WO2014185985A1 - Novel polypeptide small molecule conjugates and their uses - Google Patents
Novel polypeptide small molecule conjugates and their uses Download PDFInfo
- Publication number
- WO2014185985A1 WO2014185985A1 PCT/US2014/000123 US2014000123W WO2014185985A1 WO 2014185985 A1 WO2014185985 A1 WO 2014185985A1 US 2014000123 W US2014000123 W US 2014000123W WO 2014185985 A1 WO2014185985 A1 WO 2014185985A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- psmc
- antigen
- amino acid
- polypeptide
- group
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 272
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 260
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 245
- 150000003384 small molecules Chemical class 0.000 title claims abstract description 21
- 230000027455 binding Effects 0.000 claims description 204
- 150000001413 amino acids Chemical class 0.000 claims description 200
- 239000000427 antigen Substances 0.000 claims description 190
- 108091007433 antigens Proteins 0.000 claims description 190
- 102000036639 antigens Human genes 0.000 claims description 190
- 229920000642 polymer Polymers 0.000 claims description 78
- 229920003169 water-soluble polymer Polymers 0.000 claims description 42
- 239000011724 folic acid Substances 0.000 claims description 32
- 239000012634 fragment Substances 0.000 claims description 31
- 229940014144 folate Drugs 0.000 claims description 30
- 230000004481 post-translational protein modification Effects 0.000 claims description 17
- 230000001588 bifunctional effect Effects 0.000 claims description 13
- 231100000599 cytotoxic agent Toxicity 0.000 claims description 5
- 229940127089 cytotoxic agent Drugs 0.000 claims description 3
- 239000002254 cytotoxic agent Substances 0.000 claims description 2
- 235000001014 amino acid Nutrition 0.000 description 211
- 229940024606 amino acid Drugs 0.000 description 204
- 108090000623 proteins and genes Proteins 0.000 description 183
- 102000004169 proteins and genes Human genes 0.000 description 157
- 235000018102 proteins Nutrition 0.000 description 152
- -1 poly(ethylene glycol) Polymers 0.000 description 141
- 238000000034 method Methods 0.000 description 118
- 210000004027 cell Anatomy 0.000 description 117
- 229920001223 polyethylene glycol Polymers 0.000 description 91
- 108020004705 Codon Proteins 0.000 description 84
- 206010028980 Neoplasm Diseases 0.000 description 52
- 150000007523 nucleic acids Chemical class 0.000 description 51
- 102000039446 nucleic acids Human genes 0.000 description 47
- 108020004707 nucleic acids Proteins 0.000 description 47
- 238000006467 substitution reaction Methods 0.000 description 44
- 239000002585 base Substances 0.000 description 40
- 125000005647 linker group Chemical group 0.000 description 40
- 239000000126 substance Substances 0.000 description 38
- 239000003814 drug Substances 0.000 description 37
- 125000000217 alkyl group Chemical group 0.000 description 33
- 125000003275 alpha amino acid group Chemical group 0.000 description 32
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 description 32
- 125000000524 functional group Chemical group 0.000 description 31
- 108060003951 Immunoglobulin Proteins 0.000 description 30
- 238000012217 deletion Methods 0.000 description 30
- 230000037430 deletion Effects 0.000 description 30
- 102000018358 immunoglobulin Human genes 0.000 description 30
- 108020004414 DNA Proteins 0.000 description 29
- 229940079593 drug Drugs 0.000 description 29
- 230000004048 modification Effects 0.000 description 29
- 238000012986 modification Methods 0.000 description 29
- 239000003795 chemical substances by application Substances 0.000 description 28
- 230000014509 gene expression Effects 0.000 description 27
- 238000007792 addition Methods 0.000 description 26
- 230000000694 effects Effects 0.000 description 26
- 102000005962 receptors Human genes 0.000 description 26
- 239000000562 conjugate Substances 0.000 description 25
- 108020003175 receptors Proteins 0.000 description 25
- 125000001424 substituent group Chemical group 0.000 description 25
- 230000001965 increasing effect Effects 0.000 description 24
- 238000006243 chemical reaction Methods 0.000 description 23
- 239000000651 prodrug Substances 0.000 description 23
- 229940002612 prodrug Drugs 0.000 description 23
- 210000002966 serum Anatomy 0.000 description 23
- 125000003118 aryl group Chemical group 0.000 description 22
- 108091033319 polynucleotide Proteins 0.000 description 22
- 102000040430 polynucleotide Human genes 0.000 description 22
- 239000002157 polynucleotide Substances 0.000 description 22
- 102000004190 Enzymes Human genes 0.000 description 21
- 108090000790 Enzymes Proteins 0.000 description 21
- 229940088598 enzyme Drugs 0.000 description 21
- 238000001727 in vivo Methods 0.000 description 21
- 238000002703 mutagenesis Methods 0.000 description 21
- 231100000350 mutagenesis Toxicity 0.000 description 21
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 20
- 125000000539 amino acid group Chemical group 0.000 description 20
- 230000001225 therapeutic effect Effects 0.000 description 20
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 19
- 150000001540 azides Chemical class 0.000 description 19
- 150000001875 compounds Chemical class 0.000 description 19
- 241000699670 Mus sp. Species 0.000 description 18
- 238000002741 site-directed mutagenesis Methods 0.000 description 18
- 239000012636 effector Substances 0.000 description 17
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 16
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 16
- 239000000203 mixture Substances 0.000 description 16
- 239000003053 toxin Substances 0.000 description 16
- 231100000765 toxin Toxicity 0.000 description 16
- 108700012359 toxins Proteins 0.000 description 16
- 239000002253 acid Substances 0.000 description 15
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 description 15
- 239000003446 ligand Substances 0.000 description 15
- 230000035772 mutation Effects 0.000 description 15
- 229910052757 nitrogen Inorganic materials 0.000 description 15
- 239000002773 nucleotide Substances 0.000 description 15
- 125000003729 nucleotide group Chemical group 0.000 description 15
- 238000011282 treatment Methods 0.000 description 15
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 14
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 14
- 201000011510 cancer Diseases 0.000 description 14
- 235000018417 cysteine Nutrition 0.000 description 14
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 14
- 241000894006 Bacteria Species 0.000 description 13
- 102000001301 EGF receptor Human genes 0.000 description 13
- 108060006698 EGF receptor Proteins 0.000 description 13
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 13
- 108020004566 Transfer RNA Proteins 0.000 description 13
- 150000007513 acids Chemical class 0.000 description 13
- 230000004071 biological effect Effects 0.000 description 13
- 230000015572 biosynthetic process Effects 0.000 description 13
- 230000000295 complement effect Effects 0.000 description 13
- 230000006870 function Effects 0.000 description 13
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 13
- 239000000523 sample Substances 0.000 description 13
- 239000013598 vector Substances 0.000 description 13
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 12
- 239000004472 Lysine Substances 0.000 description 12
- 125000002355 alkine group Chemical group 0.000 description 12
- 238000004422 calculation algorithm Methods 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- 235000018977 lysine Nutrition 0.000 description 12
- 238000003786 synthesis reaction Methods 0.000 description 12
- 230000008685 targeting Effects 0.000 description 12
- 125000003396 thiol group Chemical group [H]S* 0.000 description 12
- 108091034117 Oligonucleotide Proteins 0.000 description 11
- 239000002202 Polyethylene glycol Substances 0.000 description 11
- WDLRUFUQRNWCPK-UHFFFAOYSA-N Tetraxetan Chemical compound OC(=O)CN1CCN(CC(O)=O)CCN(CC(O)=O)CCN(CC(O)=O)CC1 WDLRUFUQRNWCPK-UHFFFAOYSA-N 0.000 description 11
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 11
- 230000004927 fusion Effects 0.000 description 11
- 239000000463 material Substances 0.000 description 11
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 11
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 11
- 150000003254 radicals Chemical class 0.000 description 11
- 230000001629 suppression Effects 0.000 description 11
- 238000012360 testing method Methods 0.000 description 11
- 241000588724 Escherichia coli Species 0.000 description 10
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 10
- 108010076504 Protein Sorting Signals Proteins 0.000 description 10
- 239000011616 biotin Substances 0.000 description 10
- 229960002685 biotin Drugs 0.000 description 10
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 10
- 230000005847 immunogenicity Effects 0.000 description 10
- 230000001976 improved effect Effects 0.000 description 10
- 238000010348 incorporation Methods 0.000 description 10
- 230000004044 response Effects 0.000 description 10
- 230000028327 secretion Effects 0.000 description 10
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 9
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 9
- 101150029707 ERBB2 gene Proteins 0.000 description 9
- 241001465754 Metazoa Species 0.000 description 9
- 108020005038 Terminator Codon Proteins 0.000 description 9
- 238000004458 analytical method Methods 0.000 description 9
- 239000005557 antagonist Substances 0.000 description 9
- 238000013459 approach Methods 0.000 description 9
- 150000001720 carbohydrates Chemical group 0.000 description 9
- 235000019152 folic acid Nutrition 0.000 description 9
- 229940072221 immunoglobulins Drugs 0.000 description 9
- 229960001153 serine Drugs 0.000 description 9
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 8
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 8
- 150000001412 amines Chemical class 0.000 description 8
- 239000003599 detergent Substances 0.000 description 8
- 239000000539 dimer Substances 0.000 description 8
- 238000006471 dimerization reaction Methods 0.000 description 8
- 201000010099 disease Diseases 0.000 description 8
- 230000002255 enzymatic effect Effects 0.000 description 8
- 125000004404 heteroalkyl group Chemical group 0.000 description 8
- 238000009396 hybridization Methods 0.000 description 8
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 8
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 8
- 239000013612 plasmid Substances 0.000 description 8
- 125000006239 protecting group Chemical group 0.000 description 8
- 238000000746 purification Methods 0.000 description 8
- DUIOPKIIICUYRZ-UHFFFAOYSA-N semicarbazide group Chemical group NNC(=O)N DUIOPKIIICUYRZ-UHFFFAOYSA-N 0.000 description 8
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- 241000196324 Embryophyta Species 0.000 description 7
- 241000206602 Eukaryota Species 0.000 description 7
- 108010087819 Fc receptors Proteins 0.000 description 7
- 102000009109 Fc receptors Human genes 0.000 description 7
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 7
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 7
- 241000124008 Mammalia Species 0.000 description 7
- 102000035195 Peptidases Human genes 0.000 description 7
- 108091005804 Peptidases Proteins 0.000 description 7
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 7
- 239000004473 Threonine Substances 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- 238000010958 [3+2] cycloaddition reaction Methods 0.000 description 7
- 239000013543 active substance Substances 0.000 description 7
- 239000002246 antineoplastic agent Substances 0.000 description 7
- 230000001580 bacterial effect Effects 0.000 description 7
- 235000020958 biotin Nutrition 0.000 description 7
- 125000004432 carbon atom Chemical group C* 0.000 description 7
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 7
- 230000021615 conjugation Effects 0.000 description 7
- 102000037865 fusion proteins Human genes 0.000 description 7
- 108020001507 fusion proteins Proteins 0.000 description 7
- 229910052736 halogen Inorganic materials 0.000 description 7
- 125000001072 heteroaryl group Chemical group 0.000 description 7
- 125000005842 heteroatom Chemical group 0.000 description 7
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 7
- OAKJQQAXSVQMHS-UHFFFAOYSA-N hydrazine group Chemical group NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 7
- 230000002401 inhibitory effect Effects 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 229930182817 methionine Natural products 0.000 description 7
- 230000006320 pegylation Effects 0.000 description 7
- 229960002898 threonine Drugs 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 238000012546 transfer Methods 0.000 description 7
- 208000026310 Breast neoplasm Diseases 0.000 description 6
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 239000004365 Protease Substances 0.000 description 6
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 6
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 6
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 6
- 230000004913 activation Effects 0.000 description 6
- 230000009824 affinity maturation Effects 0.000 description 6
- 125000002947 alkylene group Chemical group 0.000 description 6
- 125000002344 aminooxy group Chemical group [H]N([H])O[*] 0.000 description 6
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 6
- 210000004899 c-terminal region Anatomy 0.000 description 6
- 229910052799 carbon Inorganic materials 0.000 description 6
- 239000013522 chelant Substances 0.000 description 6
- 239000002738 chelating agent Substances 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 230000008878 coupling Effects 0.000 description 6
- 238000010168 coupling process Methods 0.000 description 6
- 238000005859 coupling reaction Methods 0.000 description 6
- 125000000753 cycloalkyl group Chemical group 0.000 description 6
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 6
- 231100000433 cytotoxic Toxicity 0.000 description 6
- 230000001472 cytotoxic effect Effects 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 230000002708 enhancing effect Effects 0.000 description 6
- 150000002367 halogens Chemical class 0.000 description 6
- 125000000592 heterocycloalkyl group Chemical group 0.000 description 6
- 238000003780 insertion Methods 0.000 description 6
- 230000037431 insertion Effects 0.000 description 6
- 230000003993 interaction Effects 0.000 description 6
- 239000002502 liposome Substances 0.000 description 6
- 229910052751 metal Inorganic materials 0.000 description 6
- 239000002184 metal Substances 0.000 description 6
- 229910052760 oxygen Inorganic materials 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 125000003107 substituted aryl group Chemical group 0.000 description 6
- 229910052717 sulfur Inorganic materials 0.000 description 6
- 108020005098 Anticodon Proteins 0.000 description 5
- 206010006187 Breast cancer Diseases 0.000 description 5
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 5
- 102000004127 Cytokines Human genes 0.000 description 5
- 108090000695 Cytokines Proteins 0.000 description 5
- 102000016607 Diphtheria Toxin Human genes 0.000 description 5
- 108010053187 Diphtheria Toxin Proteins 0.000 description 5
- 241000238631 Hexapoda Species 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 5
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 5
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 5
- 108010002350 Interleukin-2 Proteins 0.000 description 5
- 102000000588 Interleukin-2 Human genes 0.000 description 5
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 5
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 description 5
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 5
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 5
- 239000000556 agonist Substances 0.000 description 5
- 235000004279 alanine Nutrition 0.000 description 5
- 150000001299 aldehydes Chemical class 0.000 description 5
- 230000002494 anti-cea effect Effects 0.000 description 5
- 230000000692 anti-sense effect Effects 0.000 description 5
- 229960001230 asparagine Drugs 0.000 description 5
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 5
- 239000012620 biological material Substances 0.000 description 5
- 150000001615 biotins Chemical class 0.000 description 5
