H]* 0.000 claims abstract description 13
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 11
- 201000011510 cancer Diseases 0.000 claims abstract description 11
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims abstract description 8
- 229910052799 carbon Inorganic materials 0.000 claims abstract description 8
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims abstract description 8
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims abstract description 8
- 206010061218 Inflammation Diseases 0.000 claims abstract description 6
- 230000004054 inflammatory process Effects 0.000 claims abstract description 6
- 230000004968 inflammatory condition Effects 0.000 claims abstract description 5
- 150000003839 salts Chemical class 0.000 claims abstract description 5
- 239000012453 solvate Substances 0.000 claims abstract description 5
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 claims abstract description 4
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 claims abstract description 3
- 239000005864 Sulphur Substances 0.000 claims abstract description 3
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 claims abstract description 3
- 239000001301 oxygen Substances 0.000 claims abstract description 3
- 229910052760 oxygen Inorganic materials 0.000 claims abstract description 3
- 238000006243 chemical reaction Methods 0.000 claims description 33
- 238000000034 method Methods 0.000 claims description 20
- 125000004122 cyclic group Chemical group 0.000 claims description 17
- -1 acyl phosphate Chemical compound 0.000 claims description 15
- 108091000080 Phosphotransferase Proteins 0.000 claims description 12
- 102000020233 phosphotransferase Human genes 0.000 claims description 12
- 150000002431 hydrogen Chemical class 0.000 claims description 11
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 claims description 10
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 claims description 9
- 125000000217 alkyl group Chemical group 0.000 claims description 8
- 150000001732 carboxylic acid derivatives Chemical class 0.000 claims description 7
- 125000005647 linker group Chemical group 0.000 claims description 7
- RWRDLPDLKQPQOW-UHFFFAOYSA-N Pyrrolidine Chemical compound C1CCNC1 RWRDLPDLKQPQOW-UHFFFAOYSA-N 0.000 claims description 6
- 201000010099 disease Diseases 0.000 claims description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 6
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 claims description 6
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 6
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 claims description 5
- 150000002148 esters Chemical class 0.000 claims description 5
- 125000002887 hydroxy group Chemical group [H]O* 0.000 claims description 5
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 claims description 5
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 claims description 5
- YLQBMQCUIZJEEH-UHFFFAOYSA-N Furan Chemical compound C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 claims description 4
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical compound C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 claims description 4
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 claims description 4
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 claims description 4
- 230000001594 aberrant effect Effects 0.000 claims description 4
- 230000008901 benefit Effects 0.000 claims description 4
- 239000003085 diluting agent Substances 0.000 claims description 4
- 230000001575 pathological effect Effects 0.000 claims description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N phenol group Chemical group C1(=CC=CC=C1)O ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 claims description 4
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 4
- 230000009467 reduction Effects 0.000 claims description 4
- 150000001299 aldehydes Chemical class 0.000 claims description 3
- 150000001408 amides Chemical class 0.000 claims description 3
- 229910052736 halogen Inorganic materials 0.000 claims description 3
- 150000002367 halogens Chemical class 0.000 claims description 3
- 230000002401 inhibitory effect Effects 0.000 claims description 3
- RSEBUVRVKCANEP-UHFFFAOYSA-N 2-pyrroline Chemical compound C1CC=CN1 RSEBUVRVKCANEP-UHFFFAOYSA-N 0.000 claims description 2
- ZCQWOFVYLHDMMC-UHFFFAOYSA-N Oxazole Chemical compound C1=COC=N1 ZCQWOFVYLHDMMC-UHFFFAOYSA-N 0.000 claims description 2
- 229910019142 PO4 Inorganic materials 0.000 claims description 2
- WTKZEGDFNFYCGP-UHFFFAOYSA-N Pyrazole Chemical compound C=1C=NNC=1 WTKZEGDFNFYCGP-UHFFFAOYSA-N 0.000 claims description 2
- FZWLAAWBMGSTSO-UHFFFAOYSA-N Thiazole Chemical compound C1=CSC=N1 FZWLAAWBMGSTSO-UHFFFAOYSA-N 0.000 claims description 2
- 125000002252 acyl group Chemical group 0.000 claims description 2
- 125000003342 alkenyl group Chemical group 0.000 claims description 2
- 150000003973 alkyl amines Chemical class 0.000 claims description 2
- 125000000304 alkynyl group Chemical group 0.000 claims description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 claims description 2
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 claims description 2
- 125000003709 fluoroalkyl group Chemical group 0.000 claims description 2
- 150000002576 ketones Chemical class 0.000 claims description 2
- 239000008194 pharmaceutical composition Substances 0.000 claims description 2
- 239000010452 phosphate Substances 0.000 claims description 2
- ZVJHJDDKYZXRJI-UHFFFAOYSA-N pyrroline Natural products C1CC=NC1 ZVJHJDDKYZXRJI-UHFFFAOYSA-N 0.000 claims description 2
- SEEPANYCNGTZFQ-UHFFFAOYSA-N sulfadiazine Chemical compound C1=CC(N)=CC=C1S(=O)(=O)NC1=NC=CC=N1 SEEPANYCNGTZFQ-UHFFFAOYSA-N 0.000 claims description 2
- 238000002560 therapeutic procedure Methods 0.000 claims description 2
- 150000007970 thio esters Chemical class 0.000 claims description 2
- 239000003112 inhibitor Substances 0.000 abstract description 5
- 230000001225 therapeutic effect Effects 0.000 abstract description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 528
- 238000003556 assay Methods 0.000 description 285
- 235000011007 phosphoric acid Nutrition 0.000 description 264
- 239000007983 Tris buffer Substances 0.000 description 219
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 219
- DEFVIWRASFVYLL-UHFFFAOYSA-N ethylene glycol bis(2-aminoethyl)tetraacetic acid Chemical compound OC(=O)CN(CC(O)=O)CCOCCOCCN(CC(O)=O)CC(O)=O DEFVIWRASFVYLL-UHFFFAOYSA-N 0.000 description 179
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 146
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 145
- 108090000765 processed proteins & peptides Proteins 0.000 description 137
- UEGPKNKPLBYCNK-UHFFFAOYSA-L magnesium acetate Chemical compound [Mg+2].CC([O-])=O.CC([O-])=O UEGPKNKPLBYCNK-UHFFFAOYSA-L 0.000 description 133
- 239000011654 magnesium acetate Substances 0.000 description 133
- 235000011285 magnesium acetate Nutrition 0.000 description 133
- 229940069446 magnesium acetate Drugs 0.000 description 133
- 239000011534 wash buffer Substances 0.000 description 132
- 239000000758 substrate Substances 0.000 description 130
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 76
- 239000000203 mixture Substances 0.000 description 54
- KISWVXRQTGLFGD-UHFFFAOYSA-N 2-[[2-[[6-amino-2-[[2-[[2-[[5-amino-2-[[2-[[1-[2-[[6-amino-2-[(2,5-diamino-5-oxopentanoyl)amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-(diaminomethylideneamino)p Chemical compound C1CCN(C(=O)C(CCCN=C(N)N)NC(=O)C(CCCCN)NC(=O)C(N)CCC(N)=O)C1C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 KISWVXRQTGLFGD-UHFFFAOYSA-N 0.000 description 52
- 102000047918 Myelin Basic Human genes 0.000 description 51
- 101710107068 Myelin basic protein Proteins 0.000 description 51
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 45
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 42
- 239000000243 solution Substances 0.000 description 41
- 239000007787 solid Substances 0.000 description 39
- 235000019439 ethyl acetate Nutrition 0.000 description 38
- 239000010410 layer Substances 0.000 description 37
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 36
- 238000005160 1H NMR spectroscopy Methods 0.000 description 29
- 238000001644 13C nuclear magnetic resonance spectroscopy Methods 0.000 description 27
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 25
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 24
- 239000012074 organic phase Substances 0.000 description 24
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 24
- 239000007993 MOPS buffer Substances 0.000 description 21
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 19
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 19
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 18
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 18
- UAOMVDZJSHZZME-UHFFFAOYSA-N diisopropylamine Chemical compound CC(C)NC(C)C UAOMVDZJSHZZME-UHFFFAOYSA-N 0.000 description 18
- SFNALCNOMXIBKG-UHFFFAOYSA-N ethylene glycol monododecyl ether Chemical compound CCCCCCCCCCCCOCCO SFNALCNOMXIBKG-UHFFFAOYSA-N 0.000 description 17
- DNJIEGIFACGWOD-UHFFFAOYSA-N ethyl mercaptane Natural products CCS DNJIEGIFACGWOD-UHFFFAOYSA-N 0.000 description 16
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 15
- 238000002360 preparation method Methods 0.000 description 15
- 239000000741 silica gel Substances 0.000 description 14
- 229910002027 silica gel Inorganic materials 0.000 description 14
- 229960001866 silicon dioxide Drugs 0.000 description 14
- XIPFMBOWZXULIA-UHFFFAOYSA-N pivalamide Chemical compound CC(C)(C)C(N)=O XIPFMBOWZXULIA-UHFFFAOYSA-N 0.000 description 13
- 238000000746 purification Methods 0.000 description 13
- IAZDPXIOMUYVGZ-WFGJKAKNSA-N Dimethyl sulfoxide Chemical compound [2H]C([2H])([2H])S(=O)C([2H])([2H])[2H] IAZDPXIOMUYVGZ-WFGJKAKNSA-N 0.000 description 12
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 12
- MZRVEZGGRBJDDB-UHFFFAOYSA-N N-Butyllithium Chemical compound [Li]CCCC MZRVEZGGRBJDDB-UHFFFAOYSA-N 0.000 description 12
- 239000012044 organic layer Substances 0.000 description 12
- 238000005481 NMR spectroscopy Methods 0.000 description 11
- 125000004429 atom Chemical group 0.000 description 11
- 101000950669 Homo sapiens Mitogen-activated protein kinase 9 Proteins 0.000 description 10
- 102100037809 Mitogen-activated protein kinase 9 Human genes 0.000 description 10
- 238000010992 reflux Methods 0.000 description 9
- 102100023033 Cyclic AMP-dependent transcription factor ATF-2 Human genes 0.000 description 8
- 101000974934 Homo sapiens Cyclic AMP-dependent transcription factor ATF-2 Proteins 0.000 description 8
- 101000997829 Homo sapiens Glial cell line-derived neurotrophic factor Proteins 0.000 description 8
- 239000004480 active ingredient Substances 0.000 description 8
- 239000011541 reaction mixture Substances 0.000 description 8
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 7
- 229960004132 diethyl ether Drugs 0.000 description 7
- 229910000029 sodium carbonate Inorganic materials 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 239000001117 sulphuric acid Substances 0.000 description 7
- 235000011149 sulphuric acid Nutrition 0.000 description 7
- LSGOVYNHVSXFFJ-UHFFFAOYSA-N vanadate(3-) Chemical compound [O-][V]([O-])([O-])=O LSGOVYNHVSXFFJ-UHFFFAOYSA-N 0.000 description 7
- SCYULBFZEHDVBN-UHFFFAOYSA-N 1,1-Dichloroethane Chemical compound CC(Cl)Cl SCYULBFZEHDVBN-UHFFFAOYSA-N 0.000 description 6
- WSLDOOZREJYCGB-UHFFFAOYSA-N 1,2-Dichloroethane Chemical group ClCCCl WSLDOOZREJYCGB-UHFFFAOYSA-N 0.000 description 6
- CSDSSGBPEUDDEE-UHFFFAOYSA-N 2-formylpyridine Chemical compound O=CC1=CC=CC=N1 CSDSSGBPEUDDEE-UHFFFAOYSA-N 0.000 description 6
- VHUUQVKOLVNVRT-UHFFFAOYSA-N Ammonium hydroxide Chemical compound [NH4+].[OH-] VHUUQVKOLVNVRT-UHFFFAOYSA-N 0.000 description 6
- 102000000584 Calmodulin Human genes 0.000 description 6
- 108010041952 Calmodulin Proteins 0.000 description 6
- 101000983111 Homo sapiens Serine/threonine-protein kinase PAK 6 Proteins 0.000 description 6
- 102100026840 Serine/threonine-protein kinase PAK 6 Human genes 0.000 description 6
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 6
- QGZKDVFQNNGYKY-UHFFFAOYSA-N ammonia Natural products N QGZKDVFQNNGYKY-UHFFFAOYSA-N 0.000 description 6
- 239000005441 aurora Substances 0.000 description 6
- HUMNYLRZRPPJDN-UHFFFAOYSA-N benzaldehyde Chemical compound O=CC1=CC=CC=C1 HUMNYLRZRPPJDN-UHFFFAOYSA-N 0.000 description 6
- 229940043279 diisopropylamine Drugs 0.000 description 6
- 125000001424 substituent group Chemical group 0.000 description 6
- KROYVOKHXIFHMV-UHFFFAOYSA-N (2-aminopyridin-3-yl)-phenylmethanone Chemical compound NC1=NC=CC=C1C(=O)C1=CC=CC=C1 KROYVOKHXIFHMV-UHFFFAOYSA-N 0.000 description 5
- 102100028397 MAP kinase-activated protein kinase 3 Human genes 0.000 description 5
- 101710141393 MAP kinase-activated protein kinase 3 Proteins 0.000 description 5
- 241001465754 Metazoa Species 0.000 description 5
- KWYHDKDOAIKMQN-UHFFFAOYSA-N N,N,N',N'-tetramethylethylenediamine Chemical compound CN(C)CCN(C)C KWYHDKDOAIKMQN-UHFFFAOYSA-N 0.000 description 5
- 102100024908 Ribosomal protein S6 kinase beta-1 Human genes 0.000 description 5
- 101710108924 Ribosomal protein S6 kinase beta-1 Proteins 0.000 description 5
- 229920004890 Triton X-100 Polymers 0.000 description 5
- 239000013504 Triton X-100 Substances 0.000 description 5
- JEIPFZHSYJVQDO-UHFFFAOYSA-N iron(III) oxide Inorganic materials O=[Fe]O[Fe]=O JEIPFZHSYJVQDO-UHFFFAOYSA-N 0.000 description 5
- YOBAEOGBNPPUQV-UHFFFAOYSA-N iron;trihydrate Chemical compound O.O.O.[Fe].[Fe] YOBAEOGBNPPUQV-UHFFFAOYSA-N 0.000 description 5
- 238000001953 recrystallisation Methods 0.000 description 5
- KJAXEBRGQOHHOY-VXRVIWLSSA-N (4s)-4-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s,3r)-2-[[(2s)-2-[[(2s)-1-[(2s)-2-[(2-aminoacetyl)amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropan Chemical class N([C@@H](CCCN=C(N)N)C(=O)N[C@@H]([C@H](O)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O)C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCN=C(N)N)NC(=O)CN KJAXEBRGQOHHOY-VXRVIWLSSA-N 0.000 description 4
- XNEOJQUMTPYGTO-UHFFFAOYSA-N 1-benzyl-3-(4-hydroxyphenyl)pyrrolo[2,3-c]pyridine-2-carbaldehyde Chemical compound C1=CC(O)=CC=C1C(C1=CC=NC=C11)=C(C=O)N1CC1=CC=CC=C1 XNEOJQUMTPYGTO-UHFFFAOYSA-N 0.000 description 4
- XWIYUCRMWCHYJR-UHFFFAOYSA-N 1h-pyrrolo[3,2-b]pyridine Chemical compound C1=CC=C2NC=CC2=N1 XWIYUCRMWCHYJR-UHFFFAOYSA-N 0.000 description 4
- JVSFQJZRHXAUGT-UHFFFAOYSA-N 2,2-dimethylpropanoyl chloride Chemical compound CC(C)(C)C(Cl)=O JVSFQJZRHXAUGT-UHFFFAOYSA-N 0.000 description 4
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 4
- AKAJHRHWNQLFQL-UHFFFAOYSA-N 3-(4-hydroxyphenyl)-1h-pyrrolo[2,3-c]pyridine-2-carbaldehyde Chemical compound C1=CC(O)=CC=C1C1=C(C=O)NC2=CN=CC=C12 AKAJHRHWNQLFQL-UHFFFAOYSA-N 0.000 description 4
- YRMVXGONXBCXMZ-UHFFFAOYSA-N 3-(4-hydroxyphenyl)-1h-pyrrolo[3,2-c]pyridine-2-carbaldehyde Chemical compound C1=CC(O)=CC=C1C1=C(C=O)NC2=CC=NC=C12 YRMVXGONXBCXMZ-UHFFFAOYSA-N 0.000 description 4
- BVCPJLYEUCHOQX-UHFFFAOYSA-N 3-phenyl-1h-pyrrolo[2,3-c]pyridine-2-carbaldehyde Chemical compound O=CC=1NC2=CN=CC=C2C=1C1=CC=CC=C1 BVCPJLYEUCHOQX-UHFFFAOYSA-N 0.000 description 4
- AVGFHVNKAYESMH-UHFFFAOYSA-N 3-phenyl-1h-pyrrolo[3,2-c]pyridine-2-carbaldehyde Chemical compound O=CC=1NC2=CC=NC=C2C=1C1=CC=CC=C1 AVGFHVNKAYESMH-UHFFFAOYSA-N 0.000 description 4
- 102000019050 90-kDa Ribosomal Protein S6 Kinases Human genes 0.000 description 4
- 108010012196 90-kDa Ribosomal Protein S6 Kinases Proteins 0.000 description 4
- 108010005254 Activating Transcription Factors Proteins 0.000 description 4
- 102000005869 Activating Transcription Factors Human genes 0.000 description 4
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 4
- 101150012716 CDK1 gene Proteins 0.000 description 4
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 4
- 108010033040 Histones Proteins 0.000 description 4
- 102100032826 Homeodomain-interacting protein kinase 3 Human genes 0.000 description 4
- 241000282414 Homo sapiens Species 0.000 description 4
- 101001066389 Homo sapiens Homeodomain-interacting protein kinase 3 Proteins 0.000 description 4
- 101000598781 Homo sapiens Oxidative stress-responsive serine-rich protein 1 Proteins 0.000 description 4
- 101000613717 Homo sapiens Protein odd-skipped-related 1 Proteins 0.000 description 4
- 101000588540 Homo sapiens Serine/threonine-protein kinase Nek6 Proteins 0.000 description 4
- 101001098464 Homo sapiens Serine/threonine-protein kinase OSR1 Proteins 0.000 description 4
- 101000987295 Homo sapiens Serine/threonine-protein kinase PAK 5 Proteins 0.000 description 4
- IMNFDUFMRHMDMM-UHFFFAOYSA-N N-Heptane Chemical compound CCCCCCC IMNFDUFMRHMDMM-UHFFFAOYSA-N 0.000 description 4
- 235000019502 Orange oil Nutrition 0.000 description 4
- 102100037143 Serine/threonine-protein kinase OSR1 Human genes 0.000 description 4
- 102100031463 Serine/threonine-protein kinase PLK1 Human genes 0.000 description 4
- ILAHWRKJUDSMFH-UHFFFAOYSA-N boron tribromide Chemical compound BrB(Br)Br ILAHWRKJUDSMFH-UHFFFAOYSA-N 0.000 description 4
- 108010024505 crosstide peptide Proteins 0.000 description 4
- 239000000706 filtrate Substances 0.000 description 4
- 238000003818 flash chromatography Methods 0.000 description 4
- 239000010502 orange oil Substances 0.000 description 4
- ZRSNZINYAWTAHE-UHFFFAOYSA-N p-methoxybenzaldehyde Chemical compound COC1=CC=C(C=O)C=C1 ZRSNZINYAWTAHE-UHFFFAOYSA-N 0.000 description 4
- NFHFRUOZVGFOOS-UHFFFAOYSA-N palladium;triphenylphosphane Chemical compound [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 NFHFRUOZVGFOOS-UHFFFAOYSA-N 0.000 description 4
- 108010056274 polo-like kinase 1 Proteins 0.000 description 4
- NROKBHXJSPEDAR-UHFFFAOYSA-M potassium fluoride Chemical compound [F-].[K+] NROKBHXJSPEDAR-UHFFFAOYSA-M 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 239000012730 sustained-release form Substances 0.000 description 4
- WXEOPBYWJZTKGV-UHFFFAOYSA-N (3-aminopyridin-4-yl)-phenylmethanone Chemical compound NC1=CN=CC=C1C(=O)C1=CC=CC=C1 WXEOPBYWJZTKGV-UHFFFAOYSA-N 0.000 description 3
- WPUQUUQFLYICLB-UHFFFAOYSA-N 1-(benzenesulfonyl)-3-(4-hydroxyphenyl)pyrrolo[2,3-c]pyridine-2-carbaldehyde Chemical compound C1=CC(O)=CC=C1C1=C(C=O)N(S(=O)(=O)C=2C=CC=CC=2)C2=CN=CC=C12 WPUQUUQFLYICLB-UHFFFAOYSA-N 0.000 description 3
- 102100037263 3-phosphoinositide-dependent protein kinase 1 Human genes 0.000 description 3
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 108010014380 Autophagy-Related Protein-1 Homolog Proteins 0.000 description 3
- 108010024986 Cyclin-Dependent Kinase 2 Proteins 0.000 description 3
- 102100036239 Cyclin-dependent kinase 2 Human genes 0.000 description 3
- 102000001301 EGF receptor Human genes 0.000 description 3
- 108060006698 EGF receptor Proteins 0.000 description 3
- 102000006947 Histones Human genes 0.000 description 3
- 101000600756 Homo sapiens 3-phosphoinositide-dependent protein kinase 1 Proteins 0.000 description 3
- 101000578774 Homo sapiens MAP kinase-activated protein kinase 5 Proteins 0.000 description 3
- 101001052493 Homo sapiens Mitogen-activated protein kinase 1 Proteins 0.000 description 3
- 101000628949 Homo sapiens Mitogen-activated protein kinase 10 Proteins 0.000 description 3
- 101000950695 Homo sapiens Mitogen-activated protein kinase 8 Proteins 0.000 description 3
- 101001126417 Homo sapiens Platelet-derived growth factor receptor alpha Proteins 0.000 description 3
- 101000945096 Homo sapiens Ribosomal protein S6 kinase alpha-5 Proteins 0.000 description 3
- 101000691459 Homo sapiens Serine/threonine-protein kinase N2 Proteins 0.000 description 3
- 101000864800 Homo sapiens Serine/threonine-protein kinase Sgk1 Proteins 0.000 description 3
- 101000997832 Homo sapiens Tyrosine-protein kinase JAK2 Proteins 0.000 description 3
- 101000820294 Homo sapiens Tyrosine-protein kinase Yes Proteins 0.000 description 3
- 101001117146 Homo sapiens [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Proteins 0.000 description 3
- 102100034069 MAP kinase-activated protein kinase 2 Human genes 0.000 description 3
- 101710141394 MAP kinase-activated protein kinase 2 Proteins 0.000 description 3
- 102100028396 MAP kinase-activated protein kinase 5 Human genes 0.000 description 3
- 102100026299 MAP kinase-interacting serine/threonine-protein kinase 1 Human genes 0.000 description 3
- 101710139011 MAP kinase-interacting serine/threonine-protein kinase 1 Proteins 0.000 description 3
- 102100033610 MAP kinase-interacting serine/threonine-protein kinase 2 Human genes 0.000 description 3
- 101710138999 MAP kinase-interacting serine/threonine-protein kinase 2 Proteins 0.000 description 3
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 3
- 102100026931 Mitogen-activated protein kinase 10 Human genes 0.000 description 3
- 102100037808 Mitogen-activated protein kinase 8 Human genes 0.000 description 3
- 101150111783 NTRK1 gene Proteins 0.000 description 3
- 101150020891 PRKCA gene Proteins 0.000 description 3
- 102100030485 Platelet-derived growth factor receptor alpha Human genes 0.000 description 3
- 102100029981 Receptor tyrosine-protein kinase erbB-4 Human genes 0.000 description 3
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 3
- 102100033645 Ribosomal protein S6 kinase alpha-5 Human genes 0.000 description 3
- 102100026180 Serine/threonine-protein kinase N2 Human genes 0.000 description 3
- 102100030070 Serine/threonine-protein kinase Sgk1 Human genes 0.000 description 3
- 102100039988 Serine/threonine-protein kinase ULK1 Human genes 0.000 description 3
- 102100033444 Tyrosine-protein kinase JAK2 Human genes 0.000 description 3
- 102100021788 Tyrosine-protein kinase Yes Human genes 0.000 description 3
- 239000008346 aqueous phase Substances 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 238000001816 cooling Methods 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- LEOWOGITZPCMKU-UHFFFAOYSA-N ethyl 3-(3-hydroxyphenyl)-1h-pyrrolo[2,3-c]pyridine-2-carboxylate Chemical compound CCOC(=O)C=1NC2=CN=CC=C2C=1C1=CC=CC(O)=C1 LEOWOGITZPCMKU-UHFFFAOYSA-N 0.000 description 3
- JCYWIEUIQLHUGZ-UHFFFAOYSA-N ethyl 3-(4-hydroxyphenyl)-1h-pyrrolo[2,3-c]pyridine-2-carboxylate Chemical compound CCOC(=O)C=1NC2=CN=CC=C2C=1C1=CC=C(O)C=C1 JCYWIEUIQLHUGZ-UHFFFAOYSA-N 0.000 description 3
- OFXDCMIHNCXHBR-UHFFFAOYSA-N ethyl 3-bromo-1h-pyrrolo[2,3-c]pyridine-2-carboxylate Chemical compound N1=CC=C2C(Br)=C(C(=O)OCC)NC2=C1 OFXDCMIHNCXHBR-UHFFFAOYSA-N 0.000 description 3
- 229940043355 kinase inhibitor Drugs 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 229920002113 octoxynol Polymers 0.000 description 3
- 108010068338 p38 Mitogen-Activated Protein Kinases Proteins 0.000 description 3
- QNGNSVIICDLXHT-UHFFFAOYSA-N para-ethylbenzaldehyde Natural products CCC1=CC=C(C=O)C=C1 QNGNSVIICDLXHT-UHFFFAOYSA-N 0.000 description 3
- SIOXPEMLGUPBBT-UHFFFAOYSA-M picolinate Chemical compound [O-]C(=O)C1=CC=CC=N1 SIOXPEMLGUPBBT-UHFFFAOYSA-M 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000003909 protein kinase inhibitor Substances 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000013268 sustained release Methods 0.000 description 3
- MUXPIKKNIKZVHU-UHFFFAOYSA-N (3-aminopyridin-2-yl)-phenylmethanone Chemical compound NC1=CC=CN=C1C(=O)C1=CC=CC=C1 MUXPIKKNIKZVHU-UHFFFAOYSA-N 0.000 description 2