- 230000001413 cellular effect Effects 0.000 description 5
- 238000010276 construction Methods 0.000 description 5
- 230000003013 cytotoxicity Effects 0.000 description 5
- 231100000135 cytotoxicity Toxicity 0.000 description 5
- 239000003398 denaturant Substances 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 239000003937 drug carrier Substances 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 230000002068 genetic effect Effects 0.000 description 5
- 239000003102 growth factor Substances 0.000 description 5
- 125000004474 heteroalkylene group Chemical group 0.000 description 5
- 239000001257 hydrogen Substances 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 238000002513 implantation Methods 0.000 description 5
- 230000002757 inflammatory effect Effects 0.000 description 5
- 238000002955 isolation Methods 0.000 description 5
- 239000002609 medium Substances 0.000 description 5
- 239000000178 monomer Substances 0.000 description 5
- 230000036961 partial effect Effects 0.000 description 5
- 229920001515 polyalkylene glycol Polymers 0.000 description 5
- 150000003839 salts Chemical class 0.000 description 5
- 125000000547 substituted alkyl group Chemical group 0.000 description 5
- 229940124597 therapeutic agent Drugs 0.000 description 5
- 210000004881 tumor cell Anatomy 0.000 description 5
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 4
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 101710132601 Capsid protein Proteins 0.000 description 4
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 4
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 4
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 4
- 241000233866 Fungi Species 0.000 description 4
- 102000003886 Glycoproteins Human genes 0.000 description 4
- 108090000288 Glycoproteins Proteins 0.000 description 4
- 101001023230 Homo sapiens Folate receptor alpha Proteins 0.000 description 4
- 206010020751 Hypersensitivity Diseases 0.000 description 4
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 4
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 4
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 4
- 102000000589 Interleukin-1 Human genes 0.000 description 4
- 108010002352 Interleukin-1 Proteins 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- 102000003960 Ligases Human genes 0.000 description 4
- 108090000364 Ligases Proteins 0.000 description 4
- 108091005461 Nucleic proteins Proteins 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 4
- 108010071390 Serum Albumin Proteins 0.000 description 4
- 102000007562 Serum Albumin Human genes 0.000 description 4
- 102000013275 Somatomedins Human genes 0.000 description 4
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 4
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 4
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 4
- 125000003545 alkoxy group Chemical group 0.000 description 4
- 125000000304 alkynyl group Chemical group 0.000 description 4
- 208000026935 allergic disease Diseases 0.000 description 4
- 230000004075 alteration Effects 0.000 description 4
- 150000001408 amides Chemical class 0.000 description 4
- 125000003277 amino group Chemical group 0.000 description 4
- 125000003710 aryl alkyl group Chemical group 0.000 description 4
- 235000009582 asparagine Nutrition 0.000 description 4
- 208000006673 asthma Diseases 0.000 description 4
- 230000000975 bioactive effect Effects 0.000 description 4
- 230000000903 blocking effect Effects 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 235000014633 carbohydrates Nutrition 0.000 description 4
- 229910002092 carbon dioxide Inorganic materials 0.000 description 4
- 230000003197 catalytic effect Effects 0.000 description 4
- 230000008859 change Effects 0.000 description 4
- 239000007795 chemical reaction product Substances 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000001086 cytosolic effect Effects 0.000 description 4
- 230000003247 decreasing effect Effects 0.000 description 4
- 229940126864 fibroblast growth factor Drugs 0.000 description 4
- 230000037433 frameshift Effects 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 125000004435 hydrogen atom Chemical class [H]* 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 230000000269 nucleophilic effect Effects 0.000 description 4
- 229920001542 oligosaccharide Polymers 0.000 description 4
- 150000002482 oligosaccharides Chemical class 0.000 description 4
- 230000002018 overexpression Effects 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 238000010647 peptide synthesis reaction Methods 0.000 description 4
- 239000008194 pharmaceutical composition Substances 0.000 description 4
- 229960005190 phenylalanine Drugs 0.000 description 4
- 150000003904 phospholipids Chemical class 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000002441 reversible effect Effects 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 238000012216 screening Methods 0.000 description 4
- 230000011664 signaling Effects 0.000 description 4
- RYYWUUFWQRZTIU-UHFFFAOYSA-K thiophosphate Chemical compound [O-]P([O-])([O-])=S RYYWUUFWQRZTIU-UHFFFAOYSA-K 0.000 description 4
- 231100000331 toxic Toxicity 0.000 description 4
- 230000002588 toxic effect Effects 0.000 description 4
- 230000014616 translation Effects 0.000 description 4
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 4
- 241001515965 unidentified phage Species 0.000 description 4
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 4
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 3
- 239000004475 Arginine Substances 0.000 description 3
- 102100032937 CD40 ligand Human genes 0.000 description 3
- 241000282832 Camelidae Species 0.000 description 3
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 3
- FDKWRPBBCBCIGA-UWTATZPHSA-N D-Selenocysteine Natural products [Se]C[C@@H](N)C(O)=O FDKWRPBBCBCIGA-UWTATZPHSA-N 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 101150039808 Egfr gene Proteins 0.000 description 3
- 101800003838 Epidermal growth factor Proteins 0.000 description 3
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 3
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 3
- 102100034221 Growth-regulated alpha protein Human genes 0.000 description 3
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 3
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 3
- 238000006736 Huisgen cycloaddition reaction Methods 0.000 description 3
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 3
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- ZKZBPNGNEQAJSX-REOHCLBHSA-N L-selenocysteine Chemical compound [SeH]C[C@H](N)C(O)=O ZKZBPNGNEQAJSX-REOHCLBHSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 108010052285 Membrane Proteins Proteins 0.000 description 3
- SSURCGGGQUWIHH-UHFFFAOYSA-N NNON Chemical compound NNON SSURCGGGQUWIHH-UHFFFAOYSA-N 0.000 description 3
- 102000014413 Neuregulin Human genes 0.000 description 3
- 108050003475 Neuregulin Proteins 0.000 description 3
- 108091060545 Nonsense suppressor Proteins 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 102100033237 Pro-epidermal growth factor Human genes 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 3
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 108010039491 Ricin Proteins 0.000 description 3
- 206010040070 Septic Shock Diseases 0.000 description 3
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 3
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 3
- 230000003213 activating effect Effects 0.000 description 3
- 239000012190 activator Substances 0.000 description 3
- 230000000890 antigenic effect Effects 0.000 description 3
- 229940041181 antineoplastic drug Drugs 0.000 description 3
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 3
- 235000009697 arginine Nutrition 0.000 description 3
- 235000003704 aspartic acid Nutrition 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 239000011324 bead Substances 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 3
- 230000001851 biosynthetic effect Effects 0.000 description 3
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 3
- 229930195731 calicheamicin Natural products 0.000 description 3
- 150000001721 carbon Chemical group 0.000 description 3
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 3
- 150000001735 carboxylic acids Chemical class 0.000 description 3
- 230000010261 cell growth Effects 0.000 description 3
- 239000003638 chemical reducing agent Substances 0.000 description 3
- 230000001268 conjugating effect Effects 0.000 description 3
- 239000010949 copper Substances 0.000 description 3
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 3
- 239000002619 cytotoxin Substances 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 238000010494 dissociation reaction Methods 0.000 description 3
- 230000005593 dissociations Effects 0.000 description 3
- 231100000673 dose–response relationship Toxicity 0.000 description 3
- 241001493065 dsRNA viruses Species 0.000 description 3
- 239000000975 dye Substances 0.000 description 3
- 229960001484 edetic acid Drugs 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000006911 enzymatic reaction Methods 0.000 description 3
- 229940116977 epidermal growth factor Drugs 0.000 description 3
- 108700021358 erbB-1 Genes Proteins 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- 229920001002 functional polymer Polymers 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 229960002989 glutamic acid Drugs 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 3
- 235000004554 glutamine Nutrition 0.000 description 3
- 230000013595 glycosylation Effects 0.000 description 3
- 238000006206 glycosylation reaction Methods 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 230000036541 health Effects 0.000 description 3
- 208000002672 hepatitis B Diseases 0.000 description 3
- 230000007062 hydrolysis Effects 0.000 description 3
- 238000006460 hydrolysis reaction Methods 0.000 description 3
- 230000002209 hydrophobic effect Effects 0.000 description 3
- 229940127121 immunoconjugate Drugs 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 229940125425 inverse agonist Drugs 0.000 description 3
- 229960000310 isoleucine Drugs 0.000 description 3
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 3
- 150000002632 lipids Chemical class 0.000 description 3
- 230000004807 localization Effects 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 3
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 125000004433 nitrogen atom Chemical group N* 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 239000007800 oxidant agent Substances 0.000 description 3
- 239000004031 partial agonist Substances 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 239000000816 peptidomimetic Substances 0.000 description 3
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 235000008729 phenylalanine Nutrition 0.000 description 3
- 239000007856 photoaffinity label Substances 0.000 description 3
- 230000004962 physiological condition Effects 0.000 description 3
- 229920001451 polypropylene glycol Polymers 0.000 description 3
- 230000036515 potency Effects 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 230000004952 protein activity Effects 0.000 description 3
- 108020001580 protein domains Proteins 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 238000010188 recombinant method Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 description 3
- 229940055619 selenocysteine Drugs 0.000 description 3
- 235000016491 selenocysteine Nutrition 0.000 description 3
- ZKZBPNGNEQAJSX-UHFFFAOYSA-N selenocysteine Natural products [SeH]CC(N)C(O)=O ZKZBPNGNEQAJSX-UHFFFAOYSA-N 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 125000004434 sulfur atom Chemical group 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 108091006106 transcriptional activators Proteins 0.000 description 3
- 230000009261 transgenic effect Effects 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- 229960004441 tyrosine Drugs 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 235000002374 tyrosine Nutrition 0.000 description 3
- 235000014393 valine Nutrition 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 2
- VILCJCGEZXAXTO-UHFFFAOYSA-N 2,2,2-tetramine Chemical compound NCCNCCNCCN VILCJCGEZXAXTO-UHFFFAOYSA-N 0.000 description 2
- RAEOEMDZDMCHJA-UHFFFAOYSA-N 2-[2-[bis(carboxymethyl)amino]ethyl-[2-[2-[bis(carboxymethyl)amino]ethyl-(carboxymethyl)amino]ethyl]amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CCN(CC(O)=O)CC(O)=O)CC(O)=O RAEOEMDZDMCHJA-UHFFFAOYSA-N 0.000 description 2
- VPFUWHKTPYPNGT-UHFFFAOYSA-N 3-(3,4-dihydroxyphenyl)-1-(5-hydroxy-2,2-dimethylchromen-6-yl)propan-1-one Chemical compound OC1=C2C=CC(C)(C)OC2=CC=C1C(=O)CCC1=CC=C(O)C(O)=C1 VPFUWHKTPYPNGT-UHFFFAOYSA-N 0.000 description 2
- 108010068327 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 description 2
- 102100033400 4F2 cell-surface antigen heavy chain Human genes 0.000 description 2
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 2
- 108010066676 Abrin Proteins 0.000 description 2
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 2
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 2
- 235000002198 Annona diversifolia Nutrition 0.000 description 2
- 101000642536 Apis mellifera Venom serine protease 34 Proteins 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 108090001008 Avidin Proteins 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 108700020463 BRCA1 Proteins 0.000 description 2
- 102000036365 BRCA1 Human genes 0.000 description 2
- 101150072950 BRCA1 gene Proteins 0.000 description 2
- 108700020462 BRCA2 Proteins 0.000 description 2
- 102000052609 BRCA2 Human genes 0.000 description 2
- 101150008921 Brca2 gene Proteins 0.000 description 2
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 2
- 102100021943 C-C motif chemokine 2 Human genes 0.000 description 2
- 101710155857 C-C motif chemokine 2 Proteins 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 101150013553 CD40 gene Proteins 0.000 description 2
- 102100032912 CD44 antigen Human genes 0.000 description 2
- 102100037904 CD9 antigen Human genes 0.000 description 2
- 101150093802 CXCL1 gene Proteins 0.000 description 2
- 108090000565 Capsid Proteins Proteins 0.000 description 2
- 108010084457 Cathepsins Proteins 0.000 description 2
- 102000005600 Cathepsins Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 102100023321 Ceruloplasmin Human genes 0.000 description 2
- 206010009944 Colon cancer Diseases 0.000 description 2
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 2
- 102100030886 Complement receptor type 1 Human genes 0.000 description 2
- 229920000858 Cyclodextrin Polymers 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 101710112752 Cytotoxin Proteins 0.000 description 2
- 150000008574 D-amino acids Chemical group 0.000 description 2
- 102000018386 EGF Family of Proteins Human genes 0.000 description 2
- 108010066486 EGF Family of Proteins Proteins 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 241000724791 Filamentous phage Species 0.000 description 2
- 102000010451 Folate receptor alpha Human genes 0.000 description 2
- 108050001931 Folate receptor alpha Proteins 0.000 description 2
- 102100035139 Folate receptor alpha Human genes 0.000 description 2
- 108091006027 G proteins Proteins 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 108010051696 Growth Hormone Proteins 0.000 description 2
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical compound NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 2
- 241000205062 Halobacterium Species 0.000 description 2
- 108090000100 Hepatocyte Growth Factor Proteins 0.000 description 2
- 102100021866 Hepatocyte growth factor Human genes 0.000 description 2
- 101000800023 Homo sapiens 4F2 cell-surface antigen heavy chain Proteins 0.000 description 2
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 2
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 2
- 101000727061 Homo sapiens Complement receptor type 1 Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 102000002265 Human Growth Hormone Human genes 0.000 description 2
- 108010000521 Human Growth Hormone Proteins 0.000 description 2
- 239000000854 Human Growth Hormone Substances 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 2
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 2
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 2
- 101000668058 Infectious salmon anemia virus (isolate Atlantic salmon/Norway/810/9/99) RNA-directed RNA polymerase catalytic subunit Proteins 0.000 description 2
- 102100025306 Integrin alpha-IIb Human genes 0.000 description 2
- 108010050904 Interferons Proteins 0.000 description 2
- 102000014150 Interferons Human genes 0.000 description 2
- 108090000174 Interleukin-10 Proteins 0.000 description 2
- 108010002616 Interleukin-5 Proteins 0.000 description 2
- 108090001005 Interleukin-6 Proteins 0.000 description 2
- 102000004889 Interleukin-6 Human genes 0.000 description 2
- 108090001007 Interleukin-8 Proteins 0.000 description 2
- 102000015696 Interleukins Human genes 0.000 description 2
- 108010063738 Interleukins Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 2
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 2
- 241000282838 Lama Species 0.000 description 2
- 102000003820 Lipoxygenases Human genes 0.000 description 2
- 108090000128 Lipoxygenases Proteins 0.000 description 2
- 101710151805 Mitochondrial intermediate peptidase 1 Proteins 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 2
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 2
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 2
- 108020004485 Nonsense Codon Proteins 0.000 description 2
- 102000007999 Nuclear Proteins Human genes 0.000 description 2
- 108010089610 Nuclear Proteins Proteins 0.000 description 2
- 108700020796 Oncogene Proteins 0.000 description 2
- 102000043276 Oncogene Human genes 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 2
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical compound CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 2
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 2
- 101000762949 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) Exotoxin A Proteins 0.000 description 2
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 2
- 229910007161 Si(CH3)3 Inorganic materials 0.000 description 2
- FKNQFGJONOIPTF-UHFFFAOYSA-N Sodium cation Chemical compound [Na+] FKNQFGJONOIPTF-UHFFFAOYSA-N 0.000 description 2
- 102100038803 Somatotropin Human genes 0.000 description 2
- 241000295644 Staphylococcaceae Species 0.000 description 2
- 241000191967 Staphylococcus aureus Species 0.000 description 2
- 241000191963 Staphylococcus epidermidis Species 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 108010090804 Streptavidin Proteins 0.000 description 2
- 108090000787 Subtilisin Proteins 0.000 description 2
- 230000010782 T cell mediated cytotoxicity Effects 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- RYYWUUFWQRZTIU-UHFFFAOYSA-N Thiophosphoric acid Chemical class OP(O)(S)=O RYYWUUFWQRZTIU-UHFFFAOYSA-N 0.000 description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 description 2
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 102100031358 Urokinase-type plasminogen activator Human genes 0.000 description 2
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 2
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 2
- 108700020467 WT1 Proteins 0.000 description 2
- 101150084041 WT1 gene Proteins 0.000 description 2
- 102100022748 Wilms tumor protein Human genes 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000007801 affinity label Substances 0.000 description 2
- 125000003342 alkenyl group Chemical group 0.000 description 2
- 235000008206 alpha-amino acids Nutrition 0.000 description 2
- 239000003242 anti bacterial agent Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 125000004104 aryloxy group Chemical group 0.000 description 2
- 125000004429 atom Chemical group 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 238000006664 bond formation reaction Methods 0.000 description 2
- 230000022131 cell cycle Effects 0.000 description 2
- 230000024245 cell differentiation Effects 0.000 description 2
- 230000032823 cell division Effects 0.000 description 2
- 210000000170 cell membrane Anatomy 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- 108010047295 complement receptors Proteins 0.000 description 2
- 102000006834 complement receptors Human genes 0.000 description 2
- 230000004154 complement system Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 125000004122 cyclic group Chemical group 0.000 description 2
- 238000006352 cycloaddition reaction Methods 0.000 description 2
- 125000000392 cycloalkenyl group Chemical group 0.000 description 2
- UFULAYFCSOUIOV-UHFFFAOYSA-N cysteamine Chemical compound NCCS UFULAYFCSOUIOV-UHFFFAOYSA-N 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 238000002784 cytotoxicity assay Methods 0.000 description 2
- 231100000263 cytotoxicity test Toxicity 0.000 description 2
- 239000000412 dendrimer Substances 0.000 description 2
- 229920000736 dendritic polymer Polymers 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 235000005911 diet Nutrition 0.000 description 2
- 230000037213 diet Effects 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- XBDQKXXYIPTUBI-UHFFFAOYSA-N dimethylselenoniopropionate Natural products CCC(O)=O XBDQKXXYIPTUBI-UHFFFAOYSA-N 0.000 description 2
- ZUOUZKKEUPVFJK-UHFFFAOYSA-N diphenyl Chemical compound C1=CC=CC=C1C1=CC=CC=C1 ZUOUZKKEUPVFJK-UHFFFAOYSA-N 0.000 description 2
- 206010013023 diphtheria Diseases 0.000 description 2
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 2
- 230000012361 double-strand break repair Effects 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 238000005538 encapsulation Methods 0.000 description 2
- 239000002158 endotoxin Substances 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 2
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 2
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 2
- 239000002095 exotoxin Substances 0.000 description 2
- 231100000776 exotoxin Toxicity 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 229950003499 fibrin Drugs 0.000 description 2
- 125000001153 fluoro group Chemical group F* 0.000 description 2
- 229960000304 folic acid Drugs 0.000 description 2
- 108010033706 glycylserine Proteins 0.000 description 2
- 239000010931 gold Substances 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 125000005843 halogen group Chemical group 0.000 description 2
- 230000003862 health status Effects 0.000 description 2
- 125000000623 heterocyclic group Chemical group 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 102000053180 human FOLR1 Human genes 0.000 description 2
- 150000002430 hydrocarbons Chemical group 0.000 description 2
- 229920001477 hydrophilic polymer Polymers 0.000 description 2
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 2
- 125000001841 imino group Chemical group [H]N=* 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 230000002637 immunotoxin Effects 0.000 description 2
- 229940051026 immunotoxin Drugs 0.000 description 2
- 239000002596 immunotoxin Substances 0.000 description 2
- 231100000608 immunotoxin Toxicity 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 102000006495 integrins Human genes 0.000 description 2
- 108010044426 integrins Proteins 0.000 description 2
- 238000009830 intercalation Methods 0.000 description 2
- 230000002452 interceptive effect Effects 0.000 description 2
- 229940047124 interferons Drugs 0.000 description 2
- 108040006849 interleukin-2 receptor activity proteins Proteins 0.000 description 2
- 229940047122 interleukins Drugs 0.000 description 2
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 2
- 238000005304 joining Methods 0.000 description 2
- 125000000468 ketone group Chemical group 0.000 description 2
- 150000002576 ketones Chemical class 0.000 description 2
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical group O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 description 2
- 229920006008 lipopolysaccharide Polymers 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 230000033607 mismatch repair Effects 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 description 2
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 2
- 239000002105 nanoparticle Substances 0.000 description 2
- 210000000653 nervous system Anatomy 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- 239000002777 nucleoside Substances 0.000 description 2
- 125000004430 oxygen atom Chemical group O* 0.000 description 2
- 229960002087 pertuzumab Drugs 0.000 description 2
- 239000002831 pharmacologic agent Substances 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000000704 physical effect Effects 0.000 description 2
- 230000003169 placental effect Effects 0.000 description 2
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- OXCMYAYHXIHQOA-UHFFFAOYSA-N potassium;[2-butyl-5-chloro-3-[[4-[2-(1,2,4-triaza-3-azanidacyclopenta-1,4-dien-5-yl)phenyl]phenyl]methyl]imidazol-4-yl]methanol Chemical compound [K+].CCCCC1=NC(Cl)=C(CO)N1CC1=CC=C(C=2C(=CC=CC=2)C2=N[N-]N=N2)C=C1 OXCMYAYHXIHQOA-UHFFFAOYSA-N 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 235000013930 proline Nutrition 0.000 description 2
- 230000009145 protein modification Effects 0.000 description 2
- 230000030788 protein refolding Effects 0.000 description 2
- 230000004850 protein–protein interaction Effects 0.000 description 2
- 239000002534 radiation-sensitizing agent Substances 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 238000007363 ring formation reaction Methods 0.000 description 2
- 229920002477 rna polymer Polymers 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- HFHDHCJBZVLPGP-UHFFFAOYSA-N schardinger α-dextrin Chemical compound O1C(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC(C(O)C2O)C(CO)OC2OC(C(C2O)O)C(CO)OC2OC2C(O)C(O)C1OC2CO HFHDHCJBZVLPGP-UHFFFAOYSA-N 0.000 description 2
- 230000036303 septic shock Effects 0.000 description 2
- 238000007086 side reaction Methods 0.000 description 2
- 229910052710 silicon Inorganic materials 0.000 description 2
- 229910001415 sodium ion Inorganic materials 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000007790 solid phase Substances 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000002904 solvent Substances 0.000 description 2
- 229960000553 somatostatin Drugs 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000013589 supplement Substances 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- 125000005309 thioalkoxy group Chemical group 0.000 description 2
- 229960000187 tissue plasminogen activator Drugs 0.000 description 2
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 2
- 238000007070 tosylation reaction Methods 0.000 description 2
- 238000006257 total synthesis reaction Methods 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- 230000035897 transcription Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 125000004417 unsaturated alkyl group Chemical group 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 229920002554 vinyl polymer Polymers 0.000 description 2
- 239000013603 viral vector Substances 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 2
- RWLSBXBFZHDHHX-VIFPVBQESA-N (2s)-2-(naphthalen-2-ylamino)propanoic acid Chemical compound C1=CC=CC2=CC(N[C@@H](C)C(O)=O)=CC=C21 RWLSBXBFZHDHHX-VIFPVBQESA-N 0.000 description 1
- JSXMFBNJRFXRCX-NSHDSACASA-N (2s)-2-amino-3-(4-prop-2-ynoxyphenyl)propanoic acid Chemical compound OC(=O)[C@@H](N)CC1=CC=C(OCC#C)C=C1 JSXMFBNJRFXRCX-NSHDSACASA-N 0.000 description 1
- NEMHIKRLROONTL-QMMMGPOBSA-N (2s)-2-azaniumyl-3-(4-azidophenyl)propanoate Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N=[N+]=[N-])C=C1 NEMHIKRLROONTL-QMMMGPOBSA-N 0.000 description 1
- BNIFSVVAHBLNTN-XKKUQSFHSA-N (2s)-4-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-4-amino-2-[[2-[[(2s)-2-[[(2s)-2-[[(2s)-1-[(2s)-6-amino-2-[[(2s)-2-[[(2s)-2-[[(2s,3r)-2-amino-3-hydroxybutanoyl]amino]-4-methylsulfanylbutanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]hexan Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N1[C@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(O)=O)CCC1 BNIFSVVAHBLNTN-XKKUQSFHSA-N 0.000 description 1
- YPGMOWHXEQDBBV-QWWZWVQMSA-N (4S,5S)-1,2-dithiane-4,5-diol Chemical compound O[C@@H]1CSSC[C@H]1O YPGMOWHXEQDBBV-QWWZWVQMSA-N 0.000 description 1
- JWCYROGSQSBTCX-UHFFFAOYSA-N (5-iminothiolan-3-yl)methanethiol Chemical compound SCC1CSC(=N)C1 JWCYROGSQSBTCX-UHFFFAOYSA-N 0.000 description 1
- 108010052418 (N-(2-((4-((2-((4-(9-acridinylamino)phenyl)amino)-2-oxoethyl)amino)-4-oxobutyl)amino)-1-(1H-imidazol-4-ylmethyl)-1-oxoethyl)-6-(((-2-aminoethyl)amino)methyl)-2-pyridinecarboxamidato) iron(1+) Proteins 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 1
- 125000000196 1,4-pentadienyl group Chemical group [H]C([*])=C([H])C([H])([H])C([H])=C([H])[H] 0.000 description 1
- BBCZJRSZHIFFAB-UHFFFAOYSA-N 1-(dimethylamino)-2-hydroxypropane-1-sulfonic acid Chemical compound CC(O)C(N(C)C)S(O)(=O)=O BBCZJRSZHIFFAB-UHFFFAOYSA-N 0.000 description 1
- 125000001637 1-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C(*)=C([H])C([H])=C([H])C2=C1[H] 0.000 description 1
- BNZPFJBUHRBLNB-UHFFFAOYSA-N 1-oxido-1,2,4-benzotriazin-1-ium Chemical class C1=CC=C2[N+]([O-])=NC=NC2=C1 BNZPFJBUHRBLNB-UHFFFAOYSA-N 0.000 description 1
- 125000004214 1-pyrrolidinyl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000001462 1-pyrrolyl group Chemical group [*]N1C([H])=C([H])C([H])=C1[H] 0.000 description 1
- HKAVADYDPYUPRD-UHFFFAOYSA-N 1h-pyrazine-2-thione Chemical compound SC1=CN=CC=N1 HKAVADYDPYUPRD-UHFFFAOYSA-N 0.000 description 1
- VGONTNSXDCQUGY-RRKCRQDMSA-N 2'-deoxyinosine Chemical group C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC2=O)=C2N=C1 VGONTNSXDCQUGY-RRKCRQDMSA-N 0.000 description 1
- GRUVVLWKPGIYEG-UHFFFAOYSA-N 2-[2-[carboxymethyl-[(2-hydroxyphenyl)methyl]amino]ethyl-[(2-hydroxyphenyl)methyl]amino]acetic acid Chemical compound C=1C=CC=C(O)C=1CN(CC(=O)O)CCN(CC(O)=O)CC1=CC=CC=C1O GRUVVLWKPGIYEG-UHFFFAOYSA-N 0.000 description 1
- SQWOBSHRAUJBNP-UHFFFAOYSA-N 2-[4,7,10-tris(carboxymethyl)-6-[(4-nitrophenyl)methyl]-1,4,7,10-tetrazacyclododec-1-yl]acetic acid Chemical class C1N(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CCN(CC(O)=O)C1CC1=CC=C([N+]([O-])=O)C=C1 SQWOBSHRAUJBNP-UHFFFAOYSA-N 0.000 description 1
- FBUTXZSKZCQABC-UHFFFAOYSA-N 2-amino-1-methyl-7h-purine-6-thione Chemical compound S=C1N(C)C(N)=NC2=C1NC=N2 FBUTXZSKZCQABC-UHFFFAOYSA-N 0.000 description 1
- 125000004174 2-benzimidazolyl group Chemical group [H]N1C(*)=NC2=C([H])C([H])=C([H])C([H])=C12 0.000 description 1
- STNZNCWQNMGRIM-UHFFFAOYSA-N 2-benzyl-1,4,7,10-tetrakis-(4-methylphenyl)sulfonyl-1,4,7,10-tetrazacyclododecane Chemical class C1=CC(C)=CC=C1S(=O)(=O)N1CCN(S(=O)(=O)C=2C=CC(C)=CC=2)CC(CC=2C=CC=CC=2)N(S(=O)(=O)C=2C=CC(C)=CC=2)CCN(S(=O)(=O)C=2C=CC(C)=CC=2)CC1 STNZNCWQNMGRIM-UHFFFAOYSA-N 0.000 description 1
- 125000002941 2-furyl group Chemical group O1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000954 2-hydroxyethyl group Chemical group [H]C([*])([H])C([H])([H])O[H] 0.000 description 1
- 125000001622 2-naphthyl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C(*)C([H])=C([H])C2=C1[H] 0.000 description 1
- KLGQWSOYKYFBTR-UHFFFAOYSA-N 2-nitrobenzamide Chemical class NC(=O)C1=CC=CC=C1[N+]([O-])=O KLGQWSOYKYFBTR-UHFFFAOYSA-N 0.000 description 1
- 125000000094 2-phenylethyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 1
- 125000001494 2-propynyl group Chemical group [H]C#CC([H])([H])* 0.000 description 1
- 125000004105 2-pyridyl group Chemical group N1=C([*])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000389 2-pyrrolyl group Chemical group [H]N1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000175 2-thienyl group Chemical group S1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000000474 3-butynyl group Chemical group [H]C#CC([H])([H])C([H])([H])* 0.000 description 1
- 125000003682 3-furyl group Chemical group O1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000003349 3-pyridyl group Chemical group N1=C([H])C([*])=C([H])C([H])=C1[H] 0.000 description 1
- 125000001397 3-pyrrolyl group Chemical group [H]N1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000001541 3-thienyl group Chemical group S1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 125000000339 4-pyridyl group Chemical group N1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 1
- KDDQRKBRJSGMQE-UHFFFAOYSA-N 4-thiazolyl Chemical group [C]1=CSC=N1 KDDQRKBRJSGMQE-UHFFFAOYSA-N 0.000 description 1
- 102100022464 5'-nucleotidase Human genes 0.000 description 1
- CWDWFSXUQODZGW-UHFFFAOYSA-N 5-thiazolyl Chemical group [C]1=CN=CS1 CWDWFSXUQODZGW-UHFFFAOYSA-N 0.000 description 1