- YDYJXBWJWLLVLZ-UHFFFAOYSA-N (3-aminopyridin-4-yl)-(4-methoxyphenyl)methanone Chemical compound C1=CC(OC)=CC=C1C(=O)C1=CC=NC=C1N YDYJXBWJWLLVLZ-UHFFFAOYSA-N 0.000 description 2
- ZKULYWRZELVDMH-UHFFFAOYSA-N (4-aminopyridin-3-yl)-(4-methoxyphenyl)methanone Chemical compound C1=CC(OC)=CC=C1C(=O)C1=CN=CC=C1N ZKULYWRZELVDMH-UHFFFAOYSA-N 0.000 description 2
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 2
- FIDGQQIVMWAIAD-UHFFFAOYSA-N 2,2,4,4-tetramethyloxolane Chemical compound CC1(C)COC(C)(C)C1 FIDGQQIVMWAIAD-UHFFFAOYSA-N 0.000 description 2
- IEQAICDLOKRSRL-UHFFFAOYSA-N 2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-[2-(2-dodecoxyethoxy)ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethanol Chemical compound CCCCCCCCCCCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCOCCO IEQAICDLOKRSRL-UHFFFAOYSA-N 0.000 description 2
- ICSNLGPSRYBMBD-UHFFFAOYSA-N 2-aminopyridine Chemical compound NC1=CC=CC=N1 ICSNLGPSRYBMBD-UHFFFAOYSA-N 0.000 description 2
- LVLHIRTTWXLFNV-UHFFFAOYSA-N 3-(4-methoxyphenyl)-1H-pyrrolo[2,3-c]pyridine-2-carbaldehyde Chemical compound COc1ccc(cc1)-c1c(C=O)[nH]c2cnccc12 LVLHIRTTWXLFNV-UHFFFAOYSA-N 0.000 description 2
- RKMKTROSKBRRSS-UHFFFAOYSA-N 3-(4-methoxyphenyl)-1H-pyrrolo[3,2-c]pyridine-2-carbaldehyde Chemical compound COc1ccc(cc1)-c1c(C=O)[nH]c2ccncc12 RKMKTROSKBRRSS-UHFFFAOYSA-N 0.000 description 2
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 description 2
- CUYKNJBYIJFRCU-UHFFFAOYSA-N 3-aminopyridine Chemical compound NC1=CC=CN=C1 CUYKNJBYIJFRCU-UHFFFAOYSA-N 0.000 description 2
- 102100036009 5'-AMP-activated protein kinase catalytic subunit alpha-2 Human genes 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- PAYRUJLWNCNPSJ-UHFFFAOYSA-N Aniline Chemical compound NC1=CC=CC=C1 PAYRUJLWNCNPSJ-UHFFFAOYSA-N 0.000 description 2
- 229910015845 BBr3 Inorganic materials 0.000 description 2
- 101100180602 Caenorhabditis elegans csnk-1 gene Proteins 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 102100031065 Choline kinase alpha Human genes 0.000 description 2
- 102000011424 Cofilin 2 Human genes 0.000 description 2
- 108010023936 Cofilin 2 Proteins 0.000 description 2
- 108010068192 Cyclin A Proteins 0.000 description 2
- 102000002435 Cyclin T Human genes 0.000 description 2
- 108010068106 Cyclin T Proteins 0.000 description 2
- 102100025191 Cyclin-A2 Human genes 0.000 description 2
- 102100024457 Cyclin-dependent kinase 9 Human genes 0.000 description 2
- 102100038587 Death-associated protein kinase 1 Human genes 0.000 description 2
- 101000876610 Dictyostelium discoideum Extracellular signal-regulated kinase 2 Proteins 0.000 description 2
- LCGLNKUTAGEVQW-UHFFFAOYSA-N Dimethyl ether Chemical compound COC LCGLNKUTAGEVQW-UHFFFAOYSA-N 0.000 description 2
- 102100031480 Dual specificity mitogen-activated protein kinase kinase 1 Human genes 0.000 description 2
- 102100040844 Dual specificity protein kinase CLK2 Human genes 0.000 description 2
- 102100036492 Dual specificity testis-specific protein kinase 1 Human genes 0.000 description 2
- 102100028554 Dual specificity tyrosine-phosphorylation-regulated kinase 1A Human genes 0.000 description 2
- 102100023115 Dual specificity tyrosine-phosphorylation-regulated kinase 2 Human genes 0.000 description 2
- 102100023114 Dual specificity tyrosine-phosphorylation-regulated kinase 3 Human genes 0.000 description 2
- 102100032822 Homeodomain-interacting protein kinase 1 Human genes 0.000 description 2
- 102100032827 Homeodomain-interacting protein kinase 2 Human genes 0.000 description 2
- 101000783681 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-2 Proteins 0.000 description 2
- 101000980930 Homo sapiens Cyclin-dependent kinase 9 Proteins 0.000 description 2
- 101000956145 Homo sapiens Death-associated protein kinase 1 Proteins 0.000 description 2
- 101001014196 Homo sapiens Dual specificity mitogen-activated protein kinase kinase 1 Proteins 0.000 description 2
- 101000749291 Homo sapiens Dual specificity protein kinase CLK2 Proteins 0.000 description 2
- 101000714159 Homo sapiens Dual specificity testis-specific protein kinase 1 Proteins 0.000 description 2
- 101000838016 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 1A Proteins 0.000 description 2
- 101001049990 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 2 Proteins 0.000 description 2
- 101001049991 Homo sapiens Dual specificity tyrosine-phosphorylation-regulated kinase 3 Proteins 0.000 description 2
- 101001066404 Homo sapiens Homeodomain-interacting protein kinase 1 Proteins 0.000 description 2
- 101001066401 Homo sapiens Homeodomain-interacting protein kinase 2 Proteins 0.000 description 2
- 101000977771 Homo sapiens Interleukin-1 receptor-associated kinase 4 Proteins 0.000 description 2
- 101001064870 Homo sapiens Lon protease homolog, mitochondrial Proteins 0.000 description 2
- 101001059429 Homo sapiens MAP/microtubule affinity-regulating kinase 3 Proteins 0.000 description 2
- 101001059427 Homo sapiens MAP/microtubule affinity-regulating kinase 4 Proteins 0.000 description 2
- 101000976899 Homo sapiens Mitogen-activated protein kinase 15 Proteins 0.000 description 2
- 101000950687 Homo sapiens Mitogen-activated protein kinase 7 Proteins 0.000 description 2
- 101001055085 Homo sapiens Mitogen-activated protein kinase kinase kinase 9 Proteins 0.000 description 2
- 101001059989 Homo sapiens Mitogen-activated protein kinase kinase kinase kinase 3 Proteins 0.000 description 2
- 101001059982 Homo sapiens Mitogen-activated protein kinase kinase kinase kinase 5 Proteins 0.000 description 2
- 101000970023 Homo sapiens NUAK family SNF1-like kinase 1 Proteins 0.000 description 2
- 101001055594 Homo sapiens S-adenosylmethionine synthase isoform type-1 Proteins 0.000 description 2
- 101000826081 Homo sapiens SRSF protein kinase 1 Proteins 0.000 description 2
- 101000628647 Homo sapiens Serine/threonine-protein kinase 24 Proteins 0.000 description 2
- 101000701393 Homo sapiens Serine/threonine-protein kinase 26 Proteins 0.000 description 2
- 101000880439 Homo sapiens Serine/threonine-protein kinase 3 Proteins 0.000 description 2
- 101000695043 Homo sapiens Serine/threonine-protein kinase BRSK1 Proteins 0.000 description 2
- 101000794043 Homo sapiens Serine/threonine-protein kinase BRSK2 Proteins 0.000 description 2
- 101000777293 Homo sapiens Serine/threonine-protein kinase Chk1 Proteins 0.000 description 2
- 101000777277 Homo sapiens Serine/threonine-protein kinase Chk2 Proteins 0.000 description 2
- 101001059443 Homo sapiens Serine/threonine-protein kinase MARK1 Proteins 0.000 description 2
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 2
- 101000588545 Homo sapiens Serine/threonine-protein kinase Nek7 Proteins 0.000 description 2
- 101000987310 Homo sapiens Serine/threonine-protein kinase PAK 2 Proteins 0.000 description 2
- 101000987297 Homo sapiens Serine/threonine-protein kinase PAK 4 Proteins 0.000 description 2
- 101000665442 Homo sapiens Serine/threonine-protein kinase TBK1 Proteins 0.000 description 2
- 101000770770 Homo sapiens Serine/threonine-protein kinase WNK1 Proteins 0.000 description 2
- 101000595531 Homo sapiens Serine/threonine-protein kinase pim-1 Proteins 0.000 description 2
- 101001001648 Homo sapiens Serine/threonine-protein kinase pim-2 Proteins 0.000 description 2
- 101001001645 Homo sapiens Serine/threonine-protein kinase pim-3 Proteins 0.000 description 2
- 101000759314 Homo sapiens Tau-tubulin kinase 1 Proteins 0.000 description 2
- 101000759318 Homo sapiens Tau-tubulin kinase 2 Proteins 0.000 description 2
- 101000772231 Homo sapiens Testis-specific serine/threonine-protein kinase 1 Proteins 0.000 description 2
- 108060006678 I-kappa-B kinase Proteins 0.000 description 2
- 102000001284 I-kappa-B kinase Human genes 0.000 description 2
- 101150057269 IKBKB gene Proteins 0.000 description 2
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 2
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 2
- 102100023533 Interleukin-1 receptor-associated kinase 4 Human genes 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 108010075654 MAP Kinase Kinase Kinase 1 Proteins 0.000 description 2
- 102000019149 MAP kinase activity proteins Human genes 0.000 description 2
- 108040008097 MAP kinase activity proteins Proteins 0.000 description 2
- 102000043136 MAP kinase family Human genes 0.000 description 2
- 108091054455 MAP kinase family Proteins 0.000 description 2
- 102100028920 MAP/microtubule affinity-regulating kinase 3 Human genes 0.000 description 2
- 102100028913 MAP/microtubule affinity-regulating kinase 4 Human genes 0.000 description 2
- 102100024299 Maternal embryonic leucine zipper kinase Human genes 0.000 description 2
- 101710154611 Maternal embryonic leucine zipper kinase Proteins 0.000 description 2
- 102100023483 Mitogen-activated protein kinase 15 Human genes 0.000 description 2
- 102100037805 Mitogen-activated protein kinase 7 Human genes 0.000 description 2
- 102100033115 Mitogen-activated protein kinase kinase kinase 1 Human genes 0.000 description 2
- 102100026888 Mitogen-activated protein kinase kinase kinase 7 Human genes 0.000 description 2
- 102100026909 Mitogen-activated protein kinase kinase kinase 9 Human genes 0.000 description 2
- 102100028193 Mitogen-activated protein kinase kinase kinase kinase 3 Human genes 0.000 description 2
- 102100028195 Mitogen-activated protein kinase kinase kinase kinase 5 Human genes 0.000 description 2
- 102100035044 Myosin light chain kinase, smooth muscle Human genes 0.000 description 2
- 101710198035 Myosin light chain kinase, smooth muscle Proteins 0.000 description 2
- 102100021732 NUAK family SNF1-like kinase 1 Human genes 0.000 description 2
- 108091008606 PDGF receptors Proteins 0.000 description 2
- 108010065081 Phosphorylase b Proteins 0.000 description 2
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 2
- SMWDFEZZVXVKRB-UHFFFAOYSA-N Quinoline Chemical compound N1=CC=CC2=CC=CC=C21 SMWDFEZZVXVKRB-UHFFFAOYSA-N 0.000 description 2
- 108010079933 Receptor-Interacting Protein Serine-Threonine Kinase 2 Proteins 0.000 description 2
- 102100022502 Receptor-interacting serine/threonine-protein kinase 2 Human genes 0.000 description 2
- 102100039314 Rho-associated protein kinase 2 Human genes 0.000 description 2
- 101710088493 Rho-associated protein kinase 2 Proteins 0.000 description 2
- 102100026115 S-adenosylmethionine synthase isoform type-1 Human genes 0.000 description 2
- 102100023010 SRSF protein kinase 1 Human genes 0.000 description 2
- 102100026764 Serine/threonine-protein kinase 24 Human genes 0.000 description 2
- 102100030617 Serine/threonine-protein kinase 26 Human genes 0.000 description 2
- 102100037628 Serine/threonine-protein kinase 3 Human genes 0.000 description 2
- 102100028623 Serine/threonine-protein kinase BRSK1 Human genes 0.000 description 2
- 102100029891 Serine/threonine-protein kinase BRSK2 Human genes 0.000 description 2
- 102100031081 Serine/threonine-protein kinase Chk1 Human genes 0.000 description 2
- 102100031075 Serine/threonine-protein kinase Chk2 Human genes 0.000 description 2
- 102100028921 Serine/threonine-protein kinase MARK1 Human genes 0.000 description 2
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 2
- 102100031401 Serine/threonine-protein kinase Nek6 Human genes 0.000 description 2
- 102100031400 Serine/threonine-protein kinase Nek7 Human genes 0.000 description 2
- 102100027939 Serine/threonine-protein kinase PAK 2 Human genes 0.000 description 2
- 102100027940 Serine/threonine-protein kinase PAK 4 Human genes 0.000 description 2
- 102100026715 Serine/threonine-protein kinase STK11 Human genes 0.000 description 2
- 101710181599 Serine/threonine-protein kinase STK11 Proteins 0.000 description 2
- 102100038192 Serine/threonine-protein kinase TBK1 Human genes 0.000 description 2
- 102100029064 Serine/threonine-protein kinase WNK1 Human genes 0.000 description 2
- 102100036077 Serine/threonine-protein kinase pim-1 Human genes 0.000 description 2
- 102100036120 Serine/threonine-protein kinase pim-2 Human genes 0.000 description 2
- 102100036119 Serine/threonine-protein kinase pim-3 Human genes 0.000 description 2
- 102100033456 TGF-beta receptor type-1 Human genes 0.000 description 2
- 102100023277 Tau-tubulin kinase 1 Human genes 0.000 description 2
- 102100023276 Tau-tubulin kinase 2 Human genes 0.000 description 2
- 102100029350 Testis-specific serine/threonine-protein kinase 1 Human genes 0.000 description 2
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 2
- 108010011702 Transforming Growth Factor-beta Type I Receptor Proteins 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 2
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 2
- 239000002260 anti-inflammatory agent Substances 0.000 description 2
- 230000003110 anti-inflammatory effect Effects 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 229940045988 antineoplastic drug protein kinase inhibitors Drugs 0.000 description 2
- 229910052786 argon Inorganic materials 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- 229940127089 cytotoxic agent Drugs 0.000 description 2
- VAYGXNSJCAHWJZ-UHFFFAOYSA-N dimethyl sulfate Chemical compound COS(=O)(=O)OC VAYGXNSJCAHWJZ-UHFFFAOYSA-N 0.000 description 2
- OJCSPXHYDFONPU-UHFFFAOYSA-N etoac etoac Chemical compound CCOC(C)=O.CCOC(C)=O OJCSPXHYDFONPU-UHFFFAOYSA-N 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 2
- XKBGEWXEAPTVCK-UHFFFAOYSA-M methyltrioctylammonium chloride Chemical compound [Cl-].CCCCCCCC[N+](C)(CCCCCCCC)CCCCCCCC XKBGEWXEAPTVCK-UHFFFAOYSA-M 0.000 description 2
- JTSLALYXYSRPGW-UHFFFAOYSA-N n-[5-(4-cyanophenyl)-1h-pyrrolo[2,3-b]pyridin-3-yl]pyridine-3-carboxamide Chemical compound C=1C=CN=CC=1C(=O)NC(C1=C2)=CNC1=NC=C2C1=CC=C(C#N)C=C1 JTSLALYXYSRPGW-UHFFFAOYSA-N 0.000 description 2
- 239000007922 nasal spray Substances 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 239000003208 petroleum Substances 0.000 description 2
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 2
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 2
- 239000011698 potassium fluoride Substances 0.000 description 2
- 235000003270 potassium fluoride Nutrition 0.000 description 2
- 102000004169 proteins and genes Human genes 0.000 description 2
- 108090000623 proteins and genes Proteins 0.000 description 2
- 150000005255 pyrrolopyridines Chemical class 0.000 description 2
- 125000000168 pyrrolyl group Chemical group 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 235000012222 talc Nutrition 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 108091008743 testicular receptors 4 Proteins 0.000 description 2
- 238000001665 trituration Methods 0.000 description 2
- 229940124676 vascular endothelial growth factor receptor Drugs 0.000 description 2
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- WFWQWTPAPNEOFE-UHFFFAOYSA-N (3-hydroxyphenyl)boronic acid Chemical compound OB(O)C1=CC=CC(O)=C1 WFWQWTPAPNEOFE-UHFFFAOYSA-N 0.000 description 1
- COIQUVGFTILYGA-UHFFFAOYSA-N (4-hydroxyphenyl)boronic acid Chemical compound OB(O)C1=CC=C(O)C=C1 COIQUVGFTILYGA-UHFFFAOYSA-N 0.000 description 1
- MFNOMYANTMSCGT-UHFFFAOYSA-N 1H-pyrrolo[3,2-b]pyridin-2-ol Chemical compound C1=CC=C2[NH2+]C([O-])=CC2=N1 MFNOMYANTMSCGT-UHFFFAOYSA-N 0.000 description 1
- VZSRBBMJRBPUNF-UHFFFAOYSA-N 2-(2,3-dihydro-1H-inden-2-ylamino)-N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]pyrimidine-5-carboxamide Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C(=O)NCCC(N1CC2=C(CC1)NN=N2)=O VZSRBBMJRBPUNF-UHFFFAOYSA-N 0.000 description 1
- ZNJRONVKWRHYBF-UHFFFAOYSA-N 2-[2-[2-(1-azatricyclo[7.3.1.05,13]trideca-5,7,9(13)-trien-7-yl)ethenyl]-6-methylpyran-4-ylidene]propanedinitrile Chemical compound O1C(C)=CC(=C(C#N)C#N)C=C1C=CC1=CC(CCCN2CCC3)=C2C3=C1 ZNJRONVKWRHYBF-UHFFFAOYSA-N 0.000 description 1
- WIGDGIGALMYEBW-LLINQDLYSA-N 2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-amino-4-methylpentanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]propanoyl]amino]-3-hydroxypropanoyl]amino]-4-methylpentanoyl]amino]acetic acid Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O WIGDGIGALMYEBW-LLINQDLYSA-N 0.000 description 1
- HKDVVTLISGIPFE-UHFFFAOYSA-N 2-bromopyridin-3-amine Chemical compound NC1=CC=CN=C1Br HKDVVTLISGIPFE-UHFFFAOYSA-N 0.000 description 1
- MKXGHKMUXDFAGG-UHFFFAOYSA-N 3-(4-hydroxyphenyl)-1-methylpyrrolo[2,3-c]pyridine-2-carbaldehyde Chemical compound Cn1c(C=O)c(-c2ccc(O)cc2)c2ccncc12 MKXGHKMUXDFAGG-UHFFFAOYSA-N 0.000 description 1
- NUKYPUAOHBNCPY-UHFFFAOYSA-N 4-aminopyridine Chemical compound NC1=CC=NC=C1 NUKYPUAOHBNCPY-UHFFFAOYSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical class OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N Acrylic acid Chemical group OC(=O)C=C NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- KLSJWNVTNUYHDU-UHFFFAOYSA-N Amitrole Chemical compound NC1=NC=NN1 KLSJWNVTNUYHDU-UHFFFAOYSA-N 0.000 description 1
- 102100022014 Angiopoietin-1 receptor Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 1
- 238000000040 CK2 assay Methods 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 229920000623 Cellulose acetate phthalate Polymers 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 1
- ZBNZXTGUTAYRHI-UHFFFAOYSA-N Dasatinib Chemical compound C=1C(N2CCN(CCO)CC2)=NC(C)=NC=1NC(S1)=NC=C1C(=O)NC1=C(C)C=CC=C1Cl ZBNZXTGUTAYRHI-UHFFFAOYSA-N 0.000 description 1
- 102100022207 E3 ubiquitin-protein ligase parkin Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000753291 Homo sapiens Angiopoietin-1 receptor Proteins 0.000 description 1
- 101000619542 Homo sapiens E3 ubiquitin-protein ligase parkin Proteins 0.000 description 1
- 101000573441 Homo sapiens Misshapen-like kinase 1 Proteins 0.000 description 1
- 101001005602 Homo sapiens Mitogen-activated protein kinase kinase kinase 11 Proteins 0.000 description 1
- 101000945090 Homo sapiens Ribosomal protein S6 kinase alpha-3 Proteins 0.000 description 1
- 101000701396 Homo sapiens Serine/threonine-protein kinase 33 Proteins 0.000 description 1
- 101000605835 Homo sapiens Serine/threonine-protein kinase PINK1, mitochondrial Proteins 0.000 description 1
- 101000607332 Homo sapiens Serine/threonine-protein kinase ULK2 Proteins 0.000 description 1
- 101000818543 Homo sapiens Tyrosine-protein kinase ZAP-70 Proteins 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 1
- 239000005517 L01XE01 - Imatinib Substances 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000002067 L01XE06 - Dasatinib Substances 0.000 description 1
- 102100026287 Misshapen-like kinase 1 Human genes 0.000 description 1
- 102100025207 Mitogen-activated protein kinase kinase kinase 11 Human genes 0.000 description 1
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 1
- CJKRXEBLWJVYJD-UHFFFAOYSA-N N,N'-diethylethylenediamine Chemical compound CCNCCNCC CJKRXEBLWJVYJD-UHFFFAOYSA-N 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 101150009401 Prkcz gene Proteins 0.000 description 1
- 241000283080 Proboscidea <mammal> Species 0.000 description 1
- 102100033643 Ribosomal protein S6 kinase alpha-3 Human genes 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 102100030515 Serine/threonine-protein kinase 33 Human genes 0.000 description 1
- 102100038376 Serine/threonine-protein kinase PINK1, mitochondrial Human genes 0.000 description 1
- 102100039987 Serine/threonine-protein kinase ULK2 Human genes 0.000 description 1
- 229920001800 Shellac Polymers 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 241000282887 Suidae Species 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 102100021125 Tyrosine-protein kinase ZAP-70 Human genes 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 230000000996 additive effect Effects 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 230000003281 allosteric effect Effects 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 150000001555 benzenes Chemical group 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 125000002837 carbocyclic group Chemical group 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229940096529 carboxypolymethylene Drugs 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 229940081734 cellulose acetate phthalate Drugs 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000007795 chemical reaction product Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000007906 compression Methods 0.000 description 1
- 230000006835 compression Effects 0.000 description 1
- 230000008094 contradictory effect Effects 0.000 description 1
- 239000012050 conventional carrier Substances 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 229960002448 dasatinib Drugs 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 229960004979 fampridine Drugs 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 125000001072 heteroaryl group Chemical group 0.000 description 1
- 239000005457 ice water Substances 0.000 description 1
- KTUFNOKKBVMGRW-UHFFFAOYSA-N imatinib Chemical compound C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 KTUFNOKKBVMGRW-UHFFFAOYSA-N 0.000 description 1
- 229960002411 imatinib Drugs 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 108010082683 kemptide Proteins 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- WUQPLUNEYBWFQA-UHFFFAOYSA-N n-(2-hydroxyethyl)-3-(3-hydroxyphenyl)-1h-pyrrolo[2,3-c]pyridine-2-carboxamide Chemical compound OCCNC(=O)C=1NC2=CN=CC=C2C=1C1=CC=CC(O)=C1 WUQPLUNEYBWFQA-UHFFFAOYSA-N 0.000 description 1
- XYSDHEWKSASJTI-UHFFFAOYSA-N n-(2-hydroxyethyl)-3-(4-hydroxyphenyl)-1h-pyrrolo[2,3-c]pyridine-2-carboxamide Chemical compound OCCNC(=O)C=1NC2=CN=CC=C2C=1C1=CC=C(O)C=C1 XYSDHEWKSASJTI-UHFFFAOYSA-N 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920002689 polyvinyl acetate Polymers 0.000 description 1
- 239000011118 polyvinyl acetate Substances 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000004321 preservation Methods 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- JQRYUMGHOUYJFW-UHFFFAOYSA-N pyridine;trihydrobromide Chemical compound [Br-].[Br-].[Br-].C1=CC=[NH+]C=C1.C1=CC=[NH+]C=C1.C1=CC=[NH+]C=C1 JQRYUMGHOUYJFW-UHFFFAOYSA-N 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000011435 rock Substances 0.000 description 1
- ZLGIYFNHBLSMPS-ATJNOEHPSA-N shellac Chemical compound OCCCCCC(O)C(O)CCCCCCCC(O)=O.C1C23[C@H](C(O)=O)CCC2[C@](C)(CO)[C@@H]1C(C(O)=O)=C[C@@H]3O ZLGIYFNHBLSMPS-ATJNOEHPSA-N 0.000 description 1
- 239000004208 shellac Substances 0.000 description 1
- 235000013874 shellac Nutrition 0.000 description 1
- 229940113147 shellac Drugs 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 239000002700 tablet coating Substances 0.000 description 1
- 238000009492 tablet coating Methods 0.000 description 1
- FPGGTKZVZWFYPV-UHFFFAOYSA-M tetrabutylammonium fluoride Chemical compound [F-].CCCC[N+](CCCC)(CCCC)CCCC FPGGTKZVZWFYPV-UHFFFAOYSA-M 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 239000004408 titanium dioxide Substances 0.000 description 1
- 235000010215 titanium dioxide Nutrition 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D471/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00
- C07D471/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, at least one ring being a six-membered ring with one nitrogen atom, not provided for by groups C07D451/00 - C07D463/00 in which the condensed system contains two hetero rings
- C07D471/04—Ortho-condensed systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
Definitions
- the present invention relates to novel chemical compounds, more particularly to novel pyrrolopyridines with activity as protein kinase inhibitors and thus of therapeutic use.