- 102100029824 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 Human genes 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 1
- 102100025854 Acyl-coenzyme A thioesterase 1 Human genes 0.000 description 1
- 101710175445 Acyl-coenzyme A thioesterase 1 Proteins 0.000 description 1
- 102100026423 Adhesion G protein-coupled receptor E5 Human genes 0.000 description 1
- PQSUYGKTWSAVDQ-UHFFFAOYSA-N Aldosterone Natural products C1CC2C3CCC(C(=O)CO)C3(C=O)CC(O)C2C2(C)C1=CC(=O)CC2 PQSUYGKTWSAVDQ-UHFFFAOYSA-N 0.000 description 1
- PQSUYGKTWSAVDQ-ZVIOFETBSA-N Aldosterone Chemical compound C([C@@]1([C@@H](C(=O)CO)CC[C@H]1[C@@H]1CC2)C=O)[C@H](O)[C@@H]1[C@]1(C)C2=CC(=O)CC1 PQSUYGKTWSAVDQ-ZVIOFETBSA-N 0.000 description 1
- 108700028369 Alleles Proteins 0.000 description 1
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 description 1
- 108700023418 Amidases Proteins 0.000 description 1
- 102000004092 Amidohydrolases Human genes 0.000 description 1
- 108090000531 Amidohydrolases Proteins 0.000 description 1
- 102000006534 Amino Acid Isomerases Human genes 0.000 description 1
- 108010008830 Amino Acid Isomerases Proteins 0.000 description 1
- 102000052866 Amino Acyl-tRNA Synthetases Human genes 0.000 description 1
- 108700028939 Amino Acyl-tRNA Synthetases Proteins 0.000 description 1
- 102100022749 Aminopeptidase N Human genes 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 102000007592 Apolipoproteins Human genes 0.000 description 1
- 108010071619 Apolipoproteins Proteins 0.000 description 1
- 108010083590 Apoproteins Proteins 0.000 description 1
- 102000006410 Apoproteins Human genes 0.000 description 1
- 108010039627 Aprotinin Proteins 0.000 description 1
- 102000001381 Arachidonate 5-Lipoxygenase Human genes 0.000 description 1
- 108010093579 Arachidonate 5-lipoxygenase Proteins 0.000 description 1
- 241000203069 Archaea Species 0.000 description 1
- 241000205042 Archaeoglobus fulgidus Species 0.000 description 1
- 241000712891 Arenavirus Species 0.000 description 1
- IYMAXBFPHPZYIK-BQBZGAKWSA-N Arg-Gly-Asp Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IYMAXBFPHPZYIK-BQBZGAKWSA-N 0.000 description 1
- 102000009133 Arylsulfatases Human genes 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 101800001288 Atrial natriuretic factor Proteins 0.000 description 1
- 102400001282 Atrial natriuretic peptide Human genes 0.000 description 1
- 101800001890 Atrial natriuretic peptide Proteins 0.000 description 1
- 102100022717 Atypical chemokine receptor 1 Human genes 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 241000713840 Avian erythroblastosis virus Species 0.000 description 1
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 description 1
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 1
- 102100032412 Basigin Human genes 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 102100029945 Beta-galactoside alpha-2,6-sialyltransferase 1 Human genes 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- WKBOTKDWSSQWDR-UHFFFAOYSA-N Bromine atom Chemical compound [Br] WKBOTKDWSSQWDR-UHFFFAOYSA-N 0.000 description 1
- 102100032367 C-C motif chemokine 5 Human genes 0.000 description 1
- 102100032366 C-C motif chemokine 7 Human genes 0.000 description 1
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 description 1
- 101710098275 C-X-C motif chemokine 10 Proteins 0.000 description 1
- 102100036150 C-X-C motif chemokine 5 Human genes 0.000 description 1
- 102100036153 C-X-C motif chemokine 6 Human genes 0.000 description 1
- 101710085504 C-X-C motif chemokine 6 Proteins 0.000 description 1
- 102100032957 C5a anaphylatoxin chemotactic receptor 1 Human genes 0.000 description 1
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 1
- 102000001902 CC Chemokines Human genes 0.000 description 1
- 108010040471 CC Chemokines Proteins 0.000 description 1
- 102100035893 CD151 antigen Human genes 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 102000053028 CD36 Antigens Human genes 0.000 description 1
- 108010045374 CD36 Antigens Proteins 0.000 description 1
- 108010041397 CD4 Antigens Proteins 0.000 description 1
- 102100036008 CD48 antigen Human genes 0.000 description 1
- 108010065524 CD52 Antigen Proteins 0.000 description 1
- 102100022002 CD59 glycoprotein Human genes 0.000 description 1
- 102100025222 CD63 antigen Human genes 0.000 description 1
- 102100027221 CD81 antigen Human genes 0.000 description 1
- 102100027217 CD82 antigen Human genes 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 102000024905 CD99 Human genes 0.000 description 1
- 108060001253 CD99 Proteins 0.000 description 1
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 108050006947 CXC Chemokine Proteins 0.000 description 1
- 102000019388 CXC chemokine Human genes 0.000 description 1
- 102000055006 Calcitonin Human genes 0.000 description 1
- 108060001064 Calcitonin Proteins 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 108010006303 Carboxypeptidases Proteins 0.000 description 1
- 102000005367 Carboxypeptidases Human genes 0.000 description 1
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 1
- 102100025466 Carcinoembryonic antigen-related cell adhesion molecule 3 Human genes 0.000 description 1
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 description 1
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 description 1
- 102100025470 Carcinoembryonic antigen-related cell adhesion molecule 8 Human genes 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 102100023126 Cell surface glycoprotein MUC18 Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108010055166 Chemokine CCL5 Proteins 0.000 description 1
- 108010055124 Chemokine CCL7 Proteins 0.000 description 1
- 102000000012 Chemokine CCL8 Human genes 0.000 description 1
- 108010055204 Chemokine CCL8 Proteins 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical compound [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- 102100031699 Choline transporter-like protein 1 Human genes 0.000 description 1
- 241000223782 Ciliophora Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 102100022641 Coagulation factor IX Human genes 0.000 description 1
- 102100023804 Coagulation factor VII Human genes 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 102100031506 Complement C5 Human genes 0.000 description 1
- 108010028773 Complement C5 Proteins 0.000 description 1
- 102100025877 Complement component C1q receptor Human genes 0.000 description 1
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 1
- 229940124073 Complement inhibitor Drugs 0.000 description 1
- 102100032768 Complement receptor type 2 Human genes 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 102100031673 Corneodesmosin Human genes 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- OMFXVFTZEKFJBZ-UHFFFAOYSA-N Corticosterone Natural products O=C1CCC2(C)C3C(O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 OMFXVFTZEKFJBZ-UHFFFAOYSA-N 0.000 description 1
- 102100037364 Craniofacial development protein 1 Human genes 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 108700032819 Croton tiglium crotin II Proteins 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- VMQMZMRVKUZKQL-UHFFFAOYSA-N Cu+ Chemical class [Cu+] VMQMZMRVKUZKQL-UHFFFAOYSA-N 0.000 description 1
- JPVYNHNXODAKFH-UHFFFAOYSA-N Cu2+ Chemical compound [Cu+2] JPVYNHNXODAKFH-UHFFFAOYSA-N 0.000 description 1
- XFXPMWWXUTWYJX-UHFFFAOYSA-N Cyanide Chemical compound N#[C-] XFXPMWWXUTWYJX-UHFFFAOYSA-N 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- YAHZABJORDUQGO-NQXXGFSBSA-N D-ribulose 1,5-bisphosphate Chemical compound OP(=O)(O)OC[C@@H](O)[C@@H](O)C(=O)COP(O)(O)=O YAHZABJORDUQGO-NQXXGFSBSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 108010017826 DNA Polymerase I Proteins 0.000 description 1
- 102000004594 DNA Polymerase I Human genes 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 241000450599 DNA viruses Species 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical class CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 1
- QRLVDLBMBULFAL-UHFFFAOYSA-N Digitonin Natural products CC1CCC2(OC1)OC3C(O)C4C5CCC6CC(OC7OC(CO)C(OC8OC(CO)C(O)C(OC9OCC(O)C(O)C9OC%10OC(CO)C(O)C(OC%11OC(CO)C(O)C(O)C%11O)C%10O)C8O)C(O)C7O)C(O)CC6(C)C5CCC4(C)C3C2C QRLVDLBMBULFAL-UHFFFAOYSA-N 0.000 description 1
- LTMHDMANZUZIPE-AMTYYWEZSA-N Digoxin Natural products O([C@H]1[C@H](C)O[C@H](O[C@@H]2C[C@@H]3[C@@](C)([C@@H]4[C@H]([C@]5(O)[C@](C)([C@H](O)C4)[C@H](C4=CC(=O)OC4)CC5)CC3)CC2)C[C@@H]1O)[C@H]1O[C@H](C)[C@@H](O[C@H]2O[C@@H](C)[C@H](O)[C@@H](O)C2)[C@@H](O)C1 LTMHDMANZUZIPE-AMTYYWEZSA-N 0.000 description 1
- 108010028143 Dioxygenases Proteins 0.000 description 1
- 102000016680 Dioxygenases Human genes 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 1
- 102100024364 Disintegrin and metalloproteinase domain-containing protein 8 Human genes 0.000 description 1
- 102100023471 E-selectin Human genes 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 241000271022 Echis pyramidum Species 0.000 description 1
- 102100029722 Ectonucleoside triphosphate diphosphohydrolase 1 Human genes 0.000 description 1
- 102100031334 Elongation factor 2 Human genes 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 108010032976 Enfuvirtide Proteins 0.000 description 1
- 241000224431 Entamoeba Species 0.000 description 1
- 101100050026 Enterobacteria phage T4 y01J gene Proteins 0.000 description 1
- 101710104662 Enterotoxin type C-3 Proteins 0.000 description 1
- 101710121417 Envelope glycoprotein Proteins 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 108020002908 Epoxide hydrolase Proteins 0.000 description 1
- 102000005486 Epoxide hydrolase Human genes 0.000 description 1
- 102000003951 Erythropoietin Human genes 0.000 description 1
- 102100031939 Erythropoietin Human genes 0.000 description 1
- 108090000394 Erythropoietin Proteins 0.000 description 1
- 101900234631 Escherichia coli DNA polymerase I Proteins 0.000 description 1
- 101000867232 Escherichia coli Heat-stable enterotoxin II Proteins 0.000 description 1
- 108090000371 Esterases Proteins 0.000 description 1
- 102100030844 Exocyst complex component 1 Human genes 0.000 description 1
- 108060002716 Exonuclease Proteins 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 108010076282 Factor IX Proteins 0.000 description 1
- 108010023321 Factor VII Proteins 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- 108010014173 Factor X Proteins 0.000 description 1
- 238000008416 Ferritin Methods 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- 102000001390 Fructose-Bisphosphate Aldolase Human genes 0.000 description 1
- 108010068561 Fructose-Bisphosphate Aldolase Proteins 0.000 description 1
- 102000034286 G proteins Human genes 0.000 description 1
- 101150048348 GP41 gene Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 102000002464 Galactosidases Human genes 0.000 description 1
- 108010093031 Galactosidases Proteins 0.000 description 1
- 102100040837 Galactoside alpha-(1,2)-fucosyltransferase 2 Human genes 0.000 description 1
- 102100021260 Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 101710115997 Gamma-tubulin complex component 2 Proteins 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 241000193385 Geobacillus stearothermophilus Species 0.000 description 1
- 241000224466 Giardia Species 0.000 description 1
- 108010017544 Glucosylceramidase Proteins 0.000 description 1
- 102000004547 Glucosylceramidase Human genes 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 108010053070 Glutathione Disulfide Proteins 0.000 description 1
- JZNWSCPGTDBMEW-UHFFFAOYSA-N Glycerophosphorylethanolamin Natural products NCCOP(O)(=O)OCC(O)CO JZNWSCPGTDBMEW-UHFFFAOYSA-N 0.000 description 1
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 1
- 102000005744 Glycoside Hydrolases Human genes 0.000 description 1
- 108010031186 Glycoside Hydrolases Proteins 0.000 description 1
- 102000051366 Glycosyltransferases Human genes 0.000 description 1
- 108700023372 Glycosyltransferases Proteins 0.000 description 1
- 108010086677 Gonadotropins Proteins 0.000 description 1
- 102000006771 Gonadotropins Human genes 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 1
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 1
- 102000009465 Growth Factor Receptors Human genes 0.000 description 1
- 108010009202 Growth Factor Receptors Proteins 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 description 1
- 241000204933 Haloferax volcanii Species 0.000 description 1
- 102000003693 Hedgehog Proteins Human genes 0.000 description 1
- 108090000031 Hedgehog Proteins Proteins 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 208000005331 Hepatitis D Diseases 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- 102000007625 Hirudins Human genes 0.000 description 1
- 108010007267 Hirudins Proteins 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 101000678236 Homo sapiens 5'-nucleotidase Proteins 0.000 description 1
- 101000718243 Homo sapiens Adhesion G protein-coupled receptor E5 Proteins 0.000 description 1
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 description 1
- 101000757160 Homo sapiens Aminopeptidase N Proteins 0.000 description 1
- 101000678879 Homo sapiens Atypical chemokine receptor 1 Proteins 0.000 description 1
- 101000934359 Homo sapiens B-cell differentiation antigen CD72 Proteins 0.000 description 1
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 1
- 101000863864 Homo sapiens Beta-galactoside alpha-2,6-sialyltransferase 1 Proteins 0.000 description 1
- 101000947186 Homo sapiens C-X-C motif chemokine 5 Proteins 0.000 description 1
- 101000867983 Homo sapiens C5a anaphylatoxin chemotactic receptor 1 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 1
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 description 1
- 101000934368 Homo sapiens CD63 antigen Proteins 0.000 description 1
- 101000914479 Homo sapiens CD81 antigen Proteins 0.000 description 1
- 101000914469 Homo sapiens CD82 antigen Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000981093 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 1 Proteins 0.000 description 1
- 101000914337 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 3 Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 description 1
- 101000914320 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 8 Proteins 0.000 description 1
- 101000940912 Homo sapiens Choline transporter-like protein 1 Proteins 0.000 description 1
- 101000933665 Homo sapiens Complement component C1q receptor Proteins 0.000 description 1
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 1
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 description 1
- 101000880187 Homo sapiens Craniofacial development protein 1 Proteins 0.000 description 1
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 1
- 101000622123 Homo sapiens E-selectin Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101001012447 Homo sapiens Ectonucleoside triphosphate diphosphohydrolase 1 Proteins 0.000 description 1
- 101000881679 Homo sapiens Endoglin Proteins 0.000 description 1
- 101000893710 Homo sapiens Galactoside alpha-(1,2)-fucosyltransferase 2 Proteins 0.000 description 1
- 101000894906 Homo sapiens Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 Proteins 0.000 description 1
- 101001069921 Homo sapiens Growth-regulated alpha protein Proteins 0.000 description 1
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 description 1
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 1
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 1
- 101001078133 Homo sapiens Integrin alpha-2 Proteins 0.000 description 1
- 101000994378 Homo sapiens Integrin alpha-3 Proteins 0.000 description 1
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 1
- 101000994369 Homo sapiens Integrin alpha-5 Proteins 0.000 description 1
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 1
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 description 1
- 101001078143 Homo sapiens Integrin alpha-IIb Proteins 0.000 description 1
- 101001046677 Homo sapiens Integrin alpha-V Proteins 0.000 description 1
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 1
- 101001015004 Homo sapiens Integrin beta-3 Proteins 0.000 description 1
- 101001015006 Homo sapiens Integrin beta-4 Proteins 0.000 description 1
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 1
- 101000599858 Homo sapiens Intercellular adhesion molecule 2 Proteins 0.000 description 1
- 101000599862 Homo sapiens Intercellular adhesion molecule 3 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001076422 Homo sapiens Interleukin-1 receptor type 2 Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101000605020 Homo sapiens Large neutral amino acids transporter small subunit 1 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101000984196 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily A member 5 Proteins 0.000 description 1
- 101000984190 Homo sapiens Leukocyte immunoglobulin-like receptor subfamily B member 1 Proteins 0.000 description 1
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 1
- 101000980823 Homo sapiens Leukocyte surface antigen CD53 Proteins 0.000 description 1
- 101000608935 Homo sapiens Leukosialin Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 1
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 description 1
- 101001023379 Homo sapiens Lysosome-associated membrane glycoprotein 1 Proteins 0.000 description 1
- 101000604993 Homo sapiens Lysosome-associated membrane glycoprotein 2 Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101000961414 Homo sapiens Membrane cofactor protein Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101000971513 Homo sapiens Natural killer cells antigen CD94 Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101000973997 Homo sapiens Nucleosome assembly protein 1-like 4 Proteins 0.000 description 1
- 101000622137 Homo sapiens P-selectin Proteins 0.000 description 1
- 101000947178 Homo sapiens Platelet basic protein Proteins 0.000 description 1
- 101001071312 Homo sapiens Platelet glycoprotein IX Proteins 0.000 description 1
- 101001070790 Homo sapiens Platelet glycoprotein Ib alpha chain Proteins 0.000 description 1
- 101001070786 Homo sapiens Platelet glycoprotein Ib beta chain Proteins 0.000 description 1
- 101001033026 Homo sapiens Platelet glycoprotein V Proteins 0.000 description 1
- 101000692455 Homo sapiens Platelet-derived growth factor receptor beta Proteins 0.000 description 1
- 101000617708 Homo sapiens Pregnancy-specific beta-1-glycoprotein 1 Proteins 0.000 description 1
- 101001043564 Homo sapiens Prolow-density lipoprotein receptor-related protein 1 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 1
- 101000650817 Homo sapiens Semaphorin-4D Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000652229 Homo sapiens Suppressor of cytokine signaling 7 Proteins 0.000 description 1
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 description 1
- 101000934376 Homo sapiens T-cell differentiation antigen CD6 Proteins 0.000 description 1
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000800116 Homo sapiens Thy-1 membrane glycoprotein Proteins 0.000 description 1
- 101000835093 Homo sapiens Transferrin receptor protein 1 Proteins 0.000 description 1
- 101000801228 Homo sapiens Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 1
- 101000760337 Homo sapiens Urokinase plasminogen activator surface receptor Proteins 0.000 description 1
- 101000622304 Homo sapiens Vascular cell adhesion protein 1 Proteins 0.000 description 1
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 1
- 102000008100 Human Serum Albumin Human genes 0.000 description 1
- 108091006905 Human Serum Albumin Proteins 0.000 description 1
- 241000598436 Human T-cell lymphotropic virus Species 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 108010073816 IgE Receptors Proteins 0.000 description 1
- 102000009438 IgE Receptors Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 1
- 102100022516 Immunoglobulin superfamily member 2 Human genes 0.000 description 1
- 102000016844 Immunoglobulin-like domains Human genes 0.000 description 1
- 108050006430 Immunoglobulin-like domains Proteins 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 102100023915 Insulin Human genes 0.000 description 1
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 1
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 1
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 1
- 102100025323 Integrin alpha-1 Human genes 0.000 description 1
- 102100025305 Integrin alpha-2 Human genes 0.000 description 1
- 102100032819 Integrin alpha-3 Human genes 0.000 description 1
- 102100032818 Integrin alpha-4 Human genes 0.000 description 1
- 102100032817 Integrin alpha-5 Human genes 0.000 description 1
- 102100032816 Integrin alpha-6 Human genes 0.000 description 1
- 102100022341 Integrin alpha-E Human genes 0.000 description 1
- 101710149643 Integrin alpha-IIb Proteins 0.000 description 1
- 102100022339 Integrin alpha-L Human genes 0.000 description 1
- 102100022337 Integrin alpha-V Human genes 0.000 description 1
- 108010041012 Integrin alpha4 Proteins 0.000 description 1
- 108010008212 Integrin alpha4beta1 Proteins 0.000 description 1
- 102100025304 Integrin beta-1 Human genes 0.000 description 1
- 102100032999 Integrin beta-3 Human genes 0.000 description 1
- 102100033000 Integrin beta-4 Human genes 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 102100037872 Intercellular adhesion molecule 2 Human genes 0.000 description 1
- 102100037871 Intercellular adhesion molecule 3 Human genes 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 102100037850 Interferon gamma Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 102100026017 Interleukin-1 receptor type 2 Human genes 0.000 description 1
- 108010038453 Interleukin-2 Receptors Proteins 0.000 description 1
- 102000010789 Interleukin-2 Receptors Human genes 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010038501 Interleukin-6 Receptors Proteins 0.000 description 1
- 102000010781 Interleukin-6 Receptors Human genes 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000004195 Isomerases Human genes 0.000 description 1
- 108090000769 Isomerases Proteins 0.000 description 1
- 229930194542 Keto Natural products 0.000 description 1
- 208000008839 Kidney Neoplasms Diseases 0.000 description 1
- 102100020880 Kit ligand Human genes 0.000 description 1
- 101710177504 Kit ligand Proteins 0.000 description 1
- LEVWYRKDKASIDU-IMJSIDKUSA-N L-cystine Chemical compound [O-]C(=O)[C@@H]([NH3+])CSSC[C@H]([NH3+])C([O-])=O LEVWYRKDKASIDU-IMJSIDKUSA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical compound C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Natural products CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 108010007622 LDL Lipoproteins Proteins 0.000 description 1
- 108010001831 LDL receptors Proteins 0.000 description 1
- 108010063045 Lactoferrin Proteins 0.000 description 1
- 102000010445 Lactoferrin Human genes 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 241000270322 Lepidosauria Species 0.000 description 1
- 102000004058 Leukemia inhibitory factor Human genes 0.000 description 1
- 108090000581 Leukemia inhibitory factor Proteins 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100025574 Leukocyte immunoglobulin-like receptor subfamily A member 5 Human genes 0.000 description 1
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 1
- 102100024221 Leukocyte surface antigen CD53 Human genes 0.000 description 1
- 102100039564 Leukosialin Human genes 0.000 description 1
- 108010054320 Lignin peroxidase Proteins 0.000 description 1
- 101710155614 Ligninase A Proteins 0.000 description 1
- 101710155621 Ligninase B Proteins 0.000 description 1
- 241000209510 Liliopsida Species 0.000 description 1
- 102000004882 Lipase Human genes 0.000 description 1
- 108090001060 Lipase Proteins 0.000 description 1
- 239000004367 Lipase Substances 0.000 description 1
- 102000004895 Lipoproteins Human genes 0.000 description 1
- 108090001030 Lipoproteins Proteins 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 1
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 241000219745 Lupinus Species 0.000 description 1
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 1
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- 101001133631 Lysinibacillus sphaericus Penicillin acylase Proteins 0.000 description 1
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 1
- 102100038225 Lysosome-associated membrane glycoprotein 2 Human genes 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 239000000637 Melanocyte-Stimulating Hormone Substances 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 102100039373 Membrane cofactor protein Human genes 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 241000203407 Methanocaldococcus jannaschii Species 0.000 description 1
- 241001302042 Methanothermobacter thermautotrophicus Species 0.000 description 1
- 241000243190 Microsporidia Species 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 102000008109 Mixed Function Oxygenases Human genes 0.000 description 1
- 108010074633 Mixed Function Oxygenases Proteins 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 231100000678 Mycotoxin Toxicity 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 1
- 108091006036 N-glycosylated proteins Proteins 0.000 description 1
- CHJJGSNFBQVOTG-UHFFFAOYSA-N N-methyl-guanidine Natural products CNC(N)=N CHJJGSNFBQVOTG-UHFFFAOYSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 238000005481 NMR spectroscopy Methods 0.000 description 1
- 238000011789 NOD SCID mouse Methods 0.000 description 1
- 102100021462 Natural killer cells antigen CD94 Human genes 0.000 description 1
- 108090000028 Neprilysin Proteins 0.000 description 1
- 102000003729 Neprilysin Human genes 0.000 description 1
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 1
- 102000005348 Neuraminidase Human genes 0.000 description 1
- 108010006232 Neuraminidase Proteins 0.000 description 1
- 201000004404 Neurofibroma Diseases 0.000 description 1
- 101710138657 Neurotoxin Proteins 0.000 description 1
- 108010015406 Neurturin Proteins 0.000 description 1
- 102000001839 Neurturin Human genes 0.000 description 1
- 108010033272 Nitrilase Proteins 0.000 description 1
- 108010024026 Nitrile hydratase Proteins 0.000 description 1
- 101710163270 Nuclease Proteins 0.000 description 1
- 102000004140 Oncostatin M Human genes 0.000 description 1
- 108090000630 Oncostatin M Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 241000713112 Orthobunyavirus Species 0.000 description 1
- 241000702244 Orthoreovirus Species 0.000 description 1
- 108090000417 Oxygenases Proteins 0.000 description 1
- 102000004020 Oxygenases Human genes 0.000 description 1
- 102100023472 P-selectin Human genes 0.000 description 1
- 102100034925 P-selectin glycoprotein ligand 1 Human genes 0.000 description 1
- 108090000445 Parathyroid hormone Proteins 0.000 description 1
- 102000003982 Parathyroid hormone Human genes 0.000 description 1
- 108010073038 Penicillin Amidase Proteins 0.000 description 1
- 101710123388 Penicillin G acylase Proteins 0.000 description 1
- 108010077519 Peptide Elongation Factor 2 Proteins 0.000 description 1
- 241000577979 Peromyscus spicilegus Species 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 241000709664 Picornaviridae Species 0.000 description 1
- 108010064851 Plant Proteins Proteins 0.000 description 1
- 102000015795 Platelet Membrane Glycoproteins Human genes 0.000 description 1
- 108010010336 Platelet Membrane Glycoproteins Proteins 0.000 description 1
- 102100036154 Platelet basic protein Human genes 0.000 description 1
- 102100024616 Platelet endothelial cell adhesion molecule Human genes 0.000 description 1
- 102100036851 Platelet glycoprotein IX Human genes 0.000 description 1
- 102100034173 Platelet glycoprotein Ib alpha chain Human genes 0.000 description 1
- 102100034168 Platelet glycoprotein Ib beta chain Human genes 0.000 description 1
- 102100038411 Platelet glycoprotein V Human genes 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 102100029740 Poliovirus receptor Human genes 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 102100022024 Pregnancy-specific beta-1-glycoprotein 1 Human genes 0.000 description 1
- 108091000054 Prion Proteins 0.000 description 1
- 102000029797 Prion Human genes 0.000 description 1
- 241001415846 Procellariidae Species 0.000 description 1
- 102100021923 Prolow-density lipoprotein receptor-related protein 1 Human genes 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 1
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- 241000589776 Pseudomonas putida Species 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- 241000205156 Pyrococcus furiosus Species 0.000 description 1
- 241000522615 Pyrococcus horikoshii Species 0.000 description 1
- 108010025832 RANK Ligand Proteins 0.000 description 1
- 102000014128 RANK Ligand Human genes 0.000 description 1
- 239000012980 RPMI-1640 medium Substances 0.000 description 1
- 102000004879 Racemases and epimerases Human genes 0.000 description 1
- 108090001066 Racemases and epimerases Proteins 0.000 description 1
- 244000088415 Raphanus sativus Species 0.000 description 1
- 235000006140 Raphanus sativus var sativus Nutrition 0.000 description 1
- 101001039269 Rattus norvegicus Glycine N-methyltransferase Proteins 0.000 description 1
- 101710100968 Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101710100963 Receptor tyrosine-protein kinase erbB-4 Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 102100039808 Receptor-type tyrosine-protein phosphatase eta Human genes 0.000 description 1
- 102000003743 Relaxin Human genes 0.000 description 1
- 108090000103 Relaxin Proteins 0.000 description 1
- 208000006265 Renal cell carcinoma Diseases 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 108010093560 Rezafungin Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 108090000829 Ribosome Inactivating Proteins Proteins 0.000 description 1
- 108010003581 Ribulose-bisphosphate carboxylase Proteins 0.000 description 1
- 102100029216 SLAM family member 5 Human genes 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 102100027744 Semaphorin-4D Human genes 0.000 description 1
- 241000607720 Serratia Species 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 108010056088 Somatostatin Proteins 0.000 description 1
- 102000005157 Somatostatin Human genes 0.000 description 1
- 206010041925 Staphylococcal infections Diseases 0.000 description 1
- 101000882403 Staphylococcus aureus Enterotoxin type C-2 Proteins 0.000 description 1
- 101001057112 Staphylococcus aureus Enterotoxin type D Proteins 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 108010023197 Streptokinase Proteins 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 108010056079 Subtilisins Proteins 0.000 description 1
- 102000005158 Subtilisins Human genes 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 1
- 102000019197 Superoxide Dismutase Human genes 0.000 description 1
- 108010012715 Superoxide dismutase Proteins 0.000 description 1
- 102100030529 Suppressor of cytokine signaling 7 Human genes 0.000 description 1
- 102100027208 T-cell antigen CD7 Human genes 0.000 description 1
- 102100025131 T-cell differentiation antigen CD6 Human genes 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 1
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 108700012920 TNF Proteins 0.000 description 1
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 description 1
- 108090001109 Thermolysin Proteins 0.000 description 1
- 241000589499 Thermus thermophilus Species 0.000 description 1
- 102100033523 Thy-1 membrane glycoprotein Human genes 0.000 description 1
- 108010078233 Thymalfasin Proteins 0.000 description 1
- 102400000800 Thymosin alpha-1 Human genes 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- 206010044248 Toxic shock syndrome Diseases 0.000 description 1
- 231100000650 Toxic shock syndrome Toxicity 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 108090000340 Transaminases Proteins 0.000 description 1
- 102000003929 Transaminases Human genes 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 102000006612 Transducin Human genes 0.000 description 1
- 108010087042 Transducin Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 241000224526 Trichomonas Species 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 101710113414 Tumor necrosis factor ligand superfamily member 8 Proteins 0.000 description 1
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 102100024689 Urokinase plasminogen activator surface receptor Human genes 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 1
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 1