- Kinases play an important role in signal transduction and co-ordination of complex functions such as the cell cycle.
- the general structure comprises an N- and C-terminal lobe joined at a hinge region close to an ATP binding site; phosphate groups are transferred from bound ATP to a protein substrate.
- Kinases are of great therapeutic interest and many are targets for cancer treatment, treatment of inflammation and other conditions. Indeed, more than 400 human diseases have been connected to protein kinases.
- Kinase targets in cancer therapy include bcr-Abl, EGFR (epidermal growth factor receptor), Raf, VEGFR (vascular endothelial growth factor receptor), PDGFR (platelet-derived growth factor receptor), KIT and Aurora. It is estimated that the market for kinase inhibitors in cancer treatment will grow from $769 million in 2006 to more than $7.5 billion in 2016. Chemical discovery work on kinases has produced ATP-competitive compounds, allosteric regulators, irreversible binders and highly specific inhibitors.
- PKIs are already available or in trial, usually with specific kinase targets, e.g. Imatinib against Bcr-Abl or Gefitinib against EGFR, although Dasatinib has multiple targets.
- specific kinase targets e.g. Imatinib against Bcr-Abl or Gefitinib against EGFR, although Dasatinib has multiple targets.
- Most existing PKIs are small molecules but monoclonal antibodies such as Beracizumab (against VEGF) and Trastuzumab (against Erb2) also exist in growing numbers.
- US 2008/0139606 describes a series of substituted pyrrolopyridines which inhibit kinases, in particular FAK, KDR, Tie2, Aurora A, Aurora B and CDK2. These molecules are described as being of particular utility in the treatment of cancer. These compounds incorporate two cyclic moieties linked to each other, optionally via a molecular linker as a single substituent on the pyrrole group. Independently, the present inventors have surprisingly found that a phenol group as pyrrole substituent results in PKIs of broad specificity.
- the present invention provides a compound
- X, Y and Z is nitrogen and the other 2 are carbon, preferably Y or X is nitrogen, more preferably Y is nitrogen;
- the hydroxyl of the phenol moiety can be located in the ortho, meta or para position, preferably in the meta or para position, more preferably in the para position;
- R" is hydrogen, methyl, ethyl or propyl, preferably hydrogen, methyl or ethyl
- W represents hydrogen, carbon, nitrogen, oxygen or sulphur
- the present invention thus also provides a compound of formula (II)
- X, Y and Z is nitrogen and the other 2 are carbon, preferably Y or X is nitrogen, more preferably Y is nitrogen;
- the hydroxyl of the phenol moiety can be located in the ortho, meta or para position, preferably in the meta or para position, more preferably in the para position;
- R together with the carbonyl group to which it is attached, is a carboxylic acid derivative, preferably a carboxylic acid derivative selected from an aldehyde, a ketone, an amide, an ester, a thioester, an acyl phosphate and an acyl
- the carboxylic acid derivative is an amide or ester with esters being most preferred
- R" is hydrogen, methyl, ethyl or propyl, preferably hydrogen, methyl or ethyl; or a salt, hydrate or solvate of a compound of formula (II). All potential stereoisomers of compounds incorporating a group of formula (I) or of formula (II) are encompassed within the invention and products may be racemic mixtures or enriched partially or essentially completely for one
- R' (in formula (II)), or W and the atoms attached thereto (in formula (I)), has a molecular weight up to 500 Da, preferably up to 300 Da.
- This group may comprise 0-4, preferably 0-3 cyclic groups more preferably 1 -3, most preferably 1 or 2 cyclic groups (typically of 5 to 6 but possibly with 7 atoms in the ring).
- Suitable linking groups typically comprise 1 -10 non-hydrogen atoms, preferably up to 7 non-hydrogen atoms, suitable linking groups include -CH 2 -, -NR-, -0-, -S-,
- Linking groups are typically 1 to 4 atoms in length.
- the cyclic groups are preferably, but may not be, aromatic, including heteroaromatic; if the group comprises two or more aromatic groups, then preferably no more than one of these groups is carbocyclic.
- Suitable cyclic groups include cyclohexyl, phenyl, pyridine, pyrazole, imidazole, thiazole, oxazole, furan, piperazine, pyrroline, pyrrolidine, diazolone, morpholine and piperidine. Two of the rings may be fused (e.g. phenyl and pyridine to form quinoline).
- R' in formula (II)), or W and the atoms attached thereto (in formula (I)), comprises no more than 18 non-hydrogen (heavy) atoms, preferably no more than 16 non-hydrogen atoms, more preferably no more than 12 non-hydrogen atoms, e.g. no more than 10 non-hydrogen atoms.
- R' in formula (II)), or W and the atoms attached thereto (in formula (I)), is preferably selected from hydrogen, -NH 2 ,- OR-i, -Ri or -NR 1 R 2 in which R 2 is preferably hydrogen but may be a further Ri group and Ri may be a C- ⁇ .- ⁇ - ⁇ (preferably Ci -6 ) alkyl, alkenyl, alkynyl or alkylamine, which may be linear or branched; Ri may comprise or consist of cyclic groups as described above which may be fused or linked, again as described above.
- R' in formula (I I)
- W and the atoms attached thereto in formula (I)
- OCH2CH2CH2CH3 OCH2CH2CH2CH3 , -IMHCH3, -NHCH2CH3, -NHCH2CH2CH3, -NHCH2CH2OH or -HCH2CH 2 N(CH 2 CH3)2; hydrogen, -OCH 3 , -OCH 2 CH 3 , or -NHCH 2 CH 2 OH are particularly preferred.
- Ri moieties comprising or consisting of cyclic groups are especially preferred and suitable groups are discussed above.
- the meta or para position of the hydroxyl group is preferred in combination with all options at other positions allowing variation in substituents.
- Y being nitrogen and X and Z being carbon is a preferred configuration in combination with all options at other positions allowing variation in substituents.
- R' in formula (II)
- W and the atoms attached thereto in formula (I)
- Preferred compounds of the invention are described in the Examples and include compounds with the following compound identifiers: 942, 940, 1285, 1356, 4-41 , 4-31 , 4-43 and 4-49. Particularly preferred are compounds 942 and 940 with compound 942 most preferred.
- kinase inhibitory activity is very significantly influenced by the presence of hydroxyl in the phenyl moiety, as compared, for example, to an unsubstituted benzene ring or methoxy or amino substituent.
- the Examples also demonstrate the surprisingly broad specificity of the compounds of the present invention.
- the compounds of the present invention for use in therapy, particularly for use as a protein kinase inhibitor and thus for the treatment of diseases or other pathological conditions associated with aberrant protein kinase activity or which would benefit from a reduction in protein kinase activity. More specifically, the compounds of the invention may be of use in the treatment of inflammation and inflammatory conditions and most especially in the treatment of cancer.
- Methods of treating diseases or other pathological conditions associated with aberrant protein kinase activity or which would benefit from a reduction in protein kinase activity which methods comprise administration to a human or animal patient of an effective amount of a compound of the invention, constitute further aspects of the present invention.
- Methods of treating cancer, inflammatory conditions or inflammation which methods comprise administration to a human or animal patient of an effective amount of a compound of the invention, constitute further aspects of the present invention.
- the patient will typically have been identified as in need of treatment.
- Treatments may be prophylactic but generally will not be.
- the present invention provides a method of inhibiting a protein kinase and/or a reaction catalysed by a protein kinase, the method comprising contacting said kinase with a compound of the present invention.
- Such methods may be in vivo or ex vivo, e.g. in vitro.
- the present invention provides the use of a compound of the invention in the manufacture of a medicament for the treatment of cancer, inflammatory conditions or inflammation.
- the present invention provides the use of a compound of the invention in the manufacture of a medicament for the treatment of a disease or other pathological condition associated with aberrant protein kinase activity or which would benefit from a reduction in protein kinase activity.
- Animals which may be treated include domestic animals, in particular cats and dogs and livestock animals such as pigs, cows, sheep or goats as well as horses, also elephants. Treatment of humans is nevertheless preferred.
- the present invention provides a method of preparing a compound of formula (II) comprising reaction step II below, optionally and where appropriate, preceded by reaction step I.
- Compounds of the invention may, alternatively, be prepared as set out in the reaction scheme below in which X, Y, Z and Ri are as defined herein and Hal a halogen, typically bromine.
- the present invention provides a method of preparing a compound of formula (II) comprising reaction step IV, optionally preceded by step III.
- a method of preparing a compound of the invention comprising reaction step V , optionally preceded by step IV and optionally preceded by step III.
- Formulations comprising one or more compounds of the invention in admixture with a suitable diluent, carrier or excipient constitute a further aspect of the present invention. Such formulations may be for pharmaceutical use. Suitable diluents, excipients and carriers are known to the skilled man.
- the compositions according to the invention may be presented, for example, in a form suitable for oral, nasal, parenteral, intravenal, topical or rectal administration.
- the term "pharmaceutical” includes veterinary applications of the products of the invention.
- the active compounds defined herein may be presented in the conventional pharmacological forms of administration, such as tablets, coated tablets, nasal sprays, inhalers, solutions, emulsions, liposomes, powders, capsules or sustained release forms.
- Tablets may be produced, for example, by mixing the active ingredient or ingredients with known excipients, such as for example with diluents, such as calcium carbonate, calcium phosphate or lactose, disintegrants such as corn starch or alginic acid, binders such as starch or gelatin, lubricants such as magnesium stearate or talcum, and/or agents for obtaining sustained release, such as carboxypolymethylene,
- the tablets may if desired consist of several layers.
- Coated tablets may be produced by coating cores, obtained in a similar manner to the tablets, with agents commonly used for tablet coatings, for example, polyvinyl pyrrolidone or shellac, gum arabic, talcum, titanium dioxide or sugar.
- the core may consist of several layers too.
- the tablet coat may also consist of several layers in order to obtain sustained release, in which case the excipients mentioned above for tablets may be used.
- Injection solutions may, for example, be produced in the conventional manner, such as by the addition of preservation agents, such as
- p-hydroxybenzoates or stabilizers, such as EDTA.
- the solutions are then filled into injection vials or ampoules.
- Nasal sprays administration may be formulated similarly in aqueous solution and packed into spray containers either with an aerosol propellant or provided with means for manual compression.
- Capsules containing one or several active ingredients may be produced, for example, by mixing the active ingredients with inert carriers, such as lactose or sorbitol, and filling the mixture into gelatin capsules.
- Suitable suppositories may, for example, be produced by mixing the active ingredient or active ingredient combinations with the conventional carriers envisaged for this purpose, such as natural fats or polyethyleneglycol or derivatives thereof.
- compositions may additionally comprise further active ingredients, including, for example, other anti-inflammatory or chemotherapeutic agents.
- medical uses and methods of treatment may additionally comprise further active ingredients, including, for example, other anti-inflammatory or chemotherapeutic agents.
- the therapeutic regimen may also include radiation therapy.
- the active molecule is generally present in an amount to achieve a serum level of the active molecule of at least about .
- a preferred serum level is about 1 - 10 micromolar
- Such serum levels may be achieved by incorporating the bioactive molecule in a composition to be administered systemically at a dose of from 50 mg - 250 mg.
- each preferred embodiment of a given feature may provide a molecule, use, method etc. of the invention which is preferred, both when combined with the other features of the invention in their most general form and when combined with preferred embodiments of other features.
- the effect of selecting multiple preferred embodiments may be additive or synergistic. Thus all such combinations are contemplated unless the technical context obviously makes them mutually exclusive or contradictory.
- each feature and preferred embodiments of it are independent of the other features and hence combinations of preferred embodiments may be presented to describe sub-sets of the most general definitions without providing the skilled reader with any new concepts or information as such.
- Step 2 and step 3 (4-aminopyridin-3-yl)(phenyl)methanone (IX) To a solution of 2.33 g (13.1 mmol, 1 eq.) of pivalamide VII and 5.9 mL (39.2 mmol, 3 eq.) of TMEDA in 105 mL of diethylether, cooled to -78°C, were added 15.7 mL (39.2 mmol, 3 eq., 2.5 M in hexane) of BuLi. After 15 minutes, the solution was brought back to -24°C and stirred 2 hours.
- Step 1 yV-(2-bromopyridin-3-yl)pivalamide (X) To a solution of 1 .13 g (6.5 mmol, 1 eq.) of 3-amino-2-bromopyridine and 1 .2 mL (8.5 mmol, 1 .3 eq.) of triethylamine in 13 mL of DCM, cooled to 0°C, were added 0.9 mL (7.2 mmol, 1 .1 eq.) of trimethylacetyl chloride in 2 mL of DCM. After 3 hours at room temperature, 15 mL of water were added. The aqueous layer was extracted with 2 x 10 mL of dichloromethane.
- the reaction was brought back to 0°C and stirred 2 hours before being stirred at room temperature over night. Then, 120 mL of water were added. The aqueous layer was extracted with 2 x 80 mL of dichloromethane. The organic phase was dried, filtered and concentrated. The crude mixture was purified over silicagel. The obtained white solid (estimation 9 mmol of XII) was dissolved in 90 mL of DCM. Then, 7.74 g (89.0 mmol, 10 eq.) of activated Mn0 2 were added and the reaction was refluxed 20 hours. The reaction was brought back to room temperature and 7.74 g (89.0 mmol, 10 eq.) of activated Mn0 2 were added again.
- the crude mixture was dissolved in 50 mL of dichloroethane and 50 mL of 0.1 M aqueous sulphuric acid were added. After 18 hours under reflux, the mixture was cooled down to room temperature. The solid was filtered. The filtrate was decanted and the organic layer was extracted with 2 x 30 mL of 3 M aqueous HCI. The combined aqueous layers were neutralised with K 2 C0 3 . Once again, the solid was filtered. The combined solids were recrystallised in 30 mL of
- Step 2 (4-aminopyridin-3-yl)(4-methoxyphenyl)methanone (XV) To a solution of 3.15 g (10.0 mmol, 1 eq.) of XIV in 100 mL of DCM, 8.71 g (100.0 mmol, 10 eq.) of activated Mn0 2 were added and the reaction was refluxed 40 hours. The mixture was filtered on celite and the solvent was evaporated. The crude mixture was dissolved in 200 mL of 3 M aqueous HCI were added and refluxed 16 hours. The reaction was cooled down to 0°C and 50 mL of aqueous ammonia were added. The aqueous layer was extracted with 3 x 100 mL of DCM.
- inactive MAPK (0.06 mg/ml) is activated by MKK1 (diluted in 25 mM Tris, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 0.01 % Brij35, 1 mg/ml BSA) in 25.5 ⁇ containing 25 mM Tris, 0.1 mM EGTA, 0.01 % Brij35, 10 mM magnesium acetate and 0.005 mM ATP.
- MKK1 diluted in 25 mM Tris, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 0.01 % Brij35, 1 mg/ml BSA
- MKK1 diluted in 25 mM Tris, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 0.01 % Brij35, 1 mg/ml BSA
- MKK1 diluted in 25 mM Tris, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 0.
- MAPK2/ERK2 assay MAPK2/ERK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM
- Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA is assayed against MBP in a final volume of 25.5 ⁇ in 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP](500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 3. JNK1a1/SAPK1 c assay.
- JNK1 a1/SAPK1 c (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % b-mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 ⁇ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- Mercaptoethanol, ATF2 (3 ⁇ ), 10 mM magnesium acetate and 0.02 mM [33P-g- ATP] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature.
- ATF2 activating transcription factor in a final volume of 25.5 ⁇ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- Mercaptoethanol, ATF2 (3 ⁇ )
- 10 mM magnesium acetate and 0.02 mM [33P-g- ATP] 500 -
- Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- SAPK 2a/p38 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- SAPK 2 ⁇ 38 ⁇ 2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 6. SAPK 3/p38g assay.
- SAPK 3/p38g (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 25mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.005mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- SAPK 4/p38d (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- MAPKAP-K1 a (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against KKLNRTLSVA in a final volume of 25.5 ⁇ containing 50 mM Na-b- glycerophosphate pH 7.5, 0.5 mM EDTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 40 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- MAPKAP-K2 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against KKLNRTLSVA in a final volume of 25.51 containing 50 mM Na-b-glycerophosphate pH 7.5, 0.5 mM EDTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- MSK1 assay MSK1 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide GRPRTSSFAEGKK in a final volume of 25.5 ⁇ containing 8 mM MOPS pH7.0, 0.2 mM EDTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM
- [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- PRAK (5-20mU diluted in 50 mM Na-b-glycerophosphate pH 7.5, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against KKLRRTLSVA in a final volume of 25.5 ⁇ containing 50 mM Na-b-glycerophosphate pH 7.5, 0.1 mM EGTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- PKA (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against Kemptide (LRRASLG) in a final volume of 25.5 ⁇ containing 8 mM MOPS pH 7.5, 0.2 mM EDTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- PKCa (5-20 mU diluted in 20 mM Hepes pH 7.4, 0.03% Triton X-100) is assayed against Histone H1 in the presence of PtdSerine and DAG (0.1 mg/ml. and 10 g/ml) and 0.1 mM CaCI2.
- the assay is carried out in a final volume of 25.5 ⁇ containing 20 mM Hepes pH 7.4, 0.03% Triton X-100, 0.1 mg/ml Histone H1 , 10 mM magnesium acetate and 0.02 mM[33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature.
- PDK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.05% b-mercaptoethanol, 1 mg/ml BSA) is assayed against PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQ- EMFRDFDYIADWC) in a final volume of 25.5 ⁇ containing 50 mM Tris pH 7.5, 0.05% b-mercaptoethanol, 100 ⁇ substrate peptide, 10mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- PDKtide KTFCGTPEYLAPEVRREPRILSEEEQ- EMFRDFDYIADWC
- APH-PKBa-S473D (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide GRPRTSSFAEGKK in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- SGK assay 5-20mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide GRPRTSSFAEGKK in a final volume of 25.5 ⁇ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- S6K1/P70 S6K (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against substrate peptide (KKRNRTLTV) in a final volume of 25.5 ⁇ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 0.1 mM substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 18. GSK3b assay.
- GSK3b (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against Phospho-GS2 peptide (YRRAAVPPSPSLSRHSSPHQS(P04)EDEEE) in a final volume of 25.5 ⁇ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 20 ⁇ Phospho GS2 peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- Phospho-GS2 peptide YRRAAVPP
- ROCK-II ROKa
- ROCK-II (ROKa) (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against Long S6 substrate peptide (KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK) in a final volume of 25.5 ⁇ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 30 ⁇ Long S6 substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- AMPK (5-20 mU diluted in 50 mM Hepes pH 7.5, 1 mM DTT, 0.02% Brij35) is assayed against SAMS substrate peptide (HMRSAMSGLHLVKRR) in a final volume of 25.5 ⁇ containing 50 mM Hepes pH 7.5, 1 mM DTT, 0.02% Brij35, 0.4 mM SAMS peptide, 0.196 mM AMP, 10 mM magnesium acetate and 0.05 mM
- [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- CHK1 assay CHK1 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.1 % b- mercaptoethanol, 0.01 % Brij-35, 5% glycerol, 1 mg/ml BSA) is assayed against CHKtide substrate peptide (KKKVSRSGLYRSPSMPENLNRPR) in a final volume of 25.5 ⁇ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 ⁇ CHKtide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- CHKtide substrate peptide KKKVSRSGLYRSPSMPENLNRPR
- CK2 (5-20 mU diluted in 20 mM Hepes pH7.5, 0.15 M NaCI, 0.1 mM EGTA, 0.1 % Triton X-100, 5 mM DTT, 50% glycerol) is assayed against CKII peptide
- PBK PBK (5-20 mU diluted in 50 mM Na-b-glycerophosphate pH 7.0, 0.1 % b- mercaptoethanol) is assayed against phosphorylase b peptide (KRKQISVRGL) in a final volume of 25.5 ⁇ containing 50 mM Tris pH 8.6, 50 mM Na-b- glycerophosphate, 0.04 mM CaCI2, phosphorylase b peptide (0.196 mM), 10 mM magnesium acetate, 0.02 mM [33P-g-ATP] (500 -1000 cpm/pmole) then incubated for 15 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- KRKQISVRGL phosphorylase b peptide
- LCK (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against Cdc2 peptide (KVEKIGEGTYGWYK) in a final volume of 25.5 ⁇ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3Vo4, Cdc2 peptide (0.25 mM), 10 mM magnesium acetate and 0.05mM [33P-g-ATP](500-1000 cpm/pmole) and incubated for 15 min at room temperature Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 25. CSK assay.
- CSK (5-20 mU diluted in 20 mM MOPS pH7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against Cdc2 peptide (KVEKIGEGTYGWYK) in a final volume of 25.5 ⁇ containing 8 mM MOPS pH7.0, 0.2 mM EDTA, Cdc2 peptide (0.25 mM), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](500 -1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- CDK2/cyclin A assay CDK2/cyclin A (5-20 mU diluted in 50 mM Hepes pH 7.5, 1 mM DTT, 0.02% Brij35, 100 mM NaCI) is assayed against Histone H 1 in a final volume of 25.5 ⁇ containing 50 mM Hepes pH7.5, 1 mM DTT, 0.02% Brij35, 100 mM NaCI, Histone H1 (1 mg/ml), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](500-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- DYRK 1 A assay DYRK 1A (5-20 mU of diluted in 50 mM Tris pH7.5, 0.1 mM EGTA) is assayed against Woodtide (KKISGRLSPIMTEQ) in a final volume of 25.5 ⁇ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 350 ⁇ substrate peptide, 10 mM Magnesium acetate and 0.05 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- CK1 assay CK1 (5-20 mU diluted in 20 mM Hepes pH7.5, 0.15 M NaCI, 0.1 mM EGTA, 0.1 % Triton X-100, 5 mM DTT, 50% glycerol) is assayed against CKI peptide
- RRKDLHDDEEDEAMSITA in a final volume of 25.5 ⁇ containing 20 mM Hepes pH 7.5, 0.15 M NaCI, 0.1 mM EDTA, 5 mM DTT, 0.1 % Triton-X 100, CKI peptide (0.5 mM), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 29. NEK6 assay.