- 102100023543 Vascular cell adhesion protein 1 Human genes 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 108700040099 Xylose isomerases Proteins 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- MNOGBRROKHFONU-CJUKMMNNSA-N ac1l2wzw Chemical compound C1N2C(C(C(C)=C(NCCOP(O)(O)=O)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 MNOGBRROKHFONU-CJUKMMNNSA-N 0.000 description 1
- DHKHKXVYLBGOIT-UHFFFAOYSA-N acetaldehyde Diethyl Acetal Natural products CCOC(C)OCC DHKHKXVYLBGOIT-UHFFFAOYSA-N 0.000 description 1
- 150000001241 acetals Chemical class 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- PPZYBFUYKJPWBY-UHFFFAOYSA-N acetylene azide Chemical group C#C.[N-]=[N+]=[N-] PPZYBFUYKJPWBY-UHFFFAOYSA-N 0.000 description 1
- 150000000475 acetylene derivatives Chemical class 0.000 description 1
- 238000005903 acid hydrolysis reaction Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 125000002252 acyl group Chemical group 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000003314 affinity selection Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 125000003158 alcohol group Chemical group 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229960002478 aldosterone Drugs 0.000 description 1
- 150000001335 aliphatic alkanes Chemical class 0.000 description 1
- 150000001336 alkenes Chemical class 0.000 description 1
- 125000004183 alkoxy alkyl group Chemical group 0.000 description 1
- 125000004171 alkoxy aryl group Chemical group 0.000 description 1
- 125000003282 alkyl amino group Chemical group 0.000 description 1
- 125000002877 alkyl aryl group Chemical group 0.000 description 1
- 125000004644 alkyl sulfinyl group Chemical group 0.000 description 1
- 125000004390 alkyl sulfonyl group Chemical group 0.000 description 1
- 125000004414 alkyl thio group Chemical group 0.000 description 1
- 125000005237 alkyleneamino group Chemical group 0.000 description 1
- 125000005238 alkylenediamino group Chemical group 0.000 description 1
- 125000005530 alkylenedioxy group Chemical group 0.000 description 1
- 125000005529 alkyleneoxy group Chemical group 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- 108010050122 alpha 1-Antitrypsin Proteins 0.000 description 1
- 102000015395 alpha 1-Antitrypsin Human genes 0.000 description 1
- 229940024142 alpha 1-antitrypsin Drugs 0.000 description 1
- 150000001370 alpha-amino acid derivatives Chemical class 0.000 description 1
- 150000001371 alpha-amino acids Chemical class 0.000 description 1
- 108010001818 alpha-sarcin Proteins 0.000 description 1
- 102000005922 amidase Human genes 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000003432 anti-folate effect Effects 0.000 description 1
- 230000002587 anti-hemolytic effect Effects 0.000 description 1
- 230000003602 anti-herpes Effects 0.000 description 1
- 230000036436 anti-hiv Effects 0.000 description 1
- 230000003388 anti-hormonal effect Effects 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 230000003110 anti-inflammatory effect Effects 0.000 description 1
- 230000003409 anti-rejection Effects 0.000 description 1
- 230000000259 anti-tumor effect Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 108010082685 antiarrhythmic peptide Proteins 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 229940049595 antibody-drug conjugate Drugs 0.000 description 1
- 229940127074 antifolate Drugs 0.000 description 1
- 230000009876 antimalignant effect Effects 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 239000002249 anxiolytic agent Substances 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 description 1
- 125000005160 aryl oxy alkyl group Chemical group 0.000 description 1
- 125000005165 aryl thioxy group Chemical group 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 208000010216 atopic IgE responsiveness Diseases 0.000 description 1
- 230000001746 atrial effect Effects 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 244000052616 bacterial pathogen Species 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium atom Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 159000000009 barium salts Chemical class 0.000 description 1
- 238000007630 basic procedure Methods 0.000 description 1
- 210000003651 basophil Anatomy 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 125000002619 bicyclic group Chemical group 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 238000001815 biotherapy Methods 0.000 description 1
- 239000004305 biphenyl Substances 0.000 description 1
- 235000010290 biphenyl Nutrition 0.000 description 1
- 125000000319 biphenyl-4-yl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1C1=C([H])C([H])=C([*])C([H])=C1[H] 0.000 description 1
- 150000001621 bismuth Chemical class 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- GDTBXPJZTBHREO-UHFFFAOYSA-N bromine Substances BrBr GDTBXPJZTBHREO-UHFFFAOYSA-N 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 239000000872 buffer Substances 0.000 description 1
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N butyric aldehyde Natural products CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 1
- BBBFJLBPOGFECG-VJVYQDLKSA-N calcitonin Chemical compound N([C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(=O)N1[C@@H](CCC1)C(N)=O)C(C)C)C(=O)[C@@H]1CSSC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N1 BBBFJLBPOGFECG-VJVYQDLKSA-N 0.000 description 1
- 229960004015 calcitonin Drugs 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 238000005251 capillar electrophoresis Methods 0.000 description 1
- 210000000234 capsid Anatomy 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- VQXINLNPICQTLR-UHFFFAOYSA-N carbonyl diazide Chemical compound [N-]=[N+]=NC(=O)N=[N+]=[N-] VQXINLNPICQTLR-UHFFFAOYSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 239000002327 cardiovascular agent Substances 0.000 description 1
- 229940125692 cardiovascular agent Drugs 0.000 description 1
- NSQLIUXCMFBZME-MPVJKSABSA-N carperitide Chemical compound C([C@H]1C(=O)NCC(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@H](C(NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CSSC[C@@H](C(=O)N1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)=O)[C@@H](C)CC)C1=CC=CC=C1 NSQLIUXCMFBZME-MPVJKSABSA-N 0.000 description 1
- 238000012219 cassette mutagenesis Methods 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000012820 cell cycle checkpoint Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 230000009134 cell regulation Effects 0.000 description 1
- 238000012054 celltiter-glo Methods 0.000 description 1
- 238000009614 chemical analysis method Methods 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 239000000460 chlorine Substances 0.000 description 1
- 229910052801 chlorine Inorganic materials 0.000 description 1
- 210000002987 choroid plexus Anatomy 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000003501 co-culture Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000004074 complement inhibitor Substances 0.000 description 1
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000002131 composite material Substances 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 239000002872 contrast media Substances 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- OMFXVFTZEKFJBZ-HJTSIMOOSA-N corticosterone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@H](CC4)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OMFXVFTZEKFJBZ-HJTSIMOOSA-N 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012866 crystallographic experiment Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 125000004093 cyano group Chemical group *C#N 0.000 description 1
- 125000002993 cycloalkylene group Chemical group 0.000 description 1
- 125000000582 cycloheptyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- KQWGXHWJMSMDJJ-UHFFFAOYSA-N cyclohexyl isocyanate Chemical compound O=C=NC1CCCCC1 KQWGXHWJMSMDJJ-UHFFFAOYSA-N 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000004186 cyclopropylmethyl group Chemical group [H]C([H])(*)C1([H])C([H])([H])C1([H])[H] 0.000 description 1
- OOTFVKOQINZBBF-UHFFFAOYSA-N cystamine Chemical compound CCSSCCN OOTFVKOQINZBBF-UHFFFAOYSA-N 0.000 description 1
- 229940099500 cystamine Drugs 0.000 description 1
- 229960003067 cystine Drugs 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 229960003964 deoxycholic acid Drugs 0.000 description 1
- 239000005549 deoxyribonucleoside Substances 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 238000010511 deprotection reaction Methods 0.000 description 1
- 230000000368 destabilizing effect Effects 0.000 description 1
- 238000001784 detoxification Methods 0.000 description 1
- 229960002086 dextran Drugs 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 239000000032 diagnostic agent Substances 0.000 description 1
- 229940039227 diagnostic agent Drugs 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- UVYVLBIGDKGWPX-KUAJCENISA-N digitonin Chemical compound O([C@@H]1[C@@H]([C@]2(CC[C@@H]3[C@@]4(C)C[C@@H](O)[C@H](O[C@H]5[C@@H]([C@@H](O)[C@@H](O[C@H]6[C@@H]([C@@H](O[C@H]7[C@@H]([C@@H](O)[C@H](O)CO7)O)[C@H](O)[C@@H](CO)O6)O[C@H]6[C@@H]([C@@H](O[C@H]7[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O7)O)[C@@H](O)[C@@H](CO)O6)O)[C@@H](CO)O5)O)C[C@@H]4CC[C@H]3[C@@H]2[C@@H]1O)C)[C@@H]1C)[C@]11CC[C@@H](C)CO1 UVYVLBIGDKGWPX-KUAJCENISA-N 0.000 description 1
- UVYVLBIGDKGWPX-UHFFFAOYSA-N digitonine Natural products CC1C(C2(CCC3C4(C)CC(O)C(OC5C(C(O)C(OC6C(C(OC7C(C(O)C(O)CO7)O)C(O)C(CO)O6)OC6C(C(OC7C(C(O)C(O)C(CO)O7)O)C(O)C(CO)O6)O)C(CO)O5)O)CC4CCC3C2C2O)C)C2OC11CCC(C)CO1 UVYVLBIGDKGWPX-UHFFFAOYSA-N 0.000 description 1
- LTMHDMANZUZIPE-PUGKRICDSA-N digoxin Chemical compound C1[C@H](O)[C@H](O)[C@@H](C)O[C@H]1O[C@@H]1[C@@H](C)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@@H]3C[C@@H]4[C@]([C@@H]5[C@H]([C@]6(CC[C@@H]([C@@]6(C)[C@H](O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)C[C@@H]2O)C)C[C@@H]1O LTMHDMANZUZIPE-PUGKRICDSA-N 0.000 description 1
- 229960005156 digoxin Drugs 0.000 description 1
- LTMHDMANZUZIPE-UHFFFAOYSA-N digoxine Natural products C1C(O)C(O)C(C)OC1OC1C(C)OC(OC2C(OC(OC3CC4C(C5C(C6(CCC(C6(C)C(O)C5)C=5COC(=O)C=5)O)CC4)(C)CC3)CC2O)C)CC1O LTMHDMANZUZIPE-UHFFFAOYSA-N 0.000 description 1
- 125000005594 diketone group Chemical group 0.000 description 1
- SWSQBOPZIKWTGO-UHFFFAOYSA-N dimethylaminoamidine Natural products CN(C)C(N)=N SWSQBOPZIKWTGO-UHFFFAOYSA-N 0.000 description 1
- 230000006806 disease prevention Effects 0.000 description 1
- VHJLVAABSRFDPM-ZXZARUISSA-N dithioerythritol Chemical compound SC[C@H](O)[C@H](O)CS VHJLVAABSRFDPM-ZXZARUISSA-N 0.000 description 1
- 239000002934 diuretic Substances 0.000 description 1
- 231100000294 dose-dependent toxicity Toxicity 0.000 description 1
- 241001492478 dsDNA viruses, no RNA stage Species 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 108010028531 enomycin Proteins 0.000 description 1
- 231100000655 enterotoxin Toxicity 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 229940105423 erythropoietin Drugs 0.000 description 1
- 235000020776 essential amino acid Nutrition 0.000 description 1
- 239000003797 essential amino acid Substances 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- DQJJMWZRDSGUJP-UHFFFAOYSA-N ethenoxyethene;furan-2,5-dione Chemical compound C=COC=C.O=C1OC(=O)C=C1 DQJJMWZRDSGUJP-UHFFFAOYSA-N 0.000 description 1
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 1
- 229960005542 ethidium bromide Drugs 0.000 description 1
- 229940093476 ethylene glycol Drugs 0.000 description 1
- 241001233957 eudicotyledons Species 0.000 description 1
- 102000013165 exonuclease Human genes 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 229960004222 factor ix Drugs 0.000 description 1
- 229940012413 factor vii Drugs 0.000 description 1
- 229960000301 factor viii Drugs 0.000 description 1
- 229940012426 factor x Drugs 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 239000003527 fibrinolytic agent Substances 0.000 description 1
- XRECTZIEBJDKEO-UHFFFAOYSA-N flucytosine Chemical compound NC1=NC(=O)NC=C1F XRECTZIEBJDKEO-UHFFFAOYSA-N 0.000 description 1
- 229960004413 flucytosine Drugs 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 229910052731 fluorine Inorganic materials 0.000 description 1
- 239000011737 fluorine Substances 0.000 description 1
- 125000003709 fluoroalkyl group Chemical group 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 102000006815 folate receptor Human genes 0.000 description 1
- 108020005243 folate receptor Proteins 0.000 description 1
- 239000004052 folic acid antagonist Substances 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 239000000417 fungicide Substances 0.000 description 1
- 229910052733 gallium Inorganic materials 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 229940045109 genistein Drugs 0.000 description 1
- TZBJGXHYKVUXJN-UHFFFAOYSA-N genistein Natural products C1=CC(O)=CC=C1C1=COC2=CC(O)=CC(O)=C2C1=O TZBJGXHYKVUXJN-UHFFFAOYSA-N 0.000 description 1
- 235000006539 genistein Nutrition 0.000 description 1
- ZCOLJUOHXJRHDI-CMWLGVBASA-N genistein 7-O-beta-D-glucoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=C2C(=O)C(C=3C=CC(O)=CC=3)=COC2=C1 ZCOLJUOHXJRHDI-CMWLGVBASA-N 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- YPZRWBKMTBYPTK-BJDJZHNGSA-N glutathione disulfide Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@H](C(=O)NCC(O)=O)CSSC[C@@H](C(=O)NCC(O)=O)NC(=O)CC[C@H](N)C(O)=O YPZRWBKMTBYPTK-BJDJZHNGSA-N 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000003827 glycol group Chemical group 0.000 description 1
- 108700014210 glycosyltransferase activity proteins Proteins 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000002622 gonadotropin Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000000122 growth hormone Substances 0.000 description 1
- 229960004198 guanidine Drugs 0.000 description 1
- 150000004820 halides Chemical class 0.000 description 1
- 125000001188 haloalkyl group Chemical group 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 239000002634 heparin fragment Substances 0.000 description 1
- 208000005252 hepatitis A Diseases 0.000 description 1
- 201000010284 hepatitis E Diseases 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 125000004366 heterocycloalkenyl group Chemical group 0.000 description 1
- 125000006588 heterocycloalkylene group Chemical group 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 239000008241 heterogeneous mixture Substances 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 1
- WQPDUTSPKFMPDP-OUMQNGNKSA-N hirudin Chemical compound C([C@@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC(OS(O)(=O)=O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]1NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H]2CSSC[C@@H](C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N2)=O)CSSC1)C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)CSSC1)C(C)C)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 WQPDUTSPKFMPDP-OUMQNGNKSA-N 0.000 description 1
- 229940006607 hirudin Drugs 0.000 description 1
- 210000003630 histaminocyte Anatomy 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 150000004677 hydrates Chemical class 0.000 description 1
- 230000036571 hydration Effects 0.000 description 1
- 238000006703 hydration reaction Methods 0.000 description 1
- 229940042795 hydrazides for tuberculosis treatment Drugs 0.000 description 1
- 150000002429 hydrazines Chemical class 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 1
- 125000006289 hydroxybenzyl group Chemical group 0.000 description 1
- 230000009610 hypersensitivity Effects 0.000 description 1
- 238000005286 illumination Methods 0.000 description 1
- 239000012216 imaging agent Substances 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 150000002466 imines Chemical class 0.000 description 1
- 238000001597 immobilized metal affinity chromatography Methods 0.000 description 1
- 230000036737 immune function Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000000984 immunochemical effect Effects 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000003116 impacting effect Effects 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 108010093036 interleukin receptors Proteins 0.000 description 1
- 102000002467 interleukin receptors Human genes 0.000 description 1
- 229940100601 interleukin-6 Drugs 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 230000005865 ionizing radiation Effects 0.000 description 1
- 230000002427 irreversible effect Effects 0.000 description 1
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 208000022013 kidney Wilms tumor Diseases 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- CSSYQJWUGATIHM-IKGCZBKSSA-N l-phenylalanyl-l-lysyl-l-cysteinyl-l-arginyl-l-arginyl-l-tryptophyl-l-glutaminyl-l-tryptophyl-l-arginyl-l-methionyl-l-lysyl-l-lysyl-l-leucylglycyl-l-alanyl-l-prolyl-l-seryl-l-isoleucyl-l-threonyl-l-cysteinyl-l-valyl-l-arginyl-l-arginyl-l-alanyl-l-phenylal Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CSSYQJWUGATIHM-IKGCZBKSSA-N 0.000 description 1
- 229940078795 lactoferrin Drugs 0.000 description 1
- 235000021242 lactoferrin Nutrition 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 229910052745 lead Inorganic materials 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 108090000146 leukotriene receptors Proteins 0.000 description 1
- 102000003835 leukotriene receptors Human genes 0.000 description 1
- ZNOVTXRBGFNYRX-ABLWVSNPSA-N levomefolic acid Chemical compound C1NC=2NC(N)=NC(=O)C=2N(C)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 ZNOVTXRBGFNYRX-ABLWVSNPSA-N 0.000 description 1
- 235000007635 levomefolic acid Nutrition 0.000 description 1
- 239000011578 levomefolic acid Substances 0.000 description 1
- 238000012917 library technology Methods 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 235000019421 lipase Nutrition 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 208000020816 lung neoplasm Diseases 0.000 description 1
- 238000002595 magnetic resonance imaging Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 206010027191 meningioma Diseases 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 229960003151 mercaptamine Drugs 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 150000002739 metals Chemical class 0.000 description 1
- TWXDDNPPQUTEOV-FVGYRXGTSA-N methamphetamine hydrochloride Chemical compound Cl.CN[C@@H](C)CC1=CC=CC=C1 TWXDDNPPQUTEOV-FVGYRXGTSA-N 0.000 description 1
- HRDXJKGNWSUIBT-UHFFFAOYSA-N methoxybenzene Chemical group [CH2]OC1=CC=CC=C1 HRDXJKGNWSUIBT-UHFFFAOYSA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LSDPWZHWYPCBBB-UHFFFAOYSA-O methylsulfide anion Chemical compound [SH2+]C LSDPWZHWYPCBBB-UHFFFAOYSA-O 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 230000002906 microbiologic effect Effects 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 230000000116 mitigating effect Effects 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 235000019426 modified starch Nutrition 0.000 description 1
- 125000004572 morpholin-3-yl group Chemical group N1C(COCC1)* 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 102000051367 mu Opioid Receptors Human genes 0.000 description 1
- 201000005962 mycosis fungoides Diseases 0.000 description 1
- 239000002636 mycotoxin Substances 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- OKPYIWASQZGASP-UHFFFAOYSA-N n-(2-hydroxypropyl)-2-methylprop-2-enamide Chemical compound CC(O)CNC(=O)C(C)=C OKPYIWASQZGASP-UHFFFAOYSA-N 0.000 description 1
- QCQYVCMYGCHVMR-AAZUGDAUSA-N n-[(2r,3r,4s,5r)-4,5,6-trihydroxy-1-oxo-3-[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexan-2-yl]acetamide Chemical compound CC(=O)N[C@@H](C=O)[C@H]([C@@H](O)[C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O QCQYVCMYGCHVMR-AAZUGDAUSA-N 0.000 description 1
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003136 n-heptyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 239000002159 nanocrystal Substances 0.000 description 1
- 230000001452 natriuretic effect Effects 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 239000002581 neurotoxin Substances 0.000 description 1
- 231100000618 neurotoxin Toxicity 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 125000004971 nitroalkyl group Chemical class 0.000 description 1
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000007826 nucleic acid assay Methods 0.000 description 1
- 238000001216 nucleic acid method Methods 0.000 description 1
- 238000010534 nucleophilic substitution reaction Methods 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 125000003835 nucleoside group Chemical group 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 150000002894 organic compounds Chemical class 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 150000002905 orthoesters Chemical class 0.000 description 1
- 230000002188 osteogenic effect Effects 0.000 description 1
- 230000001151 other effect Effects 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- YPZRWBKMTBYPTK-UHFFFAOYSA-N oxidized gamma-L-glutamyl-L-cysteinylglycine Natural products OC(=O)C(N)CCC(=O)NC(C(=O)NCC(O)=O)CSSCC(C(=O)NCC(O)=O)NC(=O)CCC(N)C(O)=O YPZRWBKMTBYPTK-UHFFFAOYSA-N 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 238000012856 packing Methods 0.000 description 1
- 230000026792 palmitoylation Effects 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 239000000199 parathyroid hormone Substances 0.000 description 1
- 229960001319 parathyroid hormone Drugs 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 108010087558 pectate lyase Proteins 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 229960003330 pentetic acid Drugs 0.000 description 1
- 108010012038 peptide 78 Proteins 0.000 description 1
- 229940125863 peptide 78 Drugs 0.000 description 1
- 239000000813 peptide hormone Substances 0.000 description 1
- 102000014187 peptide receptors Human genes 0.000 description 1
- 108010011903 peptide receptors Proteins 0.000 description 1
- 125000001151 peptidyl group Chemical group 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 102000013415 peroxidase activity proteins Human genes 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- 208000028591 pheochromocytoma Diseases 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 1
- 150000008104 phosphatidylethanolamines Chemical class 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- DTBNBXWJWCWCIK-UHFFFAOYSA-K phosphonatoenolpyruvate Chemical compound [O-]C(=O)C(=C)OP([O-])([O-])=O DTBNBXWJWCWCIK-UHFFFAOYSA-K 0.000 description 1
- DCWXELXMIBXGTH-QMMMGPOBSA-N phosphonotyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(OP(O)(O)=O)C=C1 DCWXELXMIBXGTH-QMMMGPOBSA-N 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-N phosphoramidic acid Chemical class NP(O)(O)=O PTMHPRAIXMAOOB-UHFFFAOYSA-N 0.000 description 1
- SXADIBFZNXBEGI-UHFFFAOYSA-N phosphoramidous acid Chemical group NP(O)O SXADIBFZNXBEGI-UHFFFAOYSA-N 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 125000000587 piperidin-1-yl group Chemical group [H]C1([H])N(*)C([H])([H])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 125000004483 piperidin-3-yl group Chemical group N1CC(CCC1)* 0.000 description 1
- 230000008635 plant growth Effects 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Substances [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 1
- 150000003057 platinum Chemical class 0.000 description 1
- 102000005162 pleiotrophin Human genes 0.000 description 1
- 210000004043 pneumocyte Anatomy 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 1
- 230000001402 polyadenylating effect Effects 0.000 description 1
- 229920001748 polybutylene Polymers 0.000 description 1
- 229920002704 polyhistidine Polymers 0.000 description 1
- 229920000056 polyoxyethylene ether Polymers 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 238000002600 positron emission tomography Methods 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 239000013615 primer Substances 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 229960003387 progesterone Drugs 0.000 description 1
- 239000000186 progesterone Substances 0.000 description 1
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 1
- 235000019260 propionic acid Nutrition 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 210000001938 protoplast Anatomy 0.000 description 1
- 210000000512 proximal kidney tubule Anatomy 0.000 description 1
- 230000005180 public health Effects 0.000 description 1
- 125000000561 purinyl group Chemical group N1=C(N=C2N=CNC2=C1)* 0.000 description 1
- 125000003373 pyrazinyl group Chemical group 0.000 description 1
- 125000005344 pyridylmethyl group Chemical group [H]C1=C([H])C([H])=C([H])C(=N1)C([H])([H])* 0.000 description 1
- 230000001698 pyrogenic effect Effects 0.000 description 1
- IUVKMZGDUIUOCP-BTNSXGMBSA-N quinbolone Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)CC[C@@]21C)C1=CCCC1 IUVKMZGDUIUOCP-BTNSXGMBSA-N 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- 230000000637 radiosensitizating effect Effects 0.000 description 1
- 230000003439 radiotherapeutic effect Effects 0.000 description 1
- 238000002708 random mutagenesis Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 102000027426 receptor tyrosine kinases Human genes 0.000 description 1
- 108091008598 receptor tyrosine kinases Proteins 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000032537 response to toxin Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 108010066533 ribonuclease S Proteins 0.000 description 1
- 239000002342 ribonucleoside Substances 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 210000004358 rod cell outer segment Anatomy 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 238000005070 sampling Methods 0.000 description 1
- 229940016590 sarkosyl Drugs 0.000 description 1
- 108700004121 sarkosyl Proteins 0.000 description 1
- 229930195734 saturated hydrocarbon Natural products 0.000 description 1
- HOZOZZFCZRXYEK-HNHWXVNLSA-M scopolamine butylbromide Chemical compound [Br-].C1([C@@H](CO)C(=O)OC2C[C@@H]3[N+]([C@H](C2)[C@@H]2[C@H]3O2)(C)CCCC)=CC=CC=C1 HOZOZZFCZRXYEK-HNHWXVNLSA-M 0.000 description 1
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 230000007781 signaling event Effects 0.000 description 1
- 230000003007 single stranded DNA break Effects 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 229940126586 small molecule drug Drugs 0.000 description 1
- NRHMKIHPTBHXPF-TUJRSCDTSA-M sodium cholate Chemical compound [Na+].C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 NRHMKIHPTBHXPF-TUJRSCDTSA-M 0.000 description 1
- FHHPUSMSKHSNKW-SMOYURAASA-M sodium deoxycholate Chemical compound [Na+].C([C@H]1CC2)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC([O-])=O)C)[C@@]2(C)[C@@H](O)C1 FHHPUSMSKHSNKW-SMOYURAASA-M 0.000 description 1
- KSAVQLQVUXSOCR-UHFFFAOYSA-M sodium lauroyl sarcosinate Chemical compound [Na+].CCCCCCCCCCCC(=O)N(C)CC([O-])=O KSAVQLQVUXSOCR-UHFFFAOYSA-M 0.000 description 1
- VGTPCRGMBIAPIM-UHFFFAOYSA-M sodium thiocyanate Chemical compound [Na+].[S-]C#N VGTPCRGMBIAPIM-UHFFFAOYSA-M 0.000 description 1
- 239000012453 solvate Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- NHXLMOGPVYXJNR-ATOGVRKGSA-N somatostatin Chemical compound C([C@H]1C(=O)N[C@H](C(N[C@@H](CO)C(=O)N[C@@H](CSSC[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N1)[C@@H](C)O)NC(=O)CNC(=O)[C@H](C)N)C(O)=O)=O)[C@H](O)C)C1=CC=CC=C1 NHXLMOGPVYXJNR-ATOGVRKGSA-N 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 108010068698 spleen exonuclease Proteins 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 108020003113 steroid hormone receptors Proteins 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 230000003637 steroidlike Effects 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229960005202 streptokinase Drugs 0.000 description 1
- 125000005415 substituted alkoxy group Chemical group 0.000 description 1
- 125000002653 sulfanylmethyl group Chemical group [H]SC([H])([H])[*] 0.000 description 1
- 108060007951 sulfatase Proteins 0.000 description 1
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 1
- 231100000617 superantigen Toxicity 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 231100000057 systemic toxicity Toxicity 0.000 description 1
- 229910052713 technetium Inorganic materials 0.000 description 1
- 229950001790 tendamistat Drugs 0.000 description 1
- 108010037401 tendamistate Proteins 0.000 description 1
- IMCGHZIGRANKHV-AJNGGQMLSA-N tert-butyl (3s,5s)-2-oxo-5-[(2s,4s)-5-oxo-4-propan-2-yloxolan-2-yl]-3-propan-2-ylpyrrolidine-1-carboxylate Chemical compound O1C(=O)[C@H](C(C)C)C[C@H]1[C@H]1N(C(=O)OC(C)(C)C)C(=O)[C@H](C(C)C)C1 IMCGHZIGRANKHV-AJNGGQMLSA-N 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 125000004192 tetrahydrofuran-2-yl group Chemical group [H]C1([H])OC([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- MPLHNVLQVRSVEE-UHFFFAOYSA-N texas red Chemical compound [O-]S(=O)(=O)C1=CC(S(Cl)(=O)=O)=CC=C1C(C1=CC=2CCCN3CCCC(C=23)=C1O1)=C2C1=C(CCC1)C3=[N+]1CCCC3=C2 MPLHNVLQVRSVEE-UHFFFAOYSA-N 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- FJFIOAKCGFEILW-UHFFFAOYSA-N thian-2-imine Chemical class N=C1CCCCS1 FJFIOAKCGFEILW-UHFFFAOYSA-N 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical class N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- NZVYCXVTEHPMHE-ZSUJOUNUSA-N thymalfasin Chemical compound CC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O NZVYCXVTEHPMHE-ZSUJOUNUSA-N 0.000 description 1
- 229960004231 thymalfasin Drugs 0.000 description 1
- 210000001685 thyroid gland Anatomy 0.000 description 1
- 125000005425 toluyl group Chemical group 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- ILJSQTXMGCGYMG-UHFFFAOYSA-N triacetic acid Chemical compound CC(=O)CC(=O)CC(O)=O ILJSQTXMGCGYMG-UHFFFAOYSA-N 0.000 description 1
- 229960001124 trientine Drugs 0.000 description 1
- 239000001226 triphosphate Substances 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 238000013024 troubleshooting Methods 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- 239000012646 vaccine adjuvant Substances 0.000 description 1
- 229940124931 vaccine adjuvant Drugs 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 1
- 239000002821 viper venom Substances 0.000 description 1
- 230000036642 wellbeing Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 125000002256 xylenyl group Chemical group C1(C(C=CC=C1)C)(C)* 0.000 description 1
- 150000003952 β-lactams Chemical class 0.000 description 1
- 108020001612 μ-opioid receptors Proteins 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
- C07K16/1036—Retroviridae, e.g. leukemia viruses
- C07K16/1045—Lentiviridae, e.g. HIV, FIV, SIV
- C07K16/1063—Lentiviridae, e.g. HIV, FIV, SIV env, e.g. gp41, gp110/120, gp160, V3, PND, CD4 binding site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
Definitions
- This invention relates to novel polypeptide small molecule conjugates comprising at least one non-naturally-encoded amino acid.
- the present invention relates generally to the field of the production and selection of antigen-binding and bispecific polypeptides by the methods of molecular biology, using both chemistry and recombinant DNA.
- a naturally produced antibody is a tetrameric structure consisting of two identical immunoglobulin (Ig) heavy chains and two identical light chains.
- the heavy and light chains of an Ab consist of different domains.
- Each light chain has one variable domain (VL) and one constant domain (CL), while each heavy chain has one variable domain (VH) and three or four constant domains (CH).
- Each domain consisting of about 1 10 amino acid residues, is folded into a characteristic ⁇ -sandwich structure formed from two ⁇ -sheets packed against each other, the immunoglobulin fold.
- the VL domains each have three complementarity determining regions (CDRl-3) and the VH domains each have up to four complimentarity determining regions (CDRl-4), that are loops, or turns, connecting ⁇ -strands at one end of the domains.
- CDRl-3 complementarity determining regions
- CDRl-4 complimentarity determining regions
- the variable regions of both the light and heavy chains generally contribute to antigen specificity, although the contribution of the individual chains to specificity is not necessarily equal.
- Antibody molecules have evolved to bind to a large number of molecules by using randomized CDR loops.
- Functional substructures of Abs can be prepared by proteolysis and by recombinant methods. They include the Fab fragment, which comprises the VH-CH1 domains of the heavy chain and the VL-CL1 domains of the light chain joined by a single interchain disulfide bond, and the Fv fragment, which comprises only the VH and VL domains, and the Fc portion which comprises the non-antigen binding region of the molecule.
- Fab fragment which comprises the VH-CH1 domains of the heavy chain and the VL-CL1 domains of the light chain joined by a single interchain disulfide bond
- the Fv fragment which comprises only the VH and VL domains
- the Fc portion which comprises the non-antigen binding region of the molecule.