- NEK6 (5-20 mU diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b- Mercaptoethanol) is assayed against NEK6 peptide (FLAKSFGSPNRAYKK) in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.01 % Brij, 0.1 %, b-Mercaptoethanol, NEK6 peptide (0.3 mM), 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- NEK2a 5-20mU of NEK2a (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against NEK2a peptide (RFRRSRRMI) in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.01 % Brij,
- MAPKAP-K1 b (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against substrate peptide (KKLNRTLSVA) in a final volume of 25.51 containing 50 mM Na- b-glycerophosphate (pH 7.5), 0.5 mM EDTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- IKKb assay 5-20mU of IKKb (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against substrate peptide
- LDDRHDSGLDSMKDEEY in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- PRK2 5-20mU of PRK2 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against Long S6 peptide
- MNK2 5-20mU of MNK2 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against substrate peptide (elF4E) in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b- Mercaptoethanol, 0.5mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- CAMK-1 assay 5-20mU of CAMK-1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA,
- 0.1 %,b-Mercaptoethanol is assayed against substrate peptide (YLRRRLSDSNF) in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.5mM CaCI2, 0.3 ⁇ calmodulin, 0.1 %, b-Mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- NEK7 (5-20 mU diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b- Mercaptoethanol) is assayed against substrate peptide (FLAKSFGSPNRAYKK) in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.01 % Brij, 0.1 %, b-Mercaptoethanol, substrate peptide (0.3 mM), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- JNK3 alpha 1 (5-20 mU diluted in 50 mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % b-mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 ⁇ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b-
- Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- MAPKAP-K3 diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol is assayed against substrate peptide
- ERK8 5-20mU of ERK8 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000
- MNK1 5-20mU of MNK1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against substrate peptide (elF4E) in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b- Mercaptoethanol, 0.5mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid. 57. SRPK1 assay
- SRPK1 5-20mU of SRPK1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against substrate peptide
- RSRSRSRSRSRSRSRSR in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid. 58. ⁇ -PKBbeta (S474D) assay
- APH-PKBbeta-S474D (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide (GRPRTSSFAEGKK) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- GRPRTSSFAEGKK modified Crosstide peptide
- Aurora B (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- CHK2 assay CHK2 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.1 % b- mercaptoethanol, 0.01 % Brij-35, 5% glycerol, 1 mg/ml BSA) is assayed against CHKtide substrate peptide (KKKVSRSGLYRSPSMPENLNRPR) in a final volume of 25.5 ⁇ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 ⁇ CHKtide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 ⁇ of 0.5 M
- Src assay Src (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide (KVEKIGEGTYGWYK) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50- 1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- EF2K (5-20mU diluted in 50 mM Hepes pH 6.6, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide (RKKFGESKTKTKEFL) in a final volume of 25.5 ⁇ containing 50mM Hepes pH 6.6, 0.2mM CaCI2, 0.3 ⁇
- KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 ⁇ substrate peptide, 10 mM
- MST2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 100 ⁇ Vanadate) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- PKD1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed substrate peptide (KKLNRTLSVA) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50- 1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- PLK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA, 100 ⁇ Vanadate) is assayed against a substrate peptide (ISDELMDATFADQEAKKK) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 10 ⁇ Vanadate, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- DYRK2 (5-20 mU of diluted in 50 mM Tris pH7.5, 0.1 mM EGTA) is assayed against Woodtide (KKISGRLSPIMTEQ) in a final volume of 25.5 ⁇ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 350 ⁇ substrate peptide, 10 mM Magnesium acetate and 0.05 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- JNK2 1 (5-20 mU diluted in 50 mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % b-mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 ⁇ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- Mercaptoethanol, ATF2 (3 ⁇ ), 10 mM magnesium acetate and 0.02 mM [33P-g- ATP] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature.
- ATF2 activating transcription factor in a final volume of 25.5 ⁇ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- Mercaptoethanol, ATF2 (3 ⁇ )
- 10 mM magnesium acetate and 0.02 mM [33P-g- ATP] 500 -1000 cpm/
- Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- DYRK3 assay DYRK3 (5-20 mU of diluted in 50 mM Tris pH7.5, 0.1 mM EGTA) is assayed against Woodtide (KKISGRLSPIMTEQ) in a final volume of 25.5 ⁇ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 350 ⁇ substrate peptide, 10 mM Magnesium acetate and 0.005 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- HIPK2 assay 5-20mU of HIPK2 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000
- HIPK3 assay 5-20mU of HIPK3 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- PAK4 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- PAK5 (PAK7)(5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- PAK6 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- CAMKKa diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol
- AKPKGNKDYHLQTCCGSLAYRRR in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.5mM CaCI2, 0.3 ⁇ calmodulin, 0.1 %, b- Mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- CAMKKb 5-20mU of CAMKKb (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against substrate peptide
- DGEFLRTSCGSPNYAARRR in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.5mM CaCI2, 0.3 ⁇ calmodulin, 0.1 %, b-Mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- PIM1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- PIM3 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- PLK1 assay PLK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA, 100 ⁇ Vanadate) is assayed against a substrate peptide (ISDELMDATFADQEAKKK) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 10 ⁇ Vanadate, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- BRSK2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- MELK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- PKC zeta (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA, 100 ⁇ Vanadate) is assayed against a substrate peptide (ERMRPRKRQGSVRRRV) in a final volume of 25.5 ⁇ containing 50mM
- Aurora C (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
- ERK1 5-20mU of ERK1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000
- FGF-R1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 5mM MnCI 2 , 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000
- IRR 5-20mU of IRR (diluted in 50mM Hepes (pH 7.5), 0.1 mM EGTA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Hepes (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- EPH-A2 assay EPH-A2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- MST4 5-20mU of MST4 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- SYK assay SYK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- substrate peptide Poly Glut Tyr
- YES1 assay YES1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- IGF-1 R (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKKSPGEYVNIEFG) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- VEG-FR (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKKSPGEYVNIEFG) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- BTK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KVEKIGEGTYGVVYK) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- KVEKIGEGTYGVVYK substrate peptide
- IR-HIS assay IR-HIS (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKSRGDYMTMQIG) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- EPH-B3 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- substrate peptide Poly Glut Tyr
- TBK1 (DU12569) (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKKKERLLDDRHDSGLDSMKDEE) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 300 ⁇ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- IKKepsilon (DU14231 )(diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- GCK (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5,0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- IRAK4 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- NUAK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against ALNRTSSDSALHRRR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM
- MLK1 assay MLK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- MINK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.05mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- MLK3 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- LKB1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against
- LSNLYHQGKFLQTFCGSPLYRRR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.2mM LSNLYHQGKFLQTFCGSPLYRRR, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 116. HER4 assay
- HER4 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against Poly Glut Tyr in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml Poly Glut Tyr, 10 mM magnesium acetate and 0.005mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 117. TTK assay
- TTK (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against RSRSRSRSRSRSRSR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM
- RSRSRSRSRSRSRSRSRSRSR 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50- 1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 120. RIPK2 assay
- RIPK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- Aurora A assay Aurora A (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against
- PAK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against RRRLSFAEPG in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM RRRLSFAEPG, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- BRSK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against KKLNRTLSFAEPG in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM
- KKLNRTLSFAEPG 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 65. HIPK3 assay
- HIPK3 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- HIPK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%)
- JNK3 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % ⁇ - mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 ⁇ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ -Mercaptoethanol, ATF2 (3 ⁇ ), 10 mM magnesium acetate and 0.02 mM [33 ⁇ - ⁇ - ⁇ ] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- ATF2 activating transcription factor in a final volume of 25.5 ⁇ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ -Mercapto
- MAPKAP-K3 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % ⁇ -mercaptoethanol, 1 mg/ml BSA) is assayed against
- KKLNRTLSVA in a final volume of 25.5I containing 50 mM Na ⁇ -glycerophosphate pH 7.5, 0.5 mM EDTA, 30 ⁇ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-Y-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.05mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- EPH-B4 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- substrate peptide Poly Glut Tyr
- JAK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.05% ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against PDKtide
- EPH-A4 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 134. TAK1 assay
- TAK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (RLGRDKYKTLRQIRQ) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ -Mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate, 0.5mM MnCI and 0.005 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature.
- a substrate peptide (RLGRDKYKTLRQIRQ) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ -Mercaptoethanol, 300 ⁇ substrate peptide, 10 mM magnesium acetate, 0.5mM MnCI and 0.005
- TrkA assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 135. TrkA assay
- TrkA (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- a substrate peptide Poly Glut Tyr
- MEKK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M
- CLK2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (RNRYRDVSPFDHSR) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.3mM peptide, 10mM DTT, 10 mM
- DAPK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide KKLNRTLSFAEPG) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.3mM peptide, 10mM DTT, 10 mM magnesium acetate and 0.005 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- EPH-B2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- substrate peptide Poly Glut Tyr
- TSSK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA, 10mM DTT) is assayed against
- KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- TESK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA, 10MM DTT) is assayed against Cofilin 2 in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.2mg/ml Cofilin 2, 10 mM magnesium acetate and 0.05mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 171. TTBK1 assay
- TTBK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % ⁇ - mercaptoethanol, 1 mg/ml BSA, 10mM DTT) is assayed against
- RRKDLHDDEEDEAMSITA in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM RRKDLHDDEEDEAMSITA, 10 mM magnesium acetate and 0.005mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 172.
- MST3 assay 5-20mU of MST3 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
- CSNK1 G2 (5-20 mU diluted in 20 mM Hepes pH7.5, 0.15 M NaCI, 0.1 mM EGTA, 0.1 % Triton X-100, 5 mM DTT, 50% glycerol) is assayed against
- RRKDLHDDEEDEAMSITA in a final volume of 25.5 ⁇ containing 20 mM Hepes pH 7.5, 0.15 M NaCI, 0.1 mM EDTA, 5 mM DTT, 0.1 % Triton-X 100,
- [33P-g-ATP] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- QIK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA,1 mg/ml Poly Glut Tyr), 10 mM magnesium acetate and 0.05 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- QSK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 1 mg/ml Poly Glut Tyr, 10 mM magnesium acetate and 0.05 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 177. WNK1 assay
- WNK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against OSR1 in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 10mM MnCI, 1 mg/ml OSR1 , 10 mM magnesium acetate and 0.02 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- CDK9/Cyclin T1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (YSPTSPSYSPTSPSYSPTSPKKK) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 1 mg/ml BSA, 0.3mM YSPTSPSYSPTSPSYSPTSPKKK, 10 mM magnesium acetate and 0.05 mM [33P- ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- YSPTSPSYSPTSPSYSPTSPKKK substrate peptide
- DDR2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (KKSRGDYMTMQIG) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mM substrate peptide 10 mM magnesium acetate and 0.005 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- OSR1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (RRHKKKDTHTNTYYLRTFGHNTRR) in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mM substrate peptide, 0.12mg/ml GST- M025, 10 mM magnesium acetate and 0.005 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- ULK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33mg/ml substrate, 10 mM magnesium acetate and 0.02 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 182.
- ULK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33mg/ml substrate, 10 mM magnesium acetate and 0.005 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- TTBK2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against substrate peptide RRKDLHDDEEDEAMSITA in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mM substrate, 10 mM magnesium acetate and 0.005 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- MAP4K3 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33 mg/ml substrate, 10 mM magnesium acetate and 0.02 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- MAP4K5 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33 mg/ml substrate, 10 mM magnesium acetate and 0.02mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- PDGFRA (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against substrate peptide KKKKEEIYFFFG in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 5mM MnCI 2 0.3mM substrate, 10 mM magnesium acetate and 0.005 mM [33 ⁇ - ⁇ - ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- TGFBR1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against substrate peptide RRKVLTQMGSPSIRCSS * VS in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 1 mM DTT, 5mM MnCI 2 , 0.3mM substrate, 10 mM magnesium acetate and 0.05 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 190. ERK5 assay
- ERK5 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33mg/ml substrate, 10 mM magnesium acetate and 0.05mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 194. PIN K1 assay
- PINK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against GST PARK2 TV3 in a final volume of 25.5 ⁇ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mg/ml substrate, 10 mM magnesium acetate and 0.005 mM [33 ⁇ - ⁇ - ⁇ ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 ⁇ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
- IGF-1R 3 9 55 57 24 15 13 4 2 16 70 9 26 51 37
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
The present invention provides a compound incorporating a group of formula (I) wherein: 1 of X, Y and Z is nitrogen and the other 2 are carbon; R" is hydrogen, methyl, ethyl or propyl; and W represents hydrogen, carbon, nitrogen, oxygen or sulphur; or incorporating a salt, hydrate or solvate of a group of formula (I); as well as therapeutic uses of these compounds, in particular as inhibitors of protein kinase activity and in the treatment of inflammation, inflammatory conditions and cancer.
Description
Compounds The present invention relates to novel chemical compounds, more particularly to novel pyrrolopyridines with activity as protein kinase inhibitors and thus of therapeutic use.
Protein kinases regulate a variety of cellular processes by adding phosphate groups to substrate proteins. The majority of kinases phosphorylate threonine, serine or tyrosine residues. Kinases play an important role in signal transduction and co-ordination of complex functions such as the cell cycle. There are over 500 human protein kinases, most of which have some sequence similarity. The general structure comprises an N- and C-terminal lobe joined at a hinge region close to an ATP binding site; phosphate groups are transferred from bound ATP to a protein substrate.
Kinases are of great therapeutic interest and many are targets for cancer treatment, treatment of inflammation and other conditions. Indeed, more than 400 human diseases have been connected to protein kinases. Kinase targets in cancer therapy include bcr-Abl, EGFR (epidermal growth factor receptor), Raf, VEGFR (vascular endothelial growth factor receptor), PDGFR (platelet-derived growth factor receptor), KIT and Aurora. It is estimated that the market for kinase inhibitors in cancer treatment will grow from $769 million in 2006 to more than $7.5 billion in 2016. Chemical discovery work on kinases has produced ATP-competitive compounds, allosteric regulators, irreversible binders and highly specific inhibitors. Although an inhibitor with high specificity for a single protein kinase may seem the most desirable, many clinical-stage kinase inhibitors are rather non-selective. In the cancer field, for example, clinicians may prefer multi-targeted drugs in order to maximise the chance for clinical antitumour activity and they will manage attendant toxicities. Kinase inhibition is a growing area and new cancer treatments are still highly sought after, thus a need for new protein kinase inhibitors/(PKIs) of narrow or broad specificity exists.
A range of PKIs are already available or in trial, usually with specific kinase targets, e.g. Imatinib against Bcr-Abl or Gefitinib against EGFR, although Dasatinib has multiple targets. Most existing PKIs are small molecules but monoclonal
antibodies such as Beracizumab (against VEGF) and Trastuzumab (against Erb2) also exist in growing numbers.
US 2008/0139606 describes a series of substituted pyrrolopyridines which inhibit kinases, in particular FAK, KDR, Tie2, Aurora A, Aurora B and CDK2. These molecules are described as being of particular utility in the treatment of cancer. These compounds incorporate two cyclic moieties linked to each other, optionally via a molecular linker as a single substituent on the pyrrole group. Independently, the present inventors have surprisingly found that a phenol group as pyrrole substituent results in PKIs of broad specificity.
Thus, in one aspect, the present invention provides a compound
incorporating a group of formula (I)
(I) wherein:
1 of X, Y and Z is nitrogen and the other 2 are carbon, preferably Y or X is nitrogen, more preferably Y is nitrogen;
the hydroxyl of the phenol moiety can be located in the ortho, meta or para position, preferably in the meta or para position, more preferably in the para position;
R" is hydrogen, methyl, ethyl or propyl, preferably hydrogen, methyl or ethyl; and
W represents hydrogen, carbon, nitrogen, oxygen or sulphur;
or a salt, hydrate or solvate of a group of formula (I).
Other than when W is hydrogen (forming an aldehyde at this position), the compound of the invention incorporating a group of formula (I) will not consist of a compound of formula (I) as the atom represented by W will be attached to another atom or atoms, thus forming a carboxylic acid derivative, suitable carboxylic acid derivatives are discussed below in the context of the definition of R' in compounds of formula (II).
The present invention thus also provides a compound of formula (II)
(II)
wherein:
1 of X, Y and Z is nitrogen and the other 2 are carbon, preferably Y or X is nitrogen, more preferably Y is nitrogen;
the hydroxyl of the phenol moiety can be located in the ortho, meta or para position, preferably in the meta or para position, more preferably in the para position;
R , together with the carbonyl group to which it is attached, is a carboxylic acid derivative, preferably a carboxylic acid derivative selected from an aldehyde, a ketone, an amide, an ester, a thioester, an acyl phosphate and an acyl
hydroxamate, more preferably the carboxylic acid derivative is an amide or ester with esters being most preferred; and
R" is hydrogen, methyl, ethyl or propyl, preferably hydrogen, methyl or ethyl; or a salt, hydrate or solvate of a compound of formula (II).
All potential stereoisomers of compounds incorporating a group of formula (I) or of formula (II) are encompassed within the invention and products may be racemic mixtures or enriched partially or essentially completely for one
stereoisomer or enantiomer.
R' (in formula (II)), or W and the atoms attached thereto (in formula (I)), has a molecular weight up to 500 Da, preferably up to 300 Da. This group may comprise 0-4, preferably 0-3 cyclic groups more preferably 1 -3, most preferably 1 or 2 cyclic groups (typically of 5 to 6 but possibly with 7 atoms in the ring).
Where two or more cyclic groups are present two or more of the cyclic groups may be fused but they may conveniently be linked rather than fused, the cyclic groups may be linked directly or there may be a linking group. Suitable linking groups typically comprise 1 -10 non-hydrogen atoms, preferably up to 7 non-hydrogen atoms, suitable linking groups include -CH2-, -NR-, -0-, -S-,
-CHRCHR-, -CH=CH-, -C=0-0-, -C=0-NR-, -0-CHR-, -NR-CHR-, -NR-C=0-NR-, -NR-C=0-0- and -CH2CH2CH2-; wherein R is H or Ci-2 alkyl. Linking groups are typically 1 to 4 atoms in length.
The cyclic groups are preferably, but may not be, aromatic, including heteroaromatic; if the group comprises two or more aromatic groups, then preferably no more than one of these groups is carbocyclic. Suitable cyclic groups include cyclohexyl, phenyl, pyridine, pyrazole, imidazole, thiazole, oxazole, furan, piperazine, pyrroline, pyrrolidine, diazolone, morpholine and piperidine. Two of the rings may be fused (e.g. phenyl and pyridine to form quinoline).
The cyclic groups may be unsubstituted or substituted, substituents typically comprise no more than 9, preferably no more than 6, more preferably no more than 4 non-hydrogen atoms and include: -OH, -OR, -NRR, -C=0-OR, -C=0-NRR, -S02- NRR, -NR-SO2R, -SO2R, -NR-C=OR, a halogen (e.g. F or CI), d-3 alkyl or fluoroalkyl; wherein each R (which may be the same or different) is H or Ci-3 alkyl. Typically there will be up to 3, more usually 1 or 2 substituting groups.
In certain preferred embodiments R' (in formula (II)), or W and the atoms attached thereto (in formula (I)), comprises no more than 18 non-hydrogen (heavy) atoms, preferably no more than 16 non-hydrogen atoms, more preferably no more than 12 non-hydrogen atoms, e.g. no more than 10 non-hydrogen atoms.
R' (in formula (II)), or W and the atoms attached thereto (in formula (I)), is preferably selected from hydrogen, -NH2 ,- OR-i, -Ri or -NR1R2 in which R2 is preferably hydrogen but may be a further Ri group and Ri may be a C-\.-\-\
(preferably Ci-6) alkyl, alkenyl, alkynyl or alkylamine, which may be linear or branched; Ri may comprise or consist of cyclic groups as described above which may be fused or linked, again as described above.
By way of example R' (in formula (I I)), or W and the atoms attached thereto (in formula (I)), may be hydrogen, -OCH3, -OCH2CH3, -OCH2CH2CH3 , -
OCH2CH2CH2CH3 , -IMHCH3, -NHCH2CH3, -NHCH2CH2CH3, -NHCH2CH2OH or -HCH2CH2N(CH2CH3)2; hydrogen, -OCH3, -OCH2CH3, or -NHCH2CH2OH are particularly preferred.
In other embodiments, Ri moieties comprising or consisting of cyclic groups are especially preferred and suitable groups are discussed above. A preferred set of substituents are represented by the formula R' = -NHR-i and some representative exampl
The meta or para position of the hydroxyl group is preferred in combination with all options at other positions allowing variation in substituents.
Likewise, Y being nitrogen and X and Z being carbon is a preferred configuration in combination with all options at other positions allowing variation in substituents.
Likewise, R' (in formula (II)), or W and the atoms attached thereto (in formula (I)), being selected from hydrogen, -OCH3, -OCH2CH3 or
-NHCH2CH2OH is preferred in combination with all options at other positions allowing variation in substituents.
Preferred compounds of the invention are described in the Examples and include compounds with the following compound identifiers: 942, 940, 1285, 1356, 4-41 , 4-31 , 4-43 and 4-49. Particularly preferred are compounds 942 and 940 with compound 942 most preferred.
As shown in the Examples, kinase inhibitory activity is very significantly influenced by the presence of hydroxyl in the phenyl moiety, as compared, for example, to an unsubstituted benzene ring or methoxy or amino substituent. The Examples also demonstrate the surprisingly broad specificity of the compounds of the present invention.
In a further aspect is provided the compounds of the present invention for use in therapy, particularly for use as a protein kinase inhibitor and thus for the treatment of diseases or other pathological conditions associated with aberrant
protein kinase activity or which would benefit from a reduction in protein kinase activity. More specifically, the compounds of the invention may be of use in the treatment of inflammation and inflammatory conditions and most especially in the treatment of cancer.
Methods of treating diseases or other pathological conditions associated with aberrant protein kinase activity or which would benefit from a reduction in protein kinase activity, which methods comprise administration to a human or animal patient of an effective amount of a compound of the invention, constitute further aspects of the present invention.
Methods of treating cancer, inflammatory conditions or inflammation, which methods comprise administration to a human or animal patient of an effective amount of a compound of the invention, constitute further aspects of the present invention.
The patient will typically have been identified as in need of treatment.
Treatments may be prophylactic but generally will not be.
In a further aspect, the present invention provides a method of inhibiting a protein kinase and/or a reaction catalysed by a protein kinase, the method comprising contacting said kinase with a compound of the present invention. Such methods may be in vivo or ex vivo, e.g. in vitro.
In a further aspect, the present invention provides the use of a compound of the invention in the manufacture of a medicament for the treatment of cancer, inflammatory conditions or inflammation.
In a further aspect, the present invention provides the use of a compound of the invention in the manufacture of a medicament for the treatment of a disease or other pathological condition associated with aberrant protein kinase activity or which would benefit from a reduction in protein kinase activity.
Animals which may be treated include domestic animals, in particular cats and dogs and livestock animals such as pigs, cows, sheep or goats as well as horses, also elephants. Treatment of humans is nevertheless preferred.
Methods for the synthesis of compounds of the invention are described in the Examples hereto, non-exemplified compounds can be prepared by methods which are analogous to the schemes and protocols described herein.
Methods of synthesising compounds of the invention, in particular methods described in the Examples, constitute a further aspect of the present invention. More particularly, in a further aspect, the present invention provides a method of
preparing a compound of formula (II) comprising reaction step II below, optionally and where appropriate, preceded by reaction step I.
Intermediate compounds of the invention as represented by formulae (ΙΙΓ), (III) and (IV) represent further aspects of the present invention. X, Y, Z, R' and R" in compounds of formulae (ΙΙΓ), (III) and (IV) are as defined herein for compounds of formula (II).
(III) (II)
Compounds of the invention, may, alternatively, be prepared as set out in the reaction scheme below in which X, Y, Z and Ri are as defined herein and Hal a halogen, typically bromine.
Thus, in a further aspect the present invention provides a method of preparing a compound of formula (II) comprising reaction step IV, optionally preceded by step III. In a further aspect is provided a method of preparing a compound of the invention comprising reaction step V , optionally preceded by step IV and optionally preceded by step III.
Intermediate compounds of the invention as represented by formulae (V) and (VI) constitute further aspects of the present invention.
(Π)
(Π)
Formulations comprising one or more compounds of the invention in admixture with a suitable diluent, carrier or excipient constitute a further aspect of the present invention. Such formulations may be for pharmaceutical use. Suitable diluents, excipients and carriers are known to the skilled man.
The compositions according to the invention may be presented, for example, in a form suitable for oral, nasal, parenteral, intravenal, topical or rectal administration.
As used herein, the term "pharmaceutical" includes veterinary applications of the products of the invention.
The active compounds defined herein may be presented in the conventional pharmacological forms of administration, such as tablets, coated tablets, nasal sprays, inhalers, solutions, emulsions, liposomes, powders, capsules or sustained release forms.
Conventional pharmaceutical excipients as well as the usual methods of production may be employed for the preparation of these forms. Tablets may be produced, for example, by mixing the active ingredient or ingredients with known excipients, such as for example with diluents, such as calcium carbonate, calcium phosphate or lactose, disintegrants such as corn starch or alginic acid, binders such as starch or gelatin, lubricants such as magnesium stearate or talcum, and/or agents for obtaining sustained release, such as carboxypolymethylene,
carboxymethyl cellulose, cellulose acetate phthalate, or polyvinylacetate.
The tablets may if desired consist of several layers. Coated tablets may be produced by coating cores, obtained in a similar manner to the tablets, with agents commonly used for tablet coatings, for example, polyvinyl pyrrolidone or shellac, gum arabic, talcum, titanium dioxide or sugar. In order to obtain sustained release or to avoid incompatibilities, the core may consist of several layers too. The tablet coat may also consist of several layers in order to obtain sustained release, in which case the excipients mentioned above for tablets may be used.
Injection solutions may, for example, be produced in the conventional manner, such as by the addition of preservation agents, such as
p-hydroxybenzoates, or stabilizers, such as EDTA. The solutions are then filled into injection vials or ampoules.
Nasal sprays administration may be formulated similarly in aqueous solution and packed into spray containers either with an aerosol propellant or provided with means for manual compression.
Capsules containing one or several active ingredients may be produced, for example, by mixing the active ingredients with inert carriers, such as lactose or sorbitol, and filling the mixture into gelatin capsules.
Suitable suppositories may, for example, be produced by mixing the active ingredient or active ingredient combinations with the conventional carriers envisaged for this purpose, such as natural fats or polyethyleneglycol or derivatives thereof.
The pharmaceutical compositions may additionally comprise further active ingredients, including, for example, other anti-inflammatory or chemotherapeutic agents. Likewise the medical uses and methods of treatment may additionally comprise further active ingredients, including, for example, other anti-inflammatory or chemotherapeutic agents. When the disease being treated is cancer, the therapeutic regimen may also include radiation therapy.
In employing such compositions systemically (intra-muscular, intravenous, intraperitoneal), the active molecule is generally present in an amount to achieve a serum level of the active molecule of at least about . A preferred serum level is about 1 - 10 micromolar Such serum levels may be achieved by incorporating the bioactive molecule in a composition to be administered systemically at a dose of from 50 mg - 250 mg.
It is appreciated that appropriate dosages will vary from patient to patient dependent on age, sex, previous treatments, severity of symptoms presented etc.
The above description describes numerous features of the present invention and in most cases preferred embodiments of each feature are described. It will be appreciated that each preferred embodiment of a given feature may provide a molecule, use, method etc. of the invention which is preferred, both when combined with the other features of the invention in their most general form and when combined with preferred embodiments of other features. The effect of selecting multiple preferred embodiments may be additive or synergistic. Thus all such combinations are contemplated unless the technical context obviously makes them mutually exclusive or contradictory. In general each feature and preferred embodiments of it are independent of the other features and hence combinations of preferred embodiments may be presented to describe sub-sets of the most general definitions without providing the skilled reader with any new concepts or information as such.
The invention will now be further described with reference to the following non-limiting Examples. Not all of the compounds synthesised and tested are within the scope of the present invention, some are provided for comparative purposes and highlight the efficacy of the molecules of the invention.
Examples
A. Synthesis Examples Reaction schemes are given throughout the Examples and three or four digit arabic numbers are given for each end product which is then tested. Roman numerals are used in the schemes and Examples for the intermediate compounds.
Example 1 . Preparation of 3-phenyl-1 H-pyrrolo[2,3-fe]pyridine-2-carbaldehyde (801 )
Step 1 . Preparation of /V-(pyridin-2-yl)pivalamide (I)
To a solution of 1 .88 g (20.0 mmol, 1 eq.) of 2-aminopyridine and 3.6 mL (26.0 mmol, 1.3 eq.) of triethylamine in 30 mL of DCM, cooled to 0°C, were added 2.7 mL (22.0 mmol, 1.1 eq.) of trimethylacetyl chloride in 4 mL of DCM. After 2 hours, the mixture was stirred one hour at room temperature. Then, 40 mL of water were added. The aqueous layer was extracted with 20 mL of dichloromethane. The organic phase was washed with 20 mL of aqueous NaHC03, dried, filtered and
concentrated. Purification over silica gel provided 2.40 g (13.5 mmol, 67%) of the title compound as a white solid. Rf=0.49 (PE/EtOAc 2:1 ). 1H NMR (300 MHz): δ = 8.24 (m, 2 H), 8.00 (broad, 1 H), 7.67 (t, J = 7.9 Hz, 1 H), 7.01 (m, 1 H), 1 .31 (s, 9 H) ppm. 13C NMR (75 MHz): δ = 177.2, 151.7, 147.8, 138.4, 1 19.8, 1 14.0, 39.9, 27.6 ppm.
Step 2. yV-(3-(hydroxy(phenyl)methyl)pyridin-2-yl)pivalamide (II)
To a solution of 2.67 g (15.0 mmol, 1 eq.) of pivalamide I and 6.5 mL (43.1 mmol, 3 eq.) of TMEDA in 1 15 mL of diethylether, cooled to -78°C, were added 17.3 mL (43.1 mmol, 3 eq., 2.5 M in hexane) of BuLi. After 15 minutes, the solution was brought back to -24°C and stirred 2 hours. Then, the mixture was cooled down to - 78°C before addition of 3.2 mL (31 .6 mmol, 2.2 eq) of benzaldehyde in 50 mL of THF. The reaction was brought back to 0°C and stirred 2 hours before being stirred at room temperature over night. Then, 100 mL of water were added. The aqueous layer was extracted with 3 x 60 mL of dichloromethane. The organic phase was dried, filtered and concentrated. Purification over silica gel provided 1.92 g (6.8 mmol, 47%) of II as a white solid. Rf=0.20 (PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 8.62 (s, 1 H), 8.30 (dd, J = 4.7 Hz, J = 1 .6 Hz, 1 H), 7.54 (dd, J = 7.7 Hz, J = 1 .5 Hz, 1 H), 7.29 (m, 5 H), 7.08 (dd, J = 7.6 Hz, J = 4.9 Hz, 1 H), 5.85 (s, 1 H), 4.93 (s, 1 H), 1.21 (s, 9 H) ppm. 13C NMR (75 MHz): δ = 178.6, 149.0, 147.7, 141.8, 138.9, 132.6, 128.4, 127.6, 126.4, 121 .5, 72.2, 39.7, 27.5 ppm.
Step 3. (2-aminopyridin-3-yl)(phenyl)methanone (III)
A solution of 1 .90 g (6.7 mmol, 1 eq.) of alcohol II and 2.90 g (33.4 mmol, 5 eq.) of activated Mn02 in 67 mL of DCM was refluxed 40 hours. The mixture was filtered on celite and the solvent was evaporated. Then, 130 mL of 3 M aqueous HCI were added and refluxed 24 hours. The reaction was cooled down to 0°C and 60 mL of aqueous ammonia were added. The aqueous layer was extracted with 3 x 50 mL of DCM. The organic phase was dried, filtered and concentrated. Purification over silica gel provided 1 .06 g (5.4 mmol, 80%) of III as a white solid. Rf=0.42 (PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 8.24 (dd, J = 4.7 Hz, J = 1 .7 Hz, 1 H), 7.76 (dd, J = 7.8 Hz, J = 1.6 Hz, 1 H), 7.60 (m, 2 H), 7.55 (m, 1 H), 7.46 (t, J = 7.2 Hz, 2 H), 6.91
(broad, 2 H), 6.59 (dd, J = 7.8 Hz, J = 4.8 Hz, 1 H) ppm. 13C NMR (75 MHz): δ = 197.8, 159.9, 154.0, 143.0, 139.2, 131 .6, 129.1 , 128.4, 1 12.9, 1 12.1 ppm.
Step 4. 3-phenyl-1 H-pyrrolo[2,3-fe]pyridine-2-carbaldehyde (801 )
To a solution of 2.0 mL (14.1 mmol, 4 eq.) of diisopropylamine in 12 mL of THF, cooled to 0°C, were added 5.7 mL (14.1 mmol, 4 eq., 2.5 M in hexane) of BuLi. The mixture was cooled to -78°C and 0.44 mL (5.3 mmol, 1 .5 eq.) of dichloroethylene were added. The system was brought back to 0°C and 700 mg (3.5 mmol, 1 eq.) of aminophenone III in 10 mL of THF were added. After one hour, 25 mL of aqueous NH4CI were added. The aqueous layer was extracted with 3 x 25 mL of
dichloromethane. The organic phase was dried, filtered and concentrated. The crude mixture was dissolved in 70 mL of dichloroethane and 70 mL of 0.1 M aqueous sulphuric acid were added. After 16 hours under reflux, the mixture was cooled down to room temperature and the pH was brought to 1 1 with Na2C03. The aqueous layer was extracted with 2 x 70 mL of dichloromethane. The organic layer was dried, filtered and concentrated. Purification over silica gel provided 120 mg (0.5 mmol, 15%) of compound 801 as a brown solid. Rf=0.53 (PE/EtOAc 2: 1 ). 1 H NMR (300 MHz): 5 = 13.06 (broad, 1 H), 10.04 (s, 1 H), 8.92 (dd, J = 4.7 Hz, J = 1 .5 Hz, 1 H), 8.22 (dd, J = 8.1 Hz, J = 1 .1 Hz, 1 H), 7.62 (m, 2 H), 7.56 (m, 2 H), 7.48 (m, 1 H), 7.26 (dd, J = 8.1 Hz, J = 4.8 Hz, 1 H) ppm. 13C NMR (75 MHz): δ = 183.2, 149.3, 149.0, 132.0, 131 .7, 130.6, 129.2, 128.4, 127.3, 1 19.8, 1 17.6 ppm. MS (CI): m/z = 222.1 . I .R. (neat): v 2800, 1661 . H .R.M.S. (CI): Calcd for Ci4Hn N20;
223.0871 . Found: 223.0865. mp 197 °C.
Example 2. Preparation of 3-phenyl-1 H-pyrrolo[2,3-c]pyridine-2-carbaldehyde (799) Step 1 . W-(pyridin-3-yl)pivalamide (IV)
To a solution of 1 .88 g (20.0 mmol, 1 eq.) of 3-aminopyridine and 3.6 mL (26.0 mmol, 1 .3 eq.) of triethylamine in 30 mL of DCM, cooled to 0°C, were added 2.7 mL (22.0 mmol, 1 .1 eq.) of trimethylacetyl chloride in 4 mL of DCM. After 2 hours, the mixture was stirred one hour at room temperature. Then, 40 mL of water were
added. The aqueous layer was extracted with 20 mL of dichloromethane. The organic phase was washed with 20 mL of aqueous NaHC03, dried, filtered and concentrated. Recrystallisation in PE/EtOAc 10:1 provided 3.14 g (17.6 mmol, 88%) of IV as a white solid. Rf=0.13 (PE/EtOAc 2:1 ). 1H NMR (300 MHz): δ = 8.55 (d, J = 2.4 Hz, 1 H), 8.29 (dd, J = 4.8 Hz, J = 0.9 Hz, 1 H), 8.1 1 (d, J = 8.1 Hz, 1 H), 7.76 (broad, 1 H), 7.21 (dd, J = 8.3 Hz, J = 4.7 Hz, 1 H), 1 .29 (s, 9 H) ppm. 13C NMR (75 MHz): 5 = 177.5, 145.2, 141.7, 135.1 , 127.7, 123.7, 39.8, 27.6 ppm.
Step 2. yV-(4-(hydroxy(phenyl)methyl)pyridin-3-yl)pivalamide (V)
To a solution of 2.67 g (15.0 mmol, 1 eq.) of pivalamide IV and 6.75 mL (45.0 mmol, 3 eq.) of TMEDA in 120 mL of diethylether, cooled to -78°C, were added 18.0 mL (45.0 mmol, 3 eq., 2.5 M in hexane) of BuLi. After 15 minutes, the solution was brought back to -24°C and stirred 2 hours. Then, the mixture was cooled down to - 78°C before addition of 3.35 mL (33.0 mmol, 2.2 eq) of benzaldehyde in 60 mL of THF. The reaction was brought back to 0°C and stirred 2 hours before being stirred at room temperature over night. Then, 120 mL of water were added. The aqueous layer was extracted with 3 x 80 mL of dichloromethane. The organic phase was dried, filtered and concentrated. Recrystallisation in DCM provided 1.60 g (5.6 mmol, 37%) of V as a white solid. Rf=0.16 (PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 9.33 (s, 1 H), 8.80 (s, 1 H), 8.20 (d, J = 4.9 Hz, 1 H), 7.34 (m, 5 H), 7.04 (d, J = 4.9 Hz, 1 H), 5.89 (s, 1 H), 4.54 (s, 1 H), 1.13 (s, 9 H) ppm. 13C NMR (75 MHz): δ = 177.1 , 144.9, 144.7, 140.0, 139.9, 133.9, 128.9, 128.5, 126.5, 123.1 , 74.9, 39.7, 27.5 ppm.
Step 3. (3-aminopyridin-4-yl)(phenyl)methanone (VI)
A solution of 1 .50 g (5.3 mmol, 1 eq.) of alcohol V and 2.30 g (26.4 mmol, 5 eq.) of activated Mn02 in 50 mL of DCM was refluxed 40 hours. The mixture was filtered on celite and the solvent was evaporated. Then, 100 mL of 3 M aqueous HCI were added and refluxed 16 hours. The reaction was cooled down to 0°C and 50 mL of aqueous ammonia were added. The aqueous layer was extracted with 3 x 50 mL of DCM. The organic phase was dried, filtered and concentrated. Purification over silica gel provided 1 .00 g (5.0 mmol, 96%) of VI as a yellow solid. Rf=0.28
(PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 8.28 (s, 1 H), 7.93 (d, J = 5.2 Hz, 1 H),
7.68 (d, J = 7.2 Hz, 2 H), 7.58 (t, J = 7.4 Hz, 1 H), 7.48 (t, J = 7.4 Hz, 2 H), 7.22 (d, J = 5.2 Hz, 1 H), 5.87 (broad, 2 H) ppm. 13C NMR (75 MHz): δ = 198.3, 144.5, 141 .4, 138.3, 136.8, 132.3, 129.5, 128.5, 125.1 , 122.0 ppm. Step 4. 3-phenyl-1 H-pyrrolo[2,3-c]pyridine-2-carbaldehyde (799)
To a solution of 2.55 mL (18.2 mmol, 4 eq.) of diisopropylamine in 15 mL of THF, cooled to 0°C, were added 7.3 mL (18.2 mmol, 4 eq., 2.5 M in hexane) of BuLi. The mixture was cooled to -78°C and 0.55 mL (6.8 mmol, 1 .5 eq.) of dichloroethylene were added. The system was brought back to 0°C and 900 mg (4.5 mmol, 1 eq.) of aminophenone VI in 7 mL of THF were added. After one hour, 30 mL of aqueous NH4CI were added. The aqueous layer was extracted with 3 x 30 mL of
dichloromethane. The organic phase was dried, filtered and concentrated. The crude mixture was dissolved in 80 mL of dichloroethane and 80 mL of 0.1 M aqueous sulphuric acid were added. After 16 hours under reflux, the mixture was cooled down to room temperature and the pH was brought to 1 1 with Na2C03. The aqueous layer was extracted with 2 x 120 mL of dichloromethane. The organic layer was dried, filtered and concentrated. The crude mixture was recrystallised in DCM providing 495 mg (2.2 mmol, 49%) of 799 as a brown solid. Rf=0.19 (PE/EtOAc 1 :2). 1 H NMR (300 MHz): δ = 10.03 (s, 1 H), 9.57 (broad, 1 H), 9.04 (s, 1 H), 8.41 (d, J = 5.6 Hz, 1 H), 7.73 (d, J = 5.5 Hz, 1 H), 7.55 (m, 5 H) ppm. 13C NMR (75 MHz): 5 = 183.6, 140.2, 137.0, 133.6, 133.3, 131 .4, 131 .0, 130.4, 129.3, 128.7, 127.7, 1 16.0 ppm. MS (ESI): m/z = 222.0. I.R. (neat): v 2718, 1672. H.R.M.S. (El): Calcd for Ci4H10N2O; 222.0788. Found: 222.0793. mp >220 °C.
Example 3. Preparation of 3-phenyl-1 H-pyrrolo[3,2-c]pyridine-2-carbaldehyde (800) Step 1 . W-(pyridin-4-yl)pivalamide (VII)
To a solution of 1 .88 g (20.0 mmol, 1 eq.) of 4-aminopyridine and 3.6 mL (26.0 mmol, 1 .3 eq.) of triethylamine in 30 mL of DCM, cooled to 0°C, were added 2.7 mL (22.0 mmol, 1 .1 eq.) of trimethylacetyl chloride in 4 mL of DCM. After 2 hours, the mixture was stirred one hour at room temperature. Then, 40 mL of water were
added. The aqueous layer was extracted with 20 mL of dichloromethane. The organic phase was washed with 20 mL of aqueous NaHC03, dried, filtered and concentrated. Recrystallisation in PE/EtOAc 8:1 provided 2.50 g (14.0 mmol, 70%) of VII as a white solid. Rf=0.07 (PE/EtOAc 2:1 ). 1H NMR (300 MHz): δ = 8.46 (d, J = 5.5 Hz, 2 H), 7.73 (broad, 1 H), 7.49 (dd, J = 4.9 Hz, J = 1 .4 Hz, 2 H), 1 .30 (s, 9 H) ppm. 13C NMR (75 MHz): δ = 177.5, 150.7, 145.3, 1 13.9, 40.1 , 27.5 ppm.
Step 2 and step 3. (4-aminopyridin-3-yl)(phenyl)methanone (IX) To a solution of 2.33 g (13.1 mmol, 1 eq.) of pivalamide VII and 5.9 mL (39.2 mmol, 3 eq.) of TMEDA in 105 mL of diethylether, cooled to -78°C, were added 15.7 mL (39.2 mmol, 3 eq., 2.5 M in hexane) of BuLi. After 15 minutes, the solution was brought back to -24°C and stirred 2 hours. Then, the mixture was cooled down to - 78°C before addition of 2.9 mL (28.8 mmol, 2.2 eq) of benzaldehyde in 50 mL of THF. The reaction was brought back to 0°C and stirred 2 hours before being stirred at room temperature over night. Then, 100 mL of water were added. The aqueous layer was extracted with 3 x 60 mL of dichloromethane. The organic phase was dried, filtered and concentrated. The crude mixture was purified over silica gel (PE/EtOAc 2:1 ) and the mixture (2 products, including VIII) was dissolved in 50 mL of DCM. Then, 2.30 g (26.4 mmol) of activated Mn02 were added and the reaction was refluxed 40 hours. The mixture was filtered on celite and the solvent was evaporated. The crude mixture was purified over silica gel (PE/EtOAc 1 :1 ). Then, 100 mL of 3 M aqueous HCI were added and refluxed 16 hours. The reaction was cooled down to 0°C and 50 mL of aqueous ammonia were added. The aqueous layer was extracted with 3 x 50 mL of DCM. The organic phase was dried, filtered and concentrated to yield 730 mg (3.7 mmol, 28%) of IX as a white solid. Rf=0.12 (PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 8.58 (s, 1 H), 8.22 (d, J = 5.9 Hz, 1 H), 7.67 (m, 2 H), 7.57 (m, 1 H), 7.49 (m, 2 H), 6.60 (d, J = 5.9 Hz, 1 H), 6.56 (broad, 2 H) ppm. 13C NMR (75 MHz): δ = 198.5, 156.0, 155.6, 152.0, 139.0, 131.9, 129.3, 128.5, 1 15.0, 1 1 1 .3 ppm.
Step 4. 3-phenyl-1 H-pyrrolo[3,2-c]pyridine-2-carbaldehyde (800)
To a solution of 1 .8 mL (12.5 mmol, 4 eq.) of diisopropylamine in 10 mL of THF, cooled to 0°C, were added 5.0 mL (12.5 mmol, 4 eq., 2.5 M in hexane) of BuLi. The
mixture was cooled to -78°C and 0.38 mL (4.7 mmol, 1 .5 eq.) of dichloroethylene were added. The system was brought back to 0°C and 620 mg (3.1 mmol, 1 eq.) of aminophenone IX in 10 mL of THF were added. After one hour, 20 mL of aqueous NH4CI were added. The aqueous layer was extracted with 3 x 20 mL of
dichloromethane. The organic phase was dried, filtered and concentrated. The crude mixture was dissolved in 60 mL of dichloroethane and 60 mL of 0.1 M aqueous sulphuric acid were added. After 16 hours under reflux, the mixture was cooled down to room temperature and the pH was brought to 1 1 with Na2C03. The aqueous layer was extracted with 2 x 80 mL of dichloromethane. The organic layer was dried, filtered and concentrated. The crude mixture was recrystallised in
DCM/PE 10: 1 providing 370 mg (1 .7 mmol, 53%) of 800 as a brown solid. Rf=0.15 (PE/EtOAc 1 :2). 1 H N MR (300 MHz): δ = 10.49 (broad, 1 H), 9.94 (s, 1 H), 9.18 (s, 1 H), 8.52 (d, J = 5.8 Hz, 1 H), 7.65 (d, J = 6.9 Hz, 2 H), 7.53 (m, 3 H), 7.43 (d, J = 5.6 Hz, 1 H) ppm. 13C NMR (75 MHz): δ = 182.9, 146.5, 145.1 , 140.6, 132.2, 130.7, 130.5, 129.4, 129.2, 128.7, 123.9, 107.4 ppm. MS (ESI): m/z = 222.0. I .R. (neat): v 2824, 2685, 1651 . H.R.M.S. (El): Calcd for Ci4H10N2O; 222.0788. Found: 222.0789. mp 199 °C.
Example 4. Preparation of 3-phenyl-1 H-pyrrolo[3,2-fe]pyridine-2-carbaldehyde (805)
Step 1 . yV-(2-bromopyridin-3-yl)pivalamide (X) To a solution of 1 .13 g (6.5 mmol, 1 eq.) of 3-amino-2-bromopyridine and 1 .2 mL (8.5 mmol, 1 .3 eq.) of triethylamine in 13 mL of DCM, cooled to 0°C, were added 0.9 mL (7.2 mmol, 1 .1 eq.) of trimethylacetyl chloride in 2 mL of DCM. After 3 hours at room temperature, 15 mL of water were added. The aqueous layer was extracted with 2 x 10 mL of dichloromethane. The organic phase was dried, filtered and concentrated. Purification over silica gel provided 1 .59 g (6.1 mmol, 93%) of X as a colourless oil. Rf=0.68 (PE/EtOAc 2: 1 ). 1 H NMR (300 MHz): δ = 8.69 (dd, J = 8.1 Hz, J = 1 .6 Hz, 1 H), 8.07 (dd, J = 4.6 Hz, J = 1 .6 Hz, 1 H), 8.02 (broad, 1 H), 7.26 (dd, J = 8.1 Hz, J = 4.7 Hz, 1 H), 1 .35 (s, 9 H) ppm. 13C NMR (75 MHz): δ = Ml A, 144.4, 133.8, 133.5, 128.6, 123.7, 40.3, 27.6 ppm.
Step 2 (and step 3 on the scheme). (3-aminopyridin-2-yl)(phenyl)methanone (XI)
To a solution of 1 .55 g (6.0 mmol, 1 eq.) of pivalamide X in 24 mL of THF, cooled to -78°C, were added 6.0 mL (15.1 mmol, 2,5 eq., 2.5 M in hexane) of BuLi. After one hour, 1 .50 g (9.0 mmol, 1 .5 eq.) of /V-methoxy-/V-methylbenzamide in 6 mL of THF were added dropwise. The reaction was stirred 18 hours at room temperature and 30 mL of water were added. The aqueous layer was extracted with 3 x 15 mL of dichloromethane. The organic phase was dried, filtered and concentrated. Then, 60 mL of 3 M aqueous HCI and 30 mL of methanol were added and refluxed 20 hours. The reaction was cooled down to 0°C and 30 mL of aqueous ammonia were added. The aqueous layer was extracted with 3 x 100 mL of DCM. The organic phase was dried, filtered and concentrated to yield 330 mg (1.6 mmol, 27%) of XI as a yellow solid. Rf=0.39 (PE/EtOAc 2:1 ). 1H NMR (300 MHz): δ = 8.06 (dd, J = 4.1 Hz, J = 1 .4 Hz, 1 H), 7.93 (m, 2 H), 7.52 (m, 1 H), 7.43 (m, 2 H), 7.21 (dd, J = 8.4 Hz, J = 4.1 Hz, 1 H), 7.09 (dd, J = 8.4 Hz, J = 1 .3 Hz, 1 H), 6.1 1 (broad, 2 H) ppm. 13C NMR (75 MHz): 5 = 197.2, 147.5, 139.1 , 137.9, 134.8, 131 .7, 130.7, 127.9, 127.8, 125.0 ppm.
Step 4. 3-phenyl-1 H-pyrrolo[3,2-fe]pyridine-2-carbaldehyde (805)
To a solution of 0.77 mL (5.5 mmol, 4 eq.) of diisopropylamine in 5 mL of THF, cooled to 0°C, were added 2.2 mL (5.5 mmol, 4 eq., 2.5 M in hexane) of BuLi. The mixture was cooled to -78°C and 0.17 mL (2.0 mmol, 1 .5 eq.) of dichloroethylene were added. The system was brought back to 0°C and 270 mg (1.4 mmol, 1 eq.) of aminophenone XI in 3 mL of THF were added. After one hour, 10 mL of aqueous NH4CI were added. The aqueous layer was extracted with 3 x 10 mL of
dichloromethane. The organic phase was dried, filtered and concentrated. The crude mixture was dissolved in 30 mL of dichloroethane and 30 mL of 0.1 M aqueous sulphuric acid were added. After 16 hours under reflux, the mixture was cooled down to room temperature and the pH was brought to 1 1 with Na2C03. The aqueous layer was extracted with 2 x 30 mL of dichloromethane. The organic layer was dried, filtered and concentrated. Purification over silica gel provided 30 mg (0.14 mmol, 10%) of 805 as an orange oil. Rf=0.32 (PE/EtOAc 2:1 ). 1H NMR (300 MHz): 5 = 10.05 (s, 1 H), 9.92 (broad, 1 H), 8.66 (dd, J = 7.4 Hz, J = 1.4 Hz, 1 H), 7.80 (m, 3 H), 7.52 (m, 2 H), 7.43 (m, 1 H), 7.33 (dd, J = 8.5 Hz, J = 4.4 Hz, 1 H)
ppm. 1JC NMR (75 MHz): δ = 183.7, 146.2, 143.4, 133.2, 131 .2, 131 .0, 130.6, 128.9, 128.6, 128.4, 121.9, 120.4 ppm. MS (CI): m/z = 222.1 . I.R. (neat): v 3285, 1643. H.R.M.S. (CI): Calcd for Ci4HnN20; 223.0871 . Found: 223.0866.
Example 5. Preparation of 3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2- carbaldehyde (942)
Step 1 and 2. (3-aminopyridin-4-yl)(4-methoxyphenyl)methanone (XIII)
To a solution of 2.67 g (15.0 mmol, 1 eq.) of pivalamide IV and 6.8 mL (45.0 mmol, 3 eq.) of TMEDA in 120 mL of dry diethylether, cooled to -78°C, were added 18.0 mL (45.0 mmol, 3 eq., 2.5 M in hexane) of BuLi. After 15 minutes, the solution was brought back to -24°C and stirred 2 hours. Then, the mixture was cooled down to - 78°C before addition of 4.0 mL (33.0 mmol, 2.2 eq) of p-anisaldehyde in 60 mL of THF. The reaction was brought back to 0°C and stirred 2 hours before being stirred at room temperature over night. Then, 120 mL of water were added. The aqueous layer was extracted with 2 x 80 mL of dichloromethane. The organic phase was dried, filtered and concentrated. The crude mixture was purified over silicagel. The obtained white solid (estimation 9 mmol of XII) was dissolved in 90 mL of DCM.
Then, 7.74 g (89.0 mmol, 10 eq.) of activated Mn02 were added and the reaction was refluxed 20 hours. The reaction was brought back to room temperature and 7.74 g (89.0 mmol, 10 eq.) of activated Mn02 were added again. After 20 hours to reflux, the mixture was filtered on celite and the solvent was evaporated. The crude mixture was dissolved in 180 mL of 3 M aqueous HCI were added and refluxed 16 hours. The reaction was cooled down to 0°C and 50 mL of aqueous ammonia were added. The aqueous layer was extracted with 3 x 90 mL of DCM. The organic phase was dried, filtered and concentrated. Purification over silica gel afforded 1.65 g (7.2 mmol, 48%) of XIII as a yellow solid. The yield varied from 38% to 48%. Rf=0.15 (PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 8.26 (s, 1 H), 7.94 (d, J = 5.1 Hz, 1 H), 7.72 (m, 2 H), 7.22 (m, 1 H), 6.96 (d, J = 5.1 Hz, 2 H), 5.58 (s, 2 H), 3.88 (s, 3 H) ppm. 13C NMR (75 MHz): δ = 196.5, 163.4, 144.0, 141.1 , 137.1 , 132.2, 130.6, 124.7, 123.4, 1 13.8, 55.6 ppm. Step 3. 3-(4-methoxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2-carbaldehyde (936)
To a solution of 1 .7 mL (12.3 mmol, 3.5 eq.) of diisopropylamine in 12 mL of THF, cooled to 0°C, were added 4.9 mL (12.3 mmol, 3.5 eq., 2.5 M in hexane) of BuLi. The mixture was cooled to -78°C and 0.42 mL (5.3 mmol, 1 .5 eq.) of
dichloroethylene were added. After 5 minutes, 0.03 mL (0.35 mmol, 0.1 eq.) of aniline were added. The cooling bath was removed and 620 mg (3.1 mmol, 1 eq.) of aminophenone XIII in 7 mL of THF were immediately added. Then, the reaction was brought back to 0°C and stirred one hour. After this time, 15 mL of water were added. The aqueous layer was neutralised with diluted sulphuric acid. The aqueous layer was extracted with 2 x 20 mL of EtOAc and with 2 x 20 mL of DCM. The organic phase was dried, filtered (the solid was washed with acetone) and concentrated. The crude mixture was dissolved in 50 mL of dichloroethane and 50 mL of 0.1 M aqueous sulphuric acid were added. After 18 hours under reflux, the mixture was cooled down to room temperature. The solid was filtered. The filtrate was decanted and the organic layer was extracted with 2 x 30 mL of 3 M aqueous HCI. The combined aqueous layers were neutralised with K2C03. Once again, the solid was filtered. The combined solids were recrystallised in 30 mL of
DCM/acetone 1 :2 providing 600 mg (2.4 mmol, 68%) of 936 as an ochre solid. The yield varied from 50% to 68%. Rf=0.30 (PE/EtOAc 1 :2). NMR data were taken in deuterated DMSO. 1H NMR (300 MHz): δ = 12.45 (broad, 1 H), 9.93 (s, 1 H), 8.92
(s, 1 H), 8.24 (d, J = 5.6 Hz, 1 H), 7.68 (d, J = 5.6 Hz, 1 H), 7.62 (d, J = 8.6 Hz, 2 H), 7.12 (d, J = 8.6 Hz, 2 H), 3.84 (s, 3 H) ppm. 13C NMR (75 MHz): δ = 183.7, 159.2, 138.9, 137.3, 133.7, 133.4, 131 .5, 129.8, 125.5, 123.4, 1 15.3, 1 14.6, 55.3 ppm. MS (ESI): m/z = 252.1 . I.R. (neat): v 2999, 1651 . H.R.M.S. (ESI): Calcd for Ci5H13N202; 253.0977. Found: 253.0976. mp >220 °C.
Step 4. 3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2-carbaldehyde (942)
To a suspension of 320 mg (1.3 mmol, 1 eq.) of methyl ether 936 in 25 mL of DCM cooled to -78°C were added dropwise 0.62 mL (6.5 mmol, 5 eq.) of BBr3 in 7 mL of DCM. After one hour, the reaction was brought back to 0°C and then stirred at room temperature overnight. Then, the reaction was poured on 30 g of ice. The two layers were decanted and the organic layer was extracted with 20 mL of 3 M aqueous HCI. The combined aqueous phases were neutralised (pH 6-7) with Na2C03. The mixture was filtered and the obtained gel triturated with diethylether. Then, the solid was triturated in 10 mL of hot acetone. The solid was collected and dried under vacuum providing 151 mg (0.65 mmol, 50%) of 942 as brown solid. The yield varied from 36% to 50%. Rf=0.21 (EtOAc). NMR data were taken in deuterated DMSO. 1H NMR (300 MHz): δ = 12.39 (s, 1 H), 9.92 (s, 1 H), 9.78 (s, 1 H), 8.90 (s, 1 H), 8.23 (d, J = 5.4 Hz, 1 H), 7.67 (d, J = 5.2 Hz, 1 H), 7.49 (d, J = 8.1 Hz, 2 H), 6.95 (d, J = 8.1 Hz, 2 H) ppm. 13C NMR (75 MHz): δ = 183.7, 157.6, 138.8, 137.3, 133.7, 133.3, 131.5, 129.8, 126.2, 121 .7, 1 16.0, 1 15.4 ppm. MS (ESI): m/z = 238.1 . I.R. (neat): v 3263, 1645. H.R.M.S. (ESI): Calcd for C HnNzOz; 239.0821. Found: 239.0825. mp > 220 °C.
Example 6. 3-(4-hydroxyphenyl)-1 H-pyrrolo[3,2-c]pyridine-2-carbaldehyde (940) Step 1 . yV-(3-(hydroxy(4-methoxyphenyl)methyl)pyridin-4-yl)pivalamide (XIV)
To a solution of 2.67 g (15.0 mmol, 1 eq.) of pivalamide VII and 6.8 mL (45.0 mmol, 3 eq.) of TMEDA in 120 mL of diethylether, cooled to -78°C, were added 18.0 mL (45.0 mmol, 3 eq., 2.5 M in hexane) of BuLi. After 15 minutes, the solution was brought back to -24°C and stirred 2 hours. Then, the mixture was cooled down to -
78°C before addition of 4.0 mL (33.0 mmol, 2.2 eq) of p-anisaldehyde in 60 mL of THF. The reaction was brought back to 0°C and stirred 2 hours before being stirred at room temperature over night. Then, 120 mL of water were added. The aqueous layer was extracted with 3 x 80 mL of dichloromethane. The organic phase was dried, filtered and concentrated. Precipitation in 30 mL of PE/DCM 1 :1 afforded 3.26 g (10.4 mmol, 69%) of XIV as a white powder. Rf=0.16 (PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 9.57 (s, 1 H), 8.36 (d, J = 5.7 Hz, 1 H), 8.23 (d, J = 5.7 Hz, 1 H), 7.87 (s, 1 H), 7.18 (d, J = 8.5 Hz, 2 H), 6.89 (broad, 1 H), 6.83 (d, J = 8.3 Hz, 2 H), 5.78 (s, 1 H), 3.77 (s, 3 H), 1 .08 (s, 9 H) ppm. 13C NMR (75 MHz): δ = 177.9, 159.4, 149.8, 148.4, 145.6, 133.0, 127.5, 126.4, 1 15.3, 1 14.0, 73.2, 55.5, 40.2, 27.2 ppm.
Step 2. (4-aminopyridin-3-yl)(4-methoxyphenyl)methanone (XV) To a solution of 3.15 g (10.0 mmol, 1 eq.) of XIV in 100 mL of DCM, 8.71 g (100.0 mmol, 10 eq.) of activated Mn02 were added and the reaction was refluxed 40 hours. The mixture was filtered on celite and the solvent was evaporated. The crude mixture was dissolved in 200 mL of 3 M aqueous HCI were added and refluxed 16 hours. The reaction was cooled down to 0°C and 50 mL of aqueous ammonia were added. The aqueous layer was extracted with 3 x 100 mL of DCM. The organic phase was dried, filtered and concentrated yielding 1 .45 g (6.3 mmol, 63%) of XV as a white powder. Rf=0.09 (PE/EtOAc 1 :2). 1H NMR (300 MHz): δ = 8.57 (s, 1 H), 8.18 (d, J = 5.9 Hz, 1 H), 7.69 (m, 2 H), 6.96 (m, 2 H), 6.58 (d, J = 5.9 Hz, 1 H), 6.49 (broad, 2 H), 3.87 (s, 3 H) ppm. 13C NMR (75 MHz): δ = 196.8, 162.9, 155.4, 155.3, 151 .7, 131 .9, 131 .4, 1 15.4, 1 13.8, 1 1 1.2, 55.6 ppm.
Step 3. 3-(4-methoxyphenyl)-1 H-pyrrolo[3,2-c]pyridine-2-carbaldehyde (937)
To a solution of 3.4 mL (23.7 mmol, 4 eq.) of diisopropylamine in 15 mL of THF, cooled to 0°C, were added 9.5 mL (23.7 mmol, 4 eq., 2.5 M in hexane) of BuLi. The mixture was cooled to -78°C and 0.71 mL (8.9 mmol, 1 .5 eq.) of dichloroethylene were added. The system was brought back to 0°C and 1 .35 g (5.9 mmol, 1 eq.) of aminophenone XV in 15 mL of THF were added. After one hour, 40 mL of aqueous NH4CI were added. The aqueous layer was extracted with 3 x 40 mL of
dichloromethane. The organic phase was dried, filtered and concentrated. The
crude mixture was dissolved in 120 mL of dichloroethane and 120 mL of 0.1 M aqueous sulphuric acid were added. After 16 hours under reflux, the mixture was cooled down to room temperature and the pH was brought to 1 1 with Na2C03. The aqueous layer was extracted with 2 x 150 mL of dichloromethane. The organic layer was dried, filtered and concentrated. The crude mixture was recrystallised in
DCM/PE 2:1 providing 970 mg (3.8 mmol, 65%) of 937 as an ochre solid. Rf=0.20 (PE/EtOAc 1 :2). NMR data were taken in deuterated DMSO. 1H NMR (300 MHz): δ = 12.39 (broad, 1 H), 9.83 (s, 1 H), 9.00 (s, 1 H), 8.37 (d, J = 5.7 Hz, 1 H), 7.67 (d, J = 8.5 Hz, 2 H), 7.43 (d, J = 5.6 Hz, 1 H), 7.12 (d, J = 8.5 Hz, 2 H), 3.84 (s, 3 H) ppm. 13C NMR (75 MHz): δ = 182.7, 159.5, 145.6, 144.3, 140.5, 132.1 , 131.7,
127.2, 123.1 , 123.1 , 1 14.7, 107.8, 55.3 ppm. MS (ESI): m/z = 252.1 . I.R. (neat): v 3327, 1666. H.R.M.S. (ESI): Calcd for Ci5H13N202; 253.0977. Found: 253.0984. mp 182 °C. Step 4. 3-(4-hydroxyphenyl)-1 H-pyrrolo[3,2-c]pyridine-2-carbaldehyde (940)
To a suspension of 770 mg (3.0 mmol, 1 eq.) of methyl ether 937 in 60 mL of DCM cooled to -78°C were added dropwise 1 .5 mL (15.3 mmol, 5 eq.) of BBr3. After one hour, the reaction was brought back to 0°C and then stirred at room temperature overnight. Then, the reaction was cooled to 0°C and 5 mL of water were added dropwise, followed by 50 mL of 3 M aqueous HCI. The organic layer was extracted with 50 mL of 3 M aqueous HCI. The aqueous layers were neutralised with Na2C03. The precipitate was collected and washed with 50 mL of acetone. The filtrate was evaporated and the brown solid was precipitated in 5 mL of acetone. The solid was removed by filtration and the filtrate was evaporated providing 370 mg (1.6 mmol, 51 %) of 940 as an ochre solid. Rf=0.12 (PE/EtOAc 1 :2). NMR data were taken in deuterated DMSO. 1H NMR (300 MHz): δ = 12.45 (broad, 1 H), 9.84 (s, 2 H), 9.04 (s, 1 H), 8.37 (d, J = 5.9 Hz, 1 H), 7.56 (d, J = 8.4 Hz, 2 H), 7.47 (d, J = 5.9 Hz, 1 H), 6.97 (d, J = 8.4 Hz, 2 H) ppm. 13C NMR (75 MHz): δ = 182.7, 157.9, 145.1 , 143.2, 140.7, 132.2, 131 .8, 128.0, 123.1 , 121.2, 1 16.1 , 108.8 ppm. MS (ESI): m/z = 238.1 . I.R. (neat): v 3265, 1643. H.R.M.S. (ESI): Calcd for Ci4HnN202; 239.0821. Found: 239.0826. mp 220 °C.
Step 1 Step 2 Step 3
Product
R=Me XIX 1285
XVIII
R=Bn XX 1286
Example 7. Preparation of 3-(4-hydroxyphenyl)-1 -(phenylsulfonyl)-1 H- pyrrolo[2,3-c]pyridine-2-carbaldehyde (1285) Step 1. 3-(4-(ieri-butyldimethylsilyloxy)phenyl)-1 H-pyrrolo[2,3-c]pyridine-2- carbaldehyde (XVIII)
To a solution of 750 mg (3.1 mmol, 1 eq.) of hydroxypyrrolopyridine 942 in 15 mL of DMF were added 860 mg (12.6 mmol, 4 eq.) of imidazole and 1.14 g (7.6 mmol, 2.4 eq.) of TBSCI. After 20 hours, 100 mL of water were added. The aqueous layer was extracted with 3 x 75 mL of DCM. The organic phase was dried, filtered and concentrated. The DMF was then removed under high vacuum. Purification over silica gel afforded 600 mg (1 .7 mmol, 54%) of XVIII as an ochre solid. Rf=0.38 (EtOAc). 1H NMR (300 MHz): δ = 10.28 (s, 1 H), 10.03 (s, 1 H), 9.09 (s, 1 H), 8.42 (d, J = 5.6 Hz, 1 H), 7.73 (d, J = 5.5 Hz, 1 H), 7.47 (m, 2 H), 7.02 (m, 2 H), 1 .03 (s, 9 H), 0.28 (s, 6 H) ppm. 13C NMR (75 MHz): δ = 183.8, 156.4, 139.7, 137.0, 133.6, 131 .6, 131 .4, 127.8, 123.9, 120.9, 1 16.2, 25.8, 18.4, -4.2 ppm. MS (ESI): m/z = 352.2. I.R. (neat): v 2951 , 1674. H.R.M.S. (ESI): Calcd for C2oH25N202Si; 353.1680. Found: 353.1680. mp 210 °C.
Step 2. 3-(4-((ferf-butyldimethylsilyl)oxy)phenyl)-1 -methyl-1 H-pyrrolo[2,3- c]pyridine-2-carbaldehyde (XIX)
To a solution of 1 .3 mg (3.2 μηιοΙ, 0.016 eq.) of Aliquat 336 in 0.6 mL of DCM, were added 0.3 mL of water, 40 mg (1 .0 mmol, 5 eq.) of NaOH and 71 mg (0.20 mmol, 1 eq.) of pyrrolopyridine XVIII. Then, 0.02 mL (0.22 mmol, 1 .1 eq.) of dimethylsulfate were added dropwise. The mixture was stirred one hour before addition of 5 mL of DCM and 5 mL of water. The organic layer was decanted, dried, filtered and concentrated. Purification over silica gel afforded 26 mg (0.07 mmol, 36%) of XIX as an orange oil. Rf=0.56 (EtOAc). 1H NMR (300 MHz): δ = 10.02 (s, 1 H), 8.97 (s, 1 H), 8.35 (d, J = 5.5 Hz, 1 H), 7.62 (dd, J = 5.6 Hz, J = 0.6 Hz, 1 H), 7.36 (m, 2 H), 6.98 (m, 2 H), 4.22 (s, 3 H), 1 .02 (s, 9 H), 0.27 (s, 6 H) ppm. 13C NMR (75 MHz): δ = 185.2, 156.2, 139.6, 135.5, 135.4, 132.4, 131 .9, 130.1 , 129.8, 123.9, 120.7, 1 15.6, 32.4, 25.8, 18.4, -4.2 ppm. MS (ESI): m/z = 366.2. I.R. (neat): v 2949, 2926, 2856, 1666. H.R.M.S. (ESI): Calcd for C2iH27N202Si; 367.1836. Found: 367.1835.
Step 3. 3-(4-hydroxyphenyl)-1 -methyl-1 H-pyrrolo[2,3-c]pyridine-2- carbaldehyde (1285) To a solution of 55 mg (0.15 mmol, 1 eq.) of pyrrolopyridine XIX in 0.75 mL of THF were added 0.22 mL (0.23 mmol, 1.5 eq., 1 M in THF). After 15 minutes, 5 mL of water and 5 mL of DCM were poured in the reaction. The aqueous layer was extracted with 3 x 5 mL of DCM. The combined organic layers were dried, filtered and concentrated. Recrystallization in 3 mL of PE/DCM 2:1 afforded 24 mg (0.09 mmol, 63%) of 1285 as an ochre-orange solid. NMR data were taken in deuterated DMSO. Rf=0.38 (EtOAc). 1H NMR (300 MHz): δ = 9.93 (s, 1 H), 9.78 (s, 1 H), 9.13 (s, 1 H), 8.27 (d, J = 5.3 Hz, 1 H), 7.61 (d, J = 5.4 Hz, 1 H), 7.39 (d, J = 8.4 Hz, 2 H), 6.94 (d, J = 8.4 Hz, 2 H), 4.15 (s, 3 H) ppm. 13C NMR (75 MHz): δ = 184.7, 157.6, 139.1 , 136.1 , 134.9, 131 .7, 128.8, 128.4, 121.2, 1 15.9, 1 14.9, 32.1 ppm. MS (ESI): m/z = 252.1 . I.R. (neat): v 1668. H.R.M.S. (ESI): Calcd for Ci5H13N202; 253.0971. Found: 252.0971. mp >220 °C.
Example 8. Preparation of 1 -benzyl-3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3- c]pyridine-2-carbaldehyde (1286)
Step 1. XVIII is already described in example 7.
Step 2. 1 -benzyl-3-(4-((ferf-butyldimethylsilyl)oxy)phenyl)-1 H-pyrrolo[2,3- c]pyridine-2-carbaldehyde (XX)
To a solution of 1 .3 mg (3.2 μηιοΙ, 0.016 eq.) of Aliquat 336 in 0.6 mL of DCM, were added 0.3 mL of water, 40 mg (1.0 mmol, 5 eq.) of NaOH and 71 mg (0.20 mmol, 1 eq.) of pyrrolopyridine XVIII. Then, 0.04 mL (0.30 mmol, 1 .5 eq.) of dimethylsulfate were added dropwise. The mixture was stirred three hours before addition of 5 mL of DCM and 5 mL of water. The organic layer was decanted, dried, filtered and concentrated. Purification over silica gel afforded 26 mg (0.07 mmol, 36%) of XX as an orange oil. Rf=0.15 (EtOAc/MeOH 10:1 ). 1H NMR (300 MHz): δ = 10.40 (s, 1 H), 8.70 (s, 1 H), 7.77 (d, J = 6.8 Hz, 1 H), 7.40 (m, 6 H), 7.24 (m, 2 H), 6.93 (m, 2 H), 5.47 (s, 2 H), 1.01 (s, 9 H), 0.25 (s, 6 H) ppm. 13C NMR (75 MHz): δ = 190.6, 155.1 , 154.8, 142.7, 135.8, 135.2, 134.1 , 131.1 , 129.7, 129.6, 128.0, 126.8, 125.2, 122.6, 120.2, 1 17.4, 63.2, 25.9, 18.4, -4.2 ppm. MS (ESI): m/z = 442.2. I.R. (neat): v 2926, 1674. H.R.M.S. (ESI): Calcd for C27H31 N2O2S1; 443.2149. Found: 443.2149. mp 177 °C.
Step 3. 1 -benzyl-3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2- carbaldehyde (1286)
To a solution of 34 mg (0.077 mmol, 1 eq.) of pyrrolopyridine XX in 0.40 mL of THF were added 0.12 mL (0.12 mmol, 1.5 eq., 1 M in THF). After 15 minutes, 5 mL of water and 5 mL of DCM were poured in the reaction. The aqueous layer was extracted with 3 x 5 mL of DCM. The combined organic layers were dried, filtered and concentrated. Recrystallization in 3 mL of DCM afforded 14 mg (0.043 mmol, 55%) of 1286 as an orange solid. NMR data were taken in deuterated DMSO.
Rf=0.08 (EtOAc/MeOH 10:1 ). 1H NMR (300 MHz): δ = 10.22 (s, 1 H), 9.45 (broad, 1 H), 9.31 (s, 1 H), 7.88 (d, J = 6.7 Hz, 1 H), 7.75 (d, J = 6.8 Hz, 1 H), 7.30 to 7.48 (m, 7 H), 6.84 (d, J = 8.5 Hz, 2 H), 5.68 (s, 2 H) ppm. 13C NMR (75 MHz): δ = 190.4, 156.0, 153.2, 141 .6, 137.0, 136.3, 133.7, 130.7, 129.0, 128.6, 128.0, 126.7, 124.5, 120.4, 1 16.6, 1 15.1 , 61 .1 ppm. MS (ESI): m/z = 328.1 . I.R. (neat): v 3298, 1672,
1610. H.R.M.S. (ESI): Calcd for C2iH17N202; 329.1285. Found: 329.1287. mp >220 °C.
Example 9. Preparation of yV-(2-(diethylamino)ethyl)-3-(4-hydroxyphenyl)-1 H- pyrrolo[2,3-c]pyridine-2-carboxamide (1356)
Step 1. methyl 3-(4-((ferf-butyldimethylsilyl)oxy)phenyl)-1 H-pyrrolo[2,3- c]pyridine-2-carboxylate (XXI)
To a solution of 21 mg (0.06 mmol, 1 eq.) of XVIII in 1 .5 mL of methanol were added 20 mg (0.30 mmol, 5 eq.) of KCN. Then, 100 mg (1 .2 mmol, 20 eq.) of Mn02 were carefully added (ignition) followed by 0.01 mL (0.18 mmol, 3 eq.) of acetic acid. After 4 hours, the solid was filtered and washed with 20 mL of DCM. The filtrate was washed with 15 mL of water. The organic phase was dried, filtered and concentrated to yield 22 mg (0.06 mmol, 96%) of XXI as a yellow solid. Rf=0.32 (EtOAc). 1H NMR (300 MHz): δ = 10.13 (broad, 1 H), 9.00 (s, 1 H), 8.34 (d, J = 5.4 Hz, 1 H), 7.59 (d, J = 5.5 Hz, 1 H), 7.41 (m, 2 H), 6.95 (m, 2 H), 3.86 (s, 3 H), 1.03 (s, 9 H), 0.27 (s, 6 H) ppm. 13C NMR (75 MHz): δ = 162.2, 155.5, 139.1 , 135.8, 132.7, 132.6, 131.6, 125.7, 125.2, 123.1 , 1 19.8, 1 16.0, 52.3, 25.8, 18.4, -4.2 ppm. MS (CI): m/z = 383.2. I.R. (neat): v 2957, 2928, 2897, 171 1. H.R.M.S. (CI): Calcd for C2iH27N203Si; 383.1786. Found: 383.1785. mp 206 °C.
Step 2. yV-(2-(diethylamino)ethyl)-3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3- c]pyridine-2-carboxamide (1356)
To a solution of 92 mg (0.24 mmol, 1 eq.) of ester XXI in 0.25 mL of DCM were added 0.70 mL (4.8 mmol, 20 eq.) of diethylethylenediamine. The mixture was heated to 40°C in order to evaporate the DCM. Then, the mixture was sealed for 34 hours. The reaction was cooled to room temperature. The solvent was
concentrated. The amine was removed under vacuum at room temperature. The orange oil was dissolved in 3 mL of THF. Then, 0.36 mL (0.36 mmol, 1.5 eq., 1 M in THF) of TBAF were added. After 30 minutes, the solvent was evaporated. The red oil was dissolved in 5 mL of DCM before addition of 5 mL of water. The mixture was stirred for 2 minutes. Then, 10 mL of diethylether and 20 mL of petroleum ether were added. The mixture was cooled to 0°C for 30 minutes. The solid was collected, washed with petroleum ether and dried under vacuum to give 58 mg (0.17 mmol, 69%) of 1356 as an ochre solid. NMR data were taken in deuterated
DMSO. Rf=0.02 (EtOAc). 1H NMR (300 MHz): δ = 12.12 (broad, 1 H), 9.59 (broad, 1 H), 8.81 (s, 1 H), 8.13 (d, J = 4.2 Hz, 1 H), 7.38 (d, J = 5.0 Hz, 1 H), 7.29 (d, J = 8.5 Hz, 3 H), 6.90 (d, J = 8.5 Hz, 2 H), 3.29 (q, J = 5.8 Hz, 2 H), 2.43 (m, 6 H), 0.86 (t, J = 7.0 Hz, 6 H) ppm. 13C NMR (75 MHz): δ = 160.9, 157.0, 138.4, 135.7, 132.1 , 131 .2, 130.9, 130.6, 122.6, 1 15.8, 1 14.2, 50.5, 45.9, 36.7, 1 1 .1 ppm. MS (ESI): m/z = 353.2. I.R. (neat): v 2970, 1632. H.R.M.S. (ESI): Calcd for CzoH^Oz; 353.1972. Found: 353.1973. mp >210 °C.
Example 10. Preparation of Ethyl 3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3- c]pyridine-2-carboxylate (4-31 )
Step 1
Ethyl 3-bromo-1 H-pyrrolo[2,3-c]pyridine-2-carboxylate
To a solution of ethyl 1 /-/-pyrrolo[2,3-c]pyridine-2-carboxylate (1.36 g, 7.15 mmol) in pyridine (90 ml) was added dropwise a solution of pyridinium tribromide (2.15 g, 6.72 mmol) in pyridine (20 ml), at 0 °C. The reaction mixture is then stirred overnight at room temperature. 300 ml ice water was added and the resulting suspension stirred for 30 minutes, filtered and the precipitated material washed with water and dried to afford 0.92 g (51 %) of the title compound as a colorless solid.
1H NMR (400 MHz, DMSO) δ 12.76 (s, 1 H), 8.88 (s, 1 H), 8.28 (d, J = 4.8, 1 H), 7.52 (d, J = 4.8, 1 H), 4.41 (d, J = 6.9, 2H), 1 .38 (t, J = 6.7, 3H).
Step 2
Ethyl 3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2-carboxylate
To a solution of ethyl 3-bromo-1 H-pyrrolo[2,3-c]pyridine-2-carboxylate(107 mg, 0.40 mmol) in dioxane (10 ml) are added 4-hydroxyphenyl boronic acid (83 mg, 0.60 mmol), potassium fluoride (120 mg, 2.06 mmol) and water (1 ml). The reaction mixture was stirred under argon for 15 minutes. Tetrakis(triphenylphosphine)palladium(0) (90 mg, 0.08 mmol) and triethylamine (70 μΙ, 0.50 mmol) were added and the reaction mixture stirred overnight at reflux. After cooling to room temperature, 1 M HCI (10 ml) was added and the aqueous phase extracted with CHCI3 : EtOH 90 : 10, x2). The combined organic extract was dried (MgS04), filtered an concentrated. Flash chromatography (Heptane : EtOAc gradient) followed by trituration with EtOAc afforded 50 mg (44%) of the title compound as a pale yellow solid.
1H NMR (400 MHz, DMSO) δ 12.25 (s, 1 H), 9.50 (s, 1 H), 8.87 (s, 1 H), 8.17 (d, J = 5.6, 1 H), 7.46 (d, J = 5.6, 1 H), 7.33 (d, J = 8.4, 2H), 6.85 (d, J = 8.4, 2H), 4.27 (q, J = 7.1 , 21-1), 1 .23 (t, J = 7.1 , 3H).
Example 1 1. Preparation of Ethyl 3-(3-hydroxyphenyl)-1 H-pyrrolo[2,3- c]pyridine-2-carboxylate (4-41 )
Ethyl 3-(3-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2-carboxylate
To a solution ethyl 3-bromo-1 H-pyrrolo[2,3-c]pyridine-2-carboxylate(269 mg, 1.00 mmol) in dioxane (25 ml) are added 3-hydroxyphenyl boronic acid (209 mg, 1.51 mmol), potassium fluoride (301 mg, 5.18 mmol) and water (2.5 ml). The reaction mixture was stirred under argon for 15 minutes. Tetrakis(triphenylphosphine)palladium(0) (226 mg, 0.20 mmol) and triethylamine (176 μΙ, 1 .25 mmol) were added and the reaction mixture stirred overnight at reflux. After cooling to room temperature, 1 M HCI (10 ml) was added and the aqueous phase extracted with CHCI3 : EtOH 90 : 10, x2). The combined organic extract was dried (MgS04), filtered an concentrated. Flash chromatography (Heptane : EtOAc gradient) followed by trituration with EtOAc afforded 124 mg (44%) of the title compound as a pale yellow solid.
1H NMR (400 MHz, DMSO) δ 13.65 (s, 1 H), 9.60 (s, 1 H), 9.19 (s, 1 H), 8.34 (d, J = 6.4, 1 H), 7.99 (d, J = 6.4, 1 H), 7.36 (s, 1 H), 7.29 (t, J = 8.1 , 1 H), 7.23 (s, 1 H), 7.10 (s, 1 H), 6.86 (d, J = 7.9, 1 H), 4.33 (q, J = 7.1 , 2H), 1 .23 (t, 3H).
e 12. Preparation of N-(2-Hydroxyethyl)-3-(4-hydroxyphenyl)-1 H- o [2 , 3 -c] py r i d i ne -2 -ca r boxa m i de (4-43 )
N-(2-Hydroxyethyl)-3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2-carboxamide
To a solution of ethyl 3-(4-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2-carboxylate (141 mg, 0.50 mmol) in ethanol (2 ml) was added ethanolamine (2 ml). The reaction mixture was heated at 100 °C overnight, cooled to room temperature and concentrated. Purification by flash chromatography (EtOAc - EtOAc : MeOH gradient) afforded a pale yellow solid that was suspended in EtOAc, sonicated and filtered to give 100 mg (68%) of a colorless solid.
1H NMR (400 MHz, DMSO) δ 8.80 (s, 1 H), 8.14 (s, 1 H), 7.44 (s, 1 H), 7.32 (d, J = 6.9, 2H), 6.88 (d, J = 7.3, 2H), 3.41 (s, 2H), 3.29 (s, 2H).
Example 13. Preparation of N-(2-hydroxyethyl)-3-(3-hydroxyphenyl)-1 H- py r ro I o [2 , 3 -c] py r i d i ne -2 -ca r boxa m i de (4-49 )
To a solution of ethyl 3-(3-hydroxyphenyl)-1 H-pyrrolo[2,3-c]pyridine-2-carboxylate (82 mg, 0.29 mmol) in ethanol (2 ml) was added ethanolamine (2 ml). The reaction mixture was heated at 100 °C overnight, cooled to room temperature and concentrated. Purification by flash chromatography (EtOAc - EtOAc : MeOH gradient) afforded 60 mg (70%) of a pale yellow solid.
1H NMR (400 MHz, DMSO) δ 8.87 (s, 1 H), 8.22 (d, J = 5.5, 1 H), 7.74 (d, J = 5.1 , 1 H), 7.55 (d, J = 5.6, 1 H), 7.32 (t, J = 8.0, 1 H), 6.98 (d, J = 5.1 , 2H), 6.83 (d, J = 8.1 , 1 H), 3.49 (t, J = 6.2, 2H), 3.38 (m, 2H).
ASSAY METHODOLOGIES.
1. MKK1 assay
This is a two-step assay where inactive MAPK (0.06 mg/ml) is activated by MKK1 (diluted in 25 mM Tris, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 0.01 % Brij35, 1 mg/ml BSA) in 25.5 μΙ containing 25 mM Tris, 0.1 mM EGTA, 0.01 % Brij35, 10 mM magnesium acetate and 0.005 mM ATP. After incubating at room temperature for 30 min, 5 μΙ from the first reaction is pipetted into 20 μΙ of the second reaction mix containing (final concentration) 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM
Na3V04, 0.66 mg/ml myelin basic protein (MBP), 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
2. MAPK2/ERK2 assay. MAPK/ERK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM
Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 μΙ in 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP](500 -1000 cpm/pmole) and
incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 3. JNK1a1/SAPK1 c assay.
JNK1 a1/SAPK1 c (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % b-mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 μΙ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- Mercaptoethanol, ATF2 (3 μΜ), 10 mM magnesium acetate and 0.02 mM [33P-g- ATP] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature.
Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
4. SAPK 2a/p38 assay.
SAPK 2a/p38 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 μΙ containing 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
5. SAPK 2b/p38 2 assay.
SAPK 2 ρ38β2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
6. SAPK 3/p38g assay.
SAPK 3/p38g (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 25mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.005mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
7. SAPK 4/p38S assay.
SAPK 4/p38d (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3V04, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5 μΙ containing 25 mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
8. MAPKAP-K1 a assay.
MAPKAP-K1 a (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against KKLNRTLSVA in a final volume of 25.5 μΙ containing 50 mM Na-b- glycerophosphate pH 7.5, 0.5 mM EDTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 40 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
9. MAPKAP-K2 assay.
MAPKAP-K2 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against
KKLNRTLSVA in a final volume of 25.51 containing 50 mM Na-b-glycerophosphate pH 7.5, 0.5 mM EDTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
10. MSK1 assay. MSK1 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide GRPRTSSFAEGKK in a final volume of 25.5 μΙ containing 8 mM MOPS pH7.0, 0.2 mM EDTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM
[33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
11. PRAK assay.
PRAK (5-20mU diluted in 50 mM Na-b-glycerophosphate pH 7.5, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against KKLRRTLSVA in a final volume of 25.5 μΙ containing 50 mM Na-b-glycerophosphate pH 7.5, 0.1 mM EGTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
32. PKA assay.
PKA (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against Kemptide (LRRASLG) in a final volume of 25.5 μΙ containing 8 mM MOPS pH 7.5, 0.2 mM EDTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by
addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
13. PKCa assay.
PKCa (5-20 mU diluted in 20 mM Hepes pH 7.4, 0.03% Triton X-100) is assayed against Histone H1 in the presence of PtdSerine and DAG (0.1 mg/ml. and 10 g/ml) and 0.1 mM CaCI2. The assay is carried out in a final volume of 25.5 μΙ containing 20 mM Hepes pH 7.4, 0.03% Triton X-100, 0.1 mg/ml Histone H1 , 10 mM magnesium acetate and 0.02 mM[33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. PtdSer/DAG preparation:- PtdSer stock = 10 mg/ml in MeOH/Chloroform (1 :2). Dry down required amount. Resuspend in appropriate volume of 10 mM Hepes pH 7.4. Vortex and briefly sonicate. (2 x 10-15 seconds at 10-15 seconds apart). DAG stock = 10 mg/ml in MeOH/chloroform (1 :2). Dry down required amount. Add sonicated PtdSer solution. Vortex and sonicate.
14. PDK1 assay.
PDK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.05% b-mercaptoethanol, 1 mg/ml BSA) is assayed against PDKtide (KTFCGTPEYLAPEVRREPRILSEEEQ- EMFRDFDYIADWC) in a final volume of 25.5 μΙ containing 50 mM Tris pH 7.5, 0.05% b-mercaptoethanol, 100 μΜ substrate peptide, 10mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
15. APH-PKBa-S473D assay.
APH-PKBa-S473D (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide
GRPRTSSFAEGKK in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
16. SGK assay. SGK (5-20mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide GRPRTSSFAEGKK in a final volume of 25.5 μΙ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
17. S6K1/ P70 S6K assay.
S6K1/P70 S6K (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against substrate peptide (KKRNRTLTV) in a final volume of 25.5 μΙ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 0.1 mM substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 18. GSK3b assay.
GSK3b (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against Phospho-GS2 peptide (YRRAAVPPSPSLSRHSSPHQS(P04)EDEEE) in a final volume of 25.5 μΙ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 20 μΜ Phospho GS2 peptide, 10
mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
19. ROCK-II (ROKa) assay.
ROCK-II (ROKa) (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against Long S6 substrate peptide (KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK) in a final volume of 25.5 μΙ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 30 μΜ Long S6 substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
20. AMPK assay.
AMPK (5-20 mU diluted in 50 mM Hepes pH 7.5, 1 mM DTT, 0.02% Brij35) is assayed against SAMS substrate peptide (HMRSAMSGLHLVKRR) in a final volume of 25.5 μΙ containing 50 mM Hepes pH 7.5, 1 mM DTT, 0.02% Brij35, 0.4 mM SAMS peptide, 0.196 mM AMP, 10 mM magnesium acetate and 0.05 mM
[33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
21. CHK1 assay. CHK1 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.1 % b- mercaptoethanol, 0.01 % Brij-35, 5% glycerol, 1 mg/ml BSA) is assayed against CHKtide substrate peptide (KKKVSRSGLYRSPSMPENLNRPR) in a final volume of 25.5 μΙ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μΜ CHKtide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 μΙ of 0.5 M
(3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
22. CK2 assay.
CK2 (5-20 mU diluted in 20 mM Hepes pH7.5, 0.15 M NaCI, 0.1 mM EGTA, 0.1 % Triton X-100, 5 mM DTT, 50% glycerol) is assayed against CKII peptide
(RRRDDDSDDD) in a final volume of 25.5 μΙ containing 20 mM Hepes pH 7.5, 0.15 M NaCI, 0.1 mM EDTA, 5 mM DTT, 0.1 % Triton-X 100, CKII peptide (0.165 mM), 10 mM magnesium acetate and 0.005 mM [33P-g-ATP](500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 33. PBK assay.
PBK (5-20 mU diluted in 50 mM Na-b-glycerophosphate pH 7.0, 0.1 % b- mercaptoethanol) is assayed against phosphorylase b peptide (KRKQISVRGL) in a final volume of 25.5 μΙ containing 50 mM Tris pH 8.6, 50 mM Na-b- glycerophosphate, 0.04 mM CaCI2, phosphorylase b peptide (0.196 mM), 10 mM magnesium acetate, 0.02 mM [33P-g-ATP] (500 -1000 cpm/pmole) then incubated for 15 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
31. LCK assay.
LCK (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against Cdc2 peptide (KVEKIGEGTYGWYK) in a final volume of 25.5 μΙ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 mM Na3Vo4, Cdc2 peptide (0.25 mM), 10 mM magnesium acetate and 0.05mM [33P-g-ATP](500-1000 cpm/pmole) and incubated for 15 min at room temperature Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
25. CSK assay.
CSK (5-20 mU diluted in 20 mM MOPS pH7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against Cdc2 peptide (KVEKIGEGTYGWYK) in a final volume of 25.5 μΙ containing 8 mM MOPS pH7.0, 0.2 mM EDTA, Cdc2 peptide (0.25 mM), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](500 -1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
26. CDK2/cyclin A assay. CDK2/cyclin A (5-20 mU diluted in 50 mM Hepes pH 7.5, 1 mM DTT, 0.02% Brij35, 100 mM NaCI) is assayed against Histone H 1 in a final volume of 25.5 μΙ containing 50 mM Hepes pH7.5, 1 mM DTT, 0.02% Brij35, 100 mM NaCI, Histone H1 (1 mg/ml), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](500-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
27. DYRK 1 A assay. DYRK 1A (5-20 mU of diluted in 50 mM Tris pH7.5, 0.1 mM EGTA) is assayed against Woodtide (KKISGRLSPIMTEQ) in a final volume of 25.5μΙ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 350 μΜ substrate peptide, 10 mM Magnesium acetate and 0.05 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
28. CK1 assay.
CK1 (5-20 mU diluted in 20 mM Hepes pH7.5, 0.15 M NaCI, 0.1 mM EGTA, 0.1 % Triton X-100, 5 mM DTT, 50% glycerol) is assayed against CKI peptide
(RRKDLHDDEEDEAMSITA) in a final volume of 25.5 μΙ containing 20 mM Hepes pH 7.5, 0.15 M NaCI, 0.1 mM EDTA, 5 mM DTT, 0.1 % Triton-X 100, CKI peptide (0.5 mM), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 29. NEK6 assay.
NEK6 (5-20 mU diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b- Mercaptoethanol) is assayed against NEK6 peptide (FLAKSFGSPNRAYKK) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.01 % Brij, 0.1 %, b-Mercaptoethanol, NEK6 peptide (0.3 mM), 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
30. NEK2a assay.
5-20mU of NEK2a (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against NEK2a peptide (RFRRSRRMI) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.01 % Brij,
0.1 %, b-Mercaptoethanol, 300μΜ NEK2a peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
36. MAPKAP-K1 b/RSK2 assay.
MAPKAP-K1 b (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against
substrate peptide (KKLNRTLSVA) in a final volume of 25.51 containing 50 mM Na- b-glycerophosphate (pH 7.5), 0.5 mM EDTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
38. IKKb assay. 5-20mU of IKKb (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against substrate peptide
(LDDRHDSGLDSMKDEEY) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
40. smMLCK assay
5-20mU of smMLCK (diluted in 50mM Hepes (pH 7.5), 0.1 mM EGTA, 1 mg/mlBSA, 0.1 %, b-Mercaptoethanol) is assayed against substrate peptide
(KKRPQRATSNVFA) in a final volume of 25.5μΙ containing 50mM Hepes (pH 7.5), 0.1 mM EGTA, 5mM CaCI2, 10μΜ Calmodulin, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid. 42. PRK2 assay
5-20mU of PRK2 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against Long S6 peptide
(KEAKEKRQEQIAKRRRLSSLRASTSKSGGSQK) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 30μΜ
Long S6 peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500- 1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
44. MNK2 alpha assay
5-20mU of MNK2 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against substrate peptide (elF4E) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b- Mercaptoethanol, 0.5mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
47. CAMK-1 assay 5-20mU of CAMK-1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA,
0.1 %,b-Mercaptoethanol) is assayed against substrate peptide (YLRRRLSDSNF) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.5mM CaCI2, 0.3μΜ calmodulin, 0.1 %, b-Mercaptoethanol, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
50. PIM2 assay
5-20mU of PIM2 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against substrate peptide (RSRHSSYPAGT) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.5mM CaCI2, 0.3μΜ calmodulin, 0.1 %, b-Mercaptoethanol, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000 cpm/pmole) and
incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid. 52. NEK7 assay
NEK7 (5-20 mU diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b- Mercaptoethanol) is assayed against substrate peptide (FLAKSFGSPNRAYKK) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.01 % Brij, 0.1 %, b-Mercaptoethanol, substrate peptide (0.3 mM), 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
53. JNK3 alpha 1 assay
JNK3 alpha 1 (5-20 mU diluted in 50 mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % b-mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 μΙ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b-
Mercaptoethanol, ATF2 (3 μΜ), 10 mM magnesium acetate and 0.05 mM [33P-g- ATP] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature.
Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
54. MAPKAP-K3 assay
5-20mU of MAPKAP-K3 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against substrate peptide
(KKLNRTLSVA) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 30μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%)
orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
55. ERK8 assay
5-20mU of ERK8 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000
cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
56. MNK1 assay
5-20mU of MNK1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against substrate peptide (elF4E) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b- Mercaptoethanol, 0.5mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid. 57. SRPK1 assay
5-20mU of SRPK1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %, b-Mercaptoethanol) is assayed against substrate peptide
(RSRSRSRSRSRSRSR) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
58. ΔΡΗ-PKBbeta (S474D) assay
APH-PKBbeta-S474D (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a modified Crosstide peptide (GRPRTSSFAEGKK) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
46. Aurora B assay
Aurora B (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(LRRLSLGLRRLSLGLRRLSLGLRRLSLG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
49. CHK2 assay CHK2 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.1 % b- mercaptoethanol, 0.01 % Brij-35, 5% glycerol, 1 mg/ml BSA) is assayed against CHKtide substrate peptide (KKKVSRSGLYRSPSMPENLNRPR) in a final volume of 25.5 μΙ containing 8 mM MOPS pH 7.0, 0.2 mM EDTA, 200 μΜ CHKtide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 μΙ of 0.5 M
(3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
51. Src assay
Src (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide (KVEKIGEGTYGWYK) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50- 1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
59. EF2K assay
EF2K (5-20mU diluted in 50 mM Hepes pH 6.6, 0.1 % b-mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide (RKKFGESKTKTKEFL) in a final volume of 25.5 μΙ containing 50mM Hepes pH 6.6, 0.2mM CaCI2, 0.3μΜ
Calmodulin, 0.05% b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 60. MARK3 assay
MARK3 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against CHKtide substrate
(KKKVSRSGLYRSPSMPENLNRPR) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM
magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
61. MST2 assay
MST2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 100μΜ Vanadate) is assayed against MBP in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 0.33mg/ml MBP,
10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
62. PKD1 assay
PKD1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed substrate peptide (KKLNRTLSVA) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50- 1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
63. PLK1 assay
PLK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA, 100μΜ Vanadate) is assayed against a substrate peptide (ISDELMDATFADQEAKKK) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 10μΜ Vanadate, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
39. DYRK2 assay
DYRK2 (5-20 mU of diluted in 50 mM Tris pH7.5, 0.1 mM EGTA) is assayed against Woodtide (KKISGRLSPIMTEQ) in a final volume of 25.5μΙ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 350 μΜ substrate peptide, 10 mM Magnesium acetate and 0.05 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
37. JNK2 assay
JNK2 1 (5-20 mU diluted in 50 mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % b-mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 μΙ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- Mercaptoethanol, ATF2 (3 μΜ), 10 mM magnesium acetate and 0.02 mM [33P-g- ATP] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature.
Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
79. DYRK3 assay DYRK3 (5-20 mU of diluted in 50 mM Tris pH7.5, 0.1 mM EGTA) is assayed against Woodtide (KKISGRLSPIMTEQ) in a final volume of 25.5μΙ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 350 μΜ substrate peptide, 10 mM Magnesium acetate and 0.005 mM [33P-g-ATP](50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
64. HIPK2 assay 5-20mU of HIPK2 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000
cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
65. HIPK3 assay
5-20mU of HIPK3 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
66. PAK4 assay
PAK4 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(RRRLSFAEPG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b- mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room
temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 67. PAK5 (PAK7) assay
PAK5 (PAK7)(5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(RRRLSFAEPG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b- mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room
temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
68. PAK6 assay
PAK6 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(RRRLSFAEPG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-
mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
69. CAMKKa assay
5-20mU of CAMKKa (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against substrate peptide
(AKPKGNKDYHLQTCCGSLAYRRR) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.5mM CaCI2, 0.3μΜ calmodulin, 0.1 %, b- Mercaptoethanol, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
104. CAMKKb assay
5-20mU of CAMKKb (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against substrate peptide
(DGEFLRTSCGSPNYAARRR) in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.5mM CaCI2, 0.3μΜ calmodulin, 0.1 %, b-Mercaptoethanol, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
71. PIM1 assay
PIM1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(RSRHSSYPAGT) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05%
b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room
temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
72. PIM3 assay
PIM3 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(RSRHSSYPAGT) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room
temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
73. PLK1 assay PLK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA, 100μΜ Vanadate) is assayed against a substrate peptide (ISDELMDATFADQEAKKK) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 10μΜ Vanadate, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
74. BRSK2 assay
BRSK2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(KKLNRTLSFAEPG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room
temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 75. MELK assay
MELK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(KKLNRTLSFAEPG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 200 μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
76. PKC zeta assay
PKC zeta (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA, 100μΜ Vanadate) is assayed against a substrate peptide (ERMRPRKRQGSVRRRV) in a final volume of 25.5 μΙ containing 50mM
Tris pH 7.5, 0.05% b-mercaptoethanol, 10μΜ Vanadate, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
77. Aurora C assay
Aurora C (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % b- mercaptoethanol, 1 mg/ml BSA) is assayed against a substrate peptide
(LRRLSLGLRRLSLGLRRLSLGLRRLSLG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.05% b-mercaptoethanol, 300 μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of
0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
78. ERK1 assay
5-20mU of ERK1 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA, 0.1 %,b-Mercaptoethanol) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.1 %, b-Mercaptoethanol, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000
cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
80. FGF-R1 assay
FGF-R1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 5mM MnCI2, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000
cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
81. IRR assay
5-20mU of IRR (diluted in 50mM Hepes (pH 7.5), 0.1 mM EGTA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Hepes (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
82. EPH-A2 assay
EPH-A2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
83. MST4 assay
5-20mU of MST4 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
84. SYK assay SYK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
85. YES1 assay YES1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
88. IGF-1 R assay
IGF-1 R (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKKSPGEYVNIEFG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
89. VEG-FR assay
VEG-FR (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKKSPGEYVNIEFG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
90. BTK assay
BTK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KVEKIGEGTYGVVYK) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
91. IR-HIS assay
IR-HIS (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKSRGDYMTMQIG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
94. EPH-B3 assay
EPH-B3 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.005 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
34. TBK1 (DU 12569) assay
TBK1 (DU12569) (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (KKKKERLLDDRHDSGLDSMKDEE) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 300μΜ substrate peptide, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
35. IKKepsilon (DU14231 ) assay
5-20mU of IKKepsilon (DU14231 )(diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.05 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric
acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
109. GCK assay
GCK (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5,0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
110. IRAK4 assay
IRAK4 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
111. NUAK1 assay
NUAK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against ALNRTSSDSALHRRR in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM
ALNRTSSDSALHRRR, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50- 1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
112. MLK1 assay
MLK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
113. Ml NK1 assay
MINK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.05mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
114. MLK3assay
MLK3 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
115. LKB1 assay
LKB1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against
LSNLYHQGKFLQTFCGSPLYRRR in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.2mM LSNLYHQGKFLQTFCGSPLYRRR, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated
for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 116. HER4 assay
HER4 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against Poly Glut Tyr in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml Poly Glut Tyr, 10 mM magnesium acetate and 0.005mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 117. TTK assay
TTK (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against RSRSRSRSRSRSRSR in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM
RSRSRSRSRSRSRSR, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50- 1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 120. RIPK2 assay
RIPK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
121. Aurora A assay
Aurora A (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against
LRRLSLGLRRLSLGLRRLSLGLRRLSLG in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM
LRRLSLGLRRLSLGLRRLSLGLRRLSLG, 10 mM magnesium acetate and
0.005mM [33P-Y-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
122. PAK2 assay
PAK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against RRRLSFAEPG in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM RRRLSFAEPG, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
123. BRSK1 assay
BRSK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against KKLNRTLSFAEPG in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM
KKLNRTLSFAEPG, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 65. HIPK3 assay
HIPK3 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
126. HIPK1 assay
HIPK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
52. JNK3a1 assay
JNK3 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % β- mercaptoethanol) is assayed against ATF2 (activating transcription factor in a final volume of 25.5 μΙ in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β-Mercaptoethanol, ATF2 (3 μΜ), 10 mM magnesium acetate and 0.02 mM [33Ρ-γ-ΑΤΡ] (500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
54. MAPKAP-K3 assay
MAPKAP-K3 (5-20 mU diluted in 20 mM MOPS pH 7.5, 1 mM EDTA, 0.01 % Brij35, 5% glycerol, 0.1 % β-mercaptoethanol, 1 mg/ml BSA) is assayed against
KKLNRTLSVA in a final volume of 25.5I containing 50 mM Na^-glycerophosphate pH 7.5, 0.5 mM EDTA, 30 μΜ substrate peptide, 10 mM magnesium acetate and 0.02 mM [33P-Y-ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
129. MARK2 assay
MARK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against
KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5μΙ containing 50mM
Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
130. MARK4 assay
MARK4 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against
KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.05mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
131. EPH-B4 assay
EPH-B4 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
132. JAK2 assay
JAK2 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.05% β- mercaptoethanol, 1 mg/ml BSA) is assayed against PDKtide
(KTFCGTPEYLAPEVRREPRILSEEEQ-EMFRDFDYIADWC) in a final volume of 25.5 μΙ containing 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.05% β-mercaptoethanol, 100 μΜ substrate peptide, 10mM magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
133. EPH-A4 assay
EPH-A4 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.05 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 134. TAK1 assay
TAK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (RLGRDKYKTLRQIRQ) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β-Mercaptoethanol, 300μΜ substrate peptide, 10 mM magnesium acetate, 0.5mM MnCI and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature.
Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 135. TrkA assay
TrkA (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 10mM MnCI, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml substrate peptide, 10 mM magnesium acetate and 0.02 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
136. MEKK1 assay
MEKK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.33 mg/ml MBP, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%)
orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
137. MARK1 assay
MARK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA) is assayed against
KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M
(3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
142. CLK2 assay
CLK2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (RNRYRDVSPFDHSR) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.3mM peptide, 10mM DTT, 10 mM
magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
143. DAPK1 assay
DAPK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide KKLNRTLSFAEPG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.3mM peptide, 10mM DTT, 10 mM magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
144. EPH-B2 assay
EPH-B2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 1 mg/ml substrate peptide, 10 mM magnesium
acetate and 0.02 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
169. TSSK1 assay
TSSK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA, 10mM DTT) is assayed against
KKKVSRSGLYRSPSMPENLNRPR in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM KKKVSRSGLYRSPSMPENLNRPR, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
170. TESK1 assay
TESK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA, 10MM DTT) is assayed against Cofilin 2 in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.2mg/ml Cofilin 2, 10 mM magnesium acetate and 0.05mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 171. TTBK1 assay
TTBK1 (5-20 mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 0.1 % β- mercaptoethanol, 1 mg/ml BSA, 10mM DTT) is assayed against
RRKDLHDDEEDEAMSITA in a final volume of 25.5μΙ containing 50mM Tris pH 7.5, 0.1 mM EGTA, 0.3mM RRKDLHDDEEDEAMSITA, 10 mM magnesium acetate and 0.005mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 172. MST3 assay
5-20mU of MST3 (diluted in 50mM Tris (pH 7.5), 0.1 mM EGTA) is assayed against MBP in a final volume of 25.5μΙ containing 50mM Tris (pH 7.5), 0.1 mM EGTA, 0.33mg/ml MBP, 10 mM magnesium acetate and 0.02 mM [33P-g-ATP]( 500-1000 cpm/pmole) and incubated for 30 mins at room temperature. Assays are stopped by addition of 5μΙ of 0.5M (3%) orthophosphoric acid. Assays are harvested onto P81 Unifilter plates using a wash buffer of 50mM orthophosphoric acid.
173. CSNK1 G2 assay.
CSNK1 G2 (5-20 mU diluted in 20 mM Hepes pH7.5, 0.15 M NaCI, 0.1 mM EGTA, 0.1 % Triton X-100, 5 mM DTT, 50% glycerol) is assayed against
RRKDLHDDEEDEAMSITA in a final volume of 25.5 μΙ containing 20 mM Hepes pH 7.5, 0.15 M NaCI, 0.1 mM EDTA, 5 mM DTT, 0.1 % Triton-X 100,
RRKDLHDDEEDEAMSITA (0.5 mM), 10 mM magnesium acetate and 0.02 mM
[33P-g-ATP](500 -1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
174. QIK assay
QIK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA,1 mg/ml Poly Glut Tyr), 10 mM magnesium acetate and 0.05 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
175. QSK assay
QSK (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (Poly Glut Tyr) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 1 mg/ml Poly Glut Tyr, 10 mM magnesium acetate and 0.05 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
177. WNK1 assay
WNK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against OSR1 in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 10mM MnCI, 1 mg/ml OSR1 , 10 mM magnesium acetate and 0.02 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
178. CDK9/Cyclin T1 assay
CDK9/Cyclin T1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (YSPTSPSYSPTSPSYSPTSPKKK) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 1 mg/ml BSA, 0.3mM YSPTSPSYSPTSPSYSPTSPKKK, 10 mM magnesium acetate and 0.05 mM [33P- γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
179. DDR2 assay
DDR2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (KKSRGDYMTMQIG) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mM substrate peptide 10 mM magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
180. OSR1 assay
OSR1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against a substrate peptide (RRHKKKDTHTNTYYLRTFGHNTRR) in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mM substrate peptide, 0.12mg/ml GST-
M025, 10 mM magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
181. ULK1 assay
ULK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33mg/ml substrate, 10 mM magnesium acetate and 0.02 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 182. ULK2 assay
ULK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33mg/ml substrate, 10 mM magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
183. TTBK2 assay
TTBK2 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against substrate peptide RRKDLHDDEEDEAMSITA in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mM substrate, 10 mM magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
184. MAP4K3 assay
MAP4K3 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 μΙ containing
50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33 mg/ml substrate, 10 mM magnesium acetate and 0.02 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
185. MAP4K5 assay
MAP4K5 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33 mg/ml substrate, 10 mM magnesium acetate and 0.02mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
187. PDGFRA assay
PDGFRA (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against substrate peptide KKKKEEIYFFFG in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 5mM MnCI2 0.3mM substrate, 10 mM magnesium acetate and 0.005 mM [33Ρ-γ- ATP] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
189. TGFBR1 assay
TGFBR1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against substrate peptide RRKVLTQMGSPSIRCSS*VS in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 1 mM DTT, 5mM MnCI2, 0.3mM substrate, 10 mM magnesium acetate and 0.05 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
190. ERK5 assay
ERK5 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against MBP in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.33mg/ml substrate, 10 mM magnesium acetate and 0.05mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid. 194. PIN K1 assay
PINK1 (5-20mU diluted in 50 mM Tris pH 7.5, 0.1 mM EGTA, 1 mg/ml BSA, 0.1 % Mercaptoethanol) is assayed against GST PARK2 TV3 in a final volume of 25.5 μΙ containing 50mM Tris pH 7.5, 0.1 mM EDTA, 10mM DTT, 0.3mg/ml substrate, 10 mM magnesium acetate and 0.005 mM [33Ρ-γ-ΑΤΡ] (50-1000 cpm/pmole) and incubated for 30 min at room temperature. Assays are stopped by addition of 5 μΙ of 0.5 M (3%) orthophosphoric acid and then harvested onto P81 Unifilter plates with a wash buffer of 50 mM orthophosphoric acid.
Results
Data showing residual kinase activity at 100 micromolar inhibitor concentration is given in the table which follows. The values are on an absolute scale such that 100 is no change in the presence of putatitic inhibitor, any value over 100 shows kinase activation. Any value less that 25 is considered to be highly significant inhibition.
PDK1 69 90 97 97 85 89 97 25 47 106 79 34 24 76 91
PKBa 50 52 97 75 86 49 50 14 17 8 53 47 41 77 73
PKBb 17 31 57 41 53 23 25 11 36 2 76 59 64
SGK1 45 51 81 82 72 44 38 19 31 23 84 70 50 88 97
S6K1 44 71 84 62 84 74 17 15 15 29 58 13 10 33 46
PKA 22 81 96 100 67 79 66 7 11 80 39 20 35 22 30
ROCK 2 13 64 86 77 74 36 14 11 11 93 29 15 12 19 32
PRK2 17 53 78 81 71 54 39 9 15 87 12 3 7 10 11
PKCa 27 82 77 82 81 87 73 7 5 90 31 93 17 97 96
PKCy 56 79 76 77 82 86 68 23 28 116 54 60 28
PKCz 46 72 101 80 92 79 54 6 33 91 92 38 64
PKD1 35 44 76 29 68 43 17 11 31 51 74 46 28 78 59
STK33 31 60 67 79 81 67 42 25 25 101 46 7 6
MSK1 28 26 73 74 83 41 9 7 8 33 57 36 29 61 61
MNK1 27 23 69 25 72 44 26 20 11 81 4 11 6
MNK2 30 25 71 58 75 66 22 16 19 94 21 12 7
MAPKAP-K2 70 77 90 74 85 69 79 55 94 93 68 70 70
MAPKAP-K3 36 44 86 53 76 52 44 49 54 33 87 65 53
PRAK 82 89 107 80 101 72 56 36 72 78 81 55 50
CAMKKb 19 36 83 46 71 47 47 17 20 69 45 13 16 29 49
CSK 13 87 106 71 38 83 83 17 19 68 88 39 58
YES1 8 39 99 60 55 24 48 5 3 99 67 15 64
ABL 11 56 99 87 40 37 61 5 27 67 82 19 51
BTK 17 24 36 41 11 34 28 45 3 14 32 6 20 31 25
JAK2 48 70 79 82 89 70 73 18 22 104 23 6 4 17 20
SYK 29 57 87 66 81 44 66 17 11 26 93 53 59 92 77
ZAP70 84 90 98 93 93 94 83 43 56 188 125 63 99
TIE2 52 101 108 101 79 98 94 34 10 57 60 22 20
BRK 2 13 51 35 4 17 4 2 24 39 33 2 10
EPH-A2 9 38 81 57 20 55 47 24 13 62 50 9 36 53 20
EPH-A4 9 47 69 51 37 42 44 13 17 66 61 11 45
EPH-B1 6 63 83 86 39 76 73 5 22 81 79 11 41
EPH-B2 2 41 112 65 56 46 38 2 4 66 81 12 43
EPH-B3 5 37 59 58 12 55 46 6 6 30 9 3 7
EPH-B4 14 72 109 90 88 74 69 10 4 67 81 5 22
FGF-R1 6 26 75 70 61 36 37 0 6 26 64 33 20
HER4 3 33 83 62 10 40 39 2 2 52 47 9 37 27 27
IGF-1R 3 9 55 57 24 15 13 4 2 16 70 9 26 51 37
IR 1 15 75 57 31 21 26 1 3 50 114 36 47
IRR 11 39 55 43 60 38 35 11 5 56 30 17 9
TrkA 5 26 64 40 23 26 33 6 5 11 62 7 8 55 55
DDR2 6 16 84 20 19 21 46 6 17 89 88 4 36
VEG-FR 6 29 54 37 51 25 15 5 6 60 22 4 4
PDGFRA 8 108 61 26 40 12 16
PINK 94 91 75
Claims
1 . A compound incorporating a group of formula (I)
(I) wherein:
1 of X, Y and Z is nitrogen and the other 2 are carbon;
R" is hydrogen, methyl, ethyl or propyl; and
W represents hydrogen, carbon, nitrogen, oxygen or sulphur; or incorporating a salt, hydrate or solvate of a group of formula (I).
2. A compound as claimed in claim 1 of formula (II)
(II)
wherein:
X, Y, Z and R" are as defined in claim 1 ; and
R\ together with the carbonyl group to which it is attached, is a carboxylic acid derivative, preferably a carboxylic acid derivative selected from an aldehyde, a ketone, an amide, an ester, a thioester, an acyl phosphate and an acyl
hydroxamate;
or a salt, hydrate or solvate of a compound of formula (II).
3. A compound as claimed in claim 1 or claim 2 wherein Y or X is nitrogen, preferably Y is nitrogen.
4. A compound as claimed in any preceding claim wherein the hydroxyl of the phenol moiety is in the meta or para position, preferably the para position.
5. A compound as claimed in any preceding claim wherein R" is hydrogen, methyl or ethyl, preferably hydrogen.
6. A compound as claimed in any one of claims 2 to 5 wherein R' is selected from hydrogen, -NH2 ,- OR-i, -Ri or -NR-|R2 in which R2 is preferably hydrogen but may be a further R-i group and Ri is a Ci-n alkyl, alkenyl, alkynyl or alkylamine, which may be linear or branched, or R-i may comprise or consist of 1 -3 cyclic groups which may be fused or linked.
7. A compound as claimed in claim 6 wherein R' comprises no more than 18 non-hydrogen atoms.
8. A compound as claimed in claim 6 or claim 7 wherein R-i incorporates 1 -3 cyclic groups, preferably 1 or 2 cyclic groups.
9. A compound as claimed in claim 8 wherein one or more of the cyclic groups is selected from the group consisting of cyclohexyl, phenyl, pyridine, pyrazole, imidazole, thiazole, oxazole, furan, piperazine, pyrroline, pyrrolidine, diazolone, morpholine and piperidine.
10. A compound as claimed in claim 8 or 9 wherein the cyclic group is substituted by one or more groups selected from -OH, -OR, -NRR, -C=0-OR, -C=0-NRR, -SO2-NRR, -NR-SO2R, -SO2R, -NR-C=OR, a halogen, and d-3 alkyl or fluoroalkyl, wherein each R which may be the same or different, is H or Ci-3 alkyl.
1 1. A compound as claimed in any one of claims 8 to 10 wherein two cyclic groups are linked by a linking group of 1-10 non-hydrogen atoms.
12. A compound as claimed in claim 1 1 wherein the linking group is selected from -CH2-, -NR-, -0-, -S-, -CHRCHR-, -CH=CH-, -C=0-0-, -C=0-NR-, -0-CHR-, -NR-CHR-, -NR-C=0-NR-, -NR-C=0-0- and -CH2CH2CH2-; wherein R is H or Ci-2 alkyl.
13. A compound as claimed in claim 2 wherein R' is hydrogen, -OCH3, - OCH2CH3, -OCH2CH2CH3 , -OCH2CH2CH2CH3 , -NHCH3, -NHCH2CH3, - NHCH2CH2CH3, -NHCH2CH2OH or
14. A compound as claimed in any preceding claim for use in therapy.
15. A compound for use as claimed in claim 14 for the treatment of a disease or other pathological condition associated with aberrant protein kinase activity or which would benefit from a reduction in protein kinase activity.
16. A compound for use as claimed in claim 14 or 15 for the treatment of inflammation, inflammatory conditions or cancer.
17. A method of inhibiting a protein kinase and/or a reaction catalysed by a protein kinase, the method comprising contacting said kinase with a compound as defined in any one of claims 1 to 13.
18. A pharmaceutical formulation comprising a compound as defined in any one of claims 1 to 13 in admixture with a suitable diluent, carrier or excipient.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB1310460.9 | 2013-06-12 | ||
GBGB1310460.9A GB201310460D0 (en) | 2013-06-12 | 2013-06-12 | Compounds |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2014198848A2 true WO2014198848A2 (en) | 2014-12-18 |
WO2014198848A3 WO2014198848A3 (en) | 2015-06-04 |
Family
ID=48876153
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2014/062280 WO2014198848A2 (en) | 2013-06-12 | 2014-06-12 | Compounds |
Country Status (2)
Country | Link |
---|---|
GB (1) | GB201310460D0 (en) |
WO (1) | WO2014198848A2 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112839648A (en) * | 2018-06-07 | 2021-05-25 | 达萨玛治疗公司 | SARM1 inhibitors |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP2004529855A (en) * | 2000-10-10 | 2004-09-30 | スミスクライン ビーチャム コーポレーション | Substituted indoles, pharmaceutical compositions containing such substituted indoles and their use as PPAR-γ binders |
FR2878849B1 (en) * | 2004-12-06 | 2008-09-12 | Aventis Pharma Sa | SUBSTITUTED INDOLES, COMPOSITIONS CONTAINING SAME, METHOD OF MANUFACTURE AND USE |
FR2884821B1 (en) * | 2005-04-26 | 2007-07-06 | Aventis Pharma Sa | SUBSTITUTED PYRROLOPYRIDINES, COMPOSITIONS CONTAINING SAME, METHOD OF MANUFACTURE AND USE |
-
2013
- 2013-06-12 GB GBGB1310460.9A patent/GB201310460D0/en not_active Ceased
-
2014
- 2014-06-12 WO PCT/EP2014/062280 patent/WO2014198848A2/en active Application Filing
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN112839648A (en) * | 2018-06-07 | 2021-05-25 | 达萨玛治疗公司 | SARM1 inhibitors |
JP2021528488A (en) * | 2018-06-07 | 2021-10-21 | ディスアーム セラピューティクス, インコーポレイテッド | SARM1 inhibitor |
JP7478142B2 (en) | 2018-06-07 | 2024-05-02 | ディスアーム セラピューティクス, インコーポレイテッド | SARM1 inhibitors |
Also Published As
Publication number | Publication date |
---|---|
WO2014198848A3 (en) | 2015-06-04 |
GB201310460D0 (en) | 2013-07-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2017204007B2 (en) | Heteroaryl compounds and methods of use thereof | |
JP5019612B2 (en) | Azaindoles and other protein kinases useful as inhibitors of ROCK | |
AU2011258217B2 (en) | Heteroaryl compounds and methods of use thereof | |
WO2015108490A2 (en) | Heteroaryl alkyne derivatives and uses thereof | |
JP5122280B2 (en) | Azaindoles useful as inhibitors of protein kinases | |
US8399458B2 (en) | Compounds useful as protein kinase inhibitors | |
AU2013352463B2 (en) | Triazolo-pyrazine derivatives useful in the treatment of disorders of the central nervous system | |
WO2002090360A1 (en) | Compounds useful as kinase inhibitors for the treatment of hyperproliferative diseases | |
AU2013277258B2 (en) | Heteroaryl compounds and methods of use thereof | |
JP7157075B2 (en) | Tricyclic compounds and their use as glycogen synthase kinase 3 (GSK3) inhibitors | |
WO2014198848A2 (en) | Compounds | |
JP6797219B2 (en) | Substituted tricyclic heterocyclic compounds and their uses | |
WO2014198844A1 (en) | Protein kinase inhibitors | |
WO2002076984A1 (en) | Compounds useful as kinase inhibitors for the treatment of hyperproliferative diseases | |
JP2013064015A (en) | Azaindole useful as inhibitor of protein kinase |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14731214 Country of ref document: EP Kind code of ref document: A2 |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 14731214 Country of ref document: EP Kind code of ref document: A2 |