- a single VH domain retains significant affinity for antigen (Ward et al., 1989, Nature 341 , 554-546). It has also been shown that a certain monomeric ⁇ light chain will specifically bind to its antigen. (L.
- scFv single chain Fv
- scFv single chain Fv
- S-z Hu et al. 1996, Cancer Research, 56, 3055-3061
- These small (Mr 25,000) proteins generally retain specificity and affinity for antigen in a single polypeptide and can provide a convenient building block for larger, antigen-specific molecules.
- the short half-life of scFvs in the circulation limits their therapeutic utility in many cases.
- a small protein scaffold called a "minibody” was designed using a part of the
- Ig VH domain as the template (Pessi et al., 1993, Nature 362, 367-369).
- Minibodies with high affinity (dissociation constant (3 ⁇ 4) about 10 "7 M) to interleukin-6 were identified by randomizing loops corresponding to CDR1 and CDR2 of VH and then selecting mutants using the phage display method (Martin et al., 1994, EMBO J. 13, 5303-5309).
- VH domains three or four CDR loops
- Diabodies are small bivalent and bispecific antibody fragments, having two antigen-binding sites.
- the fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) on the same polypeptide chain (V H -VL).
- V H heavy-chain variable domain
- V L light-chain variable domain
- Diabodies are similar in size to the Fab fragment.
- linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
- CDR peptides are short, typically cyclic, peptides which correspond to the amino acid sequences of CDR loops of antibodies. CDR loops are responsible for antibody-antigen interactions. CDR peptides and organic CDR mimetics have been shown to retain some binding affinity (Smyth & von Itzstein, 1994, J. Am. Chem. Soc. 1 16, 2725-2733). Mouse CDRs have been grafted onto the human Ig framework without the loss of affinity (Jones et al., 1986, Nature 321 , 522-525; Riechmann et al., 1988).
- Receptor tyrosine kinases of the ErbB family play pivotal roles in cell growth and differentiation. Aberrant activation of these receptors is associated with human cancers. Dimerization (the pairing of receptors) is essential to the signaling activity of all ErbB receptors. Blocking the dimerization activity of ErbB 2 has been shown to directly inhibit the ability of ErbB2 to dimerize with other ErbB receptor proteins. Inhibiting receptor dimerization prevents the activation of ErbB signaling pathways. An antagonistic molecule that down regulates ErbB signaling could function as an anti-tumor agent. The ErbB signaling network is currently a major target in the development of anti-tumor drugs.
- ErbB-1 is a specific receptor for EGF, while ErbB-2 has no known natural ligand. ErbB2 is able to form heterodimers with ErbB-1 upon addition of EGF. ErbB2 also functions as the preferred dimerization partner for the kinase-dead ErbB-3 and for ErbB-4, which are both receptors for the neuregulins.
- the ErbB signaling network can also be activated in an indirect manner during signaling by cytokines and ligands of G-coupled protein receptors, indicating that it plays a central role in the growth control of many different cell types.
- the proto-oncogene c-erbB-1 encodes the epidermal growth factor receptor.
- v-erbB which was isolated from an avian erythroblastosis virus (AEV) where it was contained as a fragment of the chicken c-ErbB-1 gene lacking the amino-terminal ligand-binding domain.
- AEV avian erythroblastosis virus
- Over expression of erbB-1 genes occurs in a wide range of tumors, including squamous carcinomas of various sites and adenocarcinomas.
- the human c-erbB-1 gene is located in the chromosomal region 7pl4 and 7pl2.
- the ErbB-2 proto-oncogene (also referred to as Neu, EGFR-2 or HER-2) is a member of the transmembrane receptor tyrosine kinase family, which also includes EGF receptor and EGFR-3 (HER-3 or ErbB-3).
- ErbB-2 encodes a transmembrane receptor-like glycoprotein of 185 kDa with intrinsic tyrosine kinase activity.
- ErbB-2 does not have any known high-affinity ligands, its kinase activity can be activated without ligand by either over expression or hetero-association with other members of the ErbB family of receptors.
- ErbB-2 Amplification of the ErbB-2 gene and over expression of its product has been detected in almost 40% of primary human breast tumors. ErbB-2 over expression is also observed in ovarian, gastric, salivary and non-small cell lung carcinomas. ErbB-2 is activated by the neuregulins in heterodimers with the neuregulin receptors ErbB- 3 and ErbB- 4.
- the humanized anti-ErbB-2 monoclonal antibody Herceptin (from monoclonal 4D5) has received FDA approval for treatment of cancers that over express ErbB-2.
- Another anti- ErbB2 antibody in development is Pertuzumab (from monoclonal 2C4). Specific inhibitors of the tyrosine kinase activity of ErbB-1 (EGF receptor) are also in clinical trials.
- Anti-ErbB2 antibodies are known in the art, and include but are not limited to
- Folate Receptor 1 also known as Folate Receptor-alpha, or Folate Binding Protein, is an N-glycosylated protein expressed on plasma membrane of cells.
- FOLRl has a high affinity for folic acid and for several reduced folic acid derivatives.
- FOLRl mediates delivery of the physiological folate, 5 -methyltetrahydro folate, to the interior of cells.
- FOLRl is overexpressed in vast majority of ovarian cancers, as well as in many uterine, endometrial, pancreatic, renal, lung, and breast cancers, while the expression of FOLRl on normal tissues is restricted to the apical membrane of epithelial cells in the kidney proximal tubules, alveolar pneumocytes of the lung, bladder, testes, choroid plexus, and thyroid (Weitman S D, et al., Cancer Res 52: 3396-3401 (1992); Antony A C, Annu Rev Nutr 16: 501-521 (1996); Kalli K R, et al. Gynecol Oncol 108: 619-626 (2008)).
- This expression pattern of FOLR1 makes it a desirable target for FOLR1 -directed cancer therapy.
- ovarian cancer is typically asymptomatic until advanced stage, it is often diagnosed at a late stage and has poor prognosis when treated with currently available procedures, typically chemotherapeutic drugs after surgical de-bulking (von Gruenigen V et al., Cancer 1 12: 2221 -2227 (2008); Ayhan A et al., Am J Obstet Gynecol 196: 81e81-86 (2007); Harry V N et al., Obstet Gynecol Surv 64: 548-560 (2009)).
- chemotherapeutic drugs after surgical de-bulking
- Covalent attachment of the hydrophilic polymer poly(ethylene glycol), abbreviated PEG is a method of increasing water solubility, bioavailability, increasing serum half-life, increasing therapeutic half-life, modulating immunogenicity, modulating biological activity, or extending the circulation time of many biologically active molecules, including proteins, peptides, and particularly hydrophobic molecules.
- PEG has been used extensively in pharmaceuticals, on artificial implants, and in other applications where biocompatibility, lack of toxicity, and lack of immunogenicity are of importance.
- the total molecular weight and hydration state of the PEG polymer or polymers attached to the biologically active molecule must be sufficiently high to impart the advantageous characteristics typically associated with PEG polymer attachment, such as increased water solubility and circulating half life, while not adversely impacting the bioactivity of the parent molecule.
- PEG derivatives are frequently linked to biologically active molecules through reactive chemical functionalities, such as lysine, cysteine and histidine residues, the N- terminus and carbohydrate moieties.
- Proteins and other molecules often have a limited number of reactive sites available for polymer attachment. Often, the sites most suitable for modification via polymer attachment play a significant role in receptor binding, and are necessary for retention of the biological activity of the molecule.
- indiscriminate attachment of polymer chains to such reactive sites on a biologically active molecule often leads to a significant reduction or even total loss of biological activity of the polymer- modified molecule.
- Reactive sites that form the loci for attachment of PEG derivatives to proteins are dictated by the protein's structure.
- Proteins, including enzymes are composed of various sequences of alpha-amino acids, which have the general structure H 2 N— CHR--COOH.
- the alpha amino moiety (H 2 N ⁇ ) of one amino acid joins to the carboxyl moiety (— COOH) of an adjacent amino acid to form amide linkages, which can be represented as— (NH— CHR ⁇ CO) n --, where the subscript "n" can equal hundreds or thousands.
- the fragment represented by R can contain reactive sites for protein biological activity and for attachment of PEG derivatives.
- PEGylation is that the PEG derivatives can undergo undesired side reactions with residues other than those desired.
- Histidine contains a reactive imino moiety, represented structurally as ⁇ N(H)— , but many chemically reactive species that react with epsilon— NH 2 can also react with— N(H)— .
- the side chain of the amino acid cysteine bears a free sulfhydryl group, represented structurally as -SH.
- the PEG derivatives directed at the epsilon— NH 2 group of lysine also react with cysteine, histidine or other residues.
- a cysteine residue can be introduced site-selectively into the structure of proteins using site-directed mutagenesis and other techniques known in the art, and the resulting free sulfhydryl moiety can be reacted with PEG derivatives that bear thiol-reactive functional groups.
- This approach is complicated, however, in that the introduction of a free sulfhydryl group can complicate the expression, folding and stability of the resulting protein.
- PEG derivatives have been developed that are more stable (e.g., U.S. Patent 6,602,498, which is incorporated by reference herein) or that react selectively with thiol moieties on molecules and surfaces (e.g., U.S. Patent 6,610,281, which is incorporated by reference herein).
- U.S. Patent 6,602,498, which is incorporated by reference herein or that react selectively with thiol moieties on molecules and surfaces
- thiol moieties e.g., U.S. Patent 6,610,281, which is incorporated by reference herein.
- an azide moiety into a protein structure, for example, one is able to incorporate a functional group that is chemically inert to amines, sulfhydryls, carboxylic acids, hydroxyl groups found in proteins, but that also reacts smoothly and efficiently with an acetylene moiety to form a cycloaddition product.
- the azide in the absence of the acetylene moiety, the azide remains chemically inert and unreactive in the presence of other protein side chains and under physiological conditions.
- the present invention addresses, among other things, problems associated with the activity and production of antigen-binding polypeptides and fragments thereof, and in particular polypeptide small molecule conjugates, and also addresses the production of antigen-binding polypeptides and polypeptide small molecule conjugates with improved biological or pharmacological properties, such as improved therapeutic half-life.
- PSMC polypeptide small molecule conjugates
- the PSMC comprises a complete antibody heavy chain.
- the PSMC comprises a complete antibody light chain.
- the PSMC comprises a variable region of an antibody light chain.
- the PSMC comprises a variable region of an antibody heavy chain.
- the PSMC comprises at least one CDR of an antibody light chain.
- the PSMC comprises at least one CDR of a PSMCantibody heavy chain.
- the PSMC comprises at least one CDR of a light chain and at least one CDR of a heavy chain.
- the PSMC comprises a Fab.
- the PSMC comprises two or more Fab's. In some embodiments, the PSMC comprises a scFv. In some embodiments, the PSMC comprises two or more scFv. In some embodiments, the PSMC comprises a minibody. In some embodiments, the PSMC comprises two or more minibodies. In some embodiments, the PSMC comprises a diabody. In some embodiments, the PSMC comprises two or more diabodies. In some embodiments, the PSMC comprises a variable region of a light chain and a variable region of a heavy chain. In some embodiments, the PSMC comprises a complete light chain and a complete heavy chain. In some embodiments, the PSMC comprises one or more Fc domain or portion thereof.
- the PSMC comprises a combination of any of the above embodiments. In some embodiments, the PSMC comprises a homodimer, heterodimer, homomultimer or heteromultimer of any of the above embodiments. In some embodiments, the PSMC comprises a polypeptide that binds to a binding partner wherein the binding partner comprises an antigen, a polypeptide, a nucleic acid molecule, a polymer, or other molecule or substance. In some embodiments, the PSMC is associated with a non-antibody scaffold molecule or substance. [0029] In some embodiments, the PSMC comprises one or more post-translational modifications. In some embodiments, the PSMC is linked to a linker, polymer, or biologically active molecule.
- the PSMC is linked to a bifunctional polymer, bifunctional linker, or at least one additional PSMC. In some embodiments, the PSMC is linked to a polypeptide that is not a PSMC. In some embodiments, an antigen- binding polypeptide comprising a non-naturally encoded amino acid is linked to one or more additional antigen-binding polypeptides which may also comprise a non-naturally encoded amino acid. In some embodiments, an antigen-binding polypeptide comprising a non- naturally encoded amino acid is linked to one or more polypeptide small molecule conjugates which may also comprise a non-naturally encoded amino acid. In some embodiments, a PSMC comprising a non-naturally encoded amino acid is linked to one or more additional antigen-binding polypeptides which may also comprise a non-naturally encoded amino acid.
- the non-naturally encoded amino acid is linked to a water soluble polymer.
- the water soluble polymer comprises a poly(ethylene glycol) moiety.
- the poly(ethylene glycol) molecule is a bifunctional polymer.
- the bifunctional polymer is linked to a second polypeptide.
- the second polypeptide is an antigen-binding polypeptide.
- the second polypeptide is a PSMC.
- the antigen-binding polypeptide comprises at least two amino acids linked to a water soluble polymer comprising a poly(ethylene glycol) moiety.
- at least one amino acid is a non-naturally encoded amino acid.
- the antigen-binding polypeptide comprises a substitution, addition or deletion that modulates affinity of the antigen-binding polypeptide for an antigen when compared with the affinity of the corresponding antigen-binding polypeptide without the substitution, addition or deletion.
- the antigen- binding polypeptide comprises a substitution, addition, or deletion that increases the stability of the antigen-binding polypeptide when compared with the stability of the corresponding antigen-binding polypeptide without the substitution, addition or deletion.
- the antigen-binding polypeptide comprises a substitution, addition, or deletion that modulates the immunogenicity of the antigen-binding polypeptide when compared with the immunogenicity of the corresponding antigen-binding polypeptide without the substitution, addition or deletion.
- the antigen-binding polypeptide comprises a substitution, addition, or deletion that modulates serum half-life or circulation time of the antigen-binding polypeptide when compared with the serum half-life or circulation time of the corresponding antigen-binding polypeptide without the substitution, addition or deletion.
- the antigen-binding polypeptide comprises substitution, addition, or deletion that increases the aqueous solubility of the corresponding antigen-binding polypeptide when compared to the aqueous solubility of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion.
- the antigen-binding polypeptide comprises a substitution, addition, or deletion that increases the solubility of the antigen-binding polypeptide produced in a host cell when compared to the solubility of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion.
- the antigen-binding polypeptide comprises a substitution, addition, or deletion that increases the expression of the antigen- binding polypeptide in a host cell or synthesized in vitro when compared to the expression of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion.
- the antigen-binding polypeptide comprises a substitution, addition, or deletion that increases protease resistance of the antigen-binding polypeptide when compared to protease resistance of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion.
- amino acid substitutions in the PSMC may be with naturally occurring or non-naturally occurring amino acids, provided that at least one substitution is with a non-naturally encoded amino acid.
- the non-naturally encoded amino acid comprises a carbonyl group, an acetyl group, an aminooxy group, a hydrazine group, a hydrazide group, a semicarbazide group, an azide group, or an alkyne group.
- the non-naturally encoded amino acid comprises a carbonyl group. In some embodiments, the non-naturally encoded amino acid has the structure:
- the non-naturally encoded amino acid comprises an aminooxy group.
- the non-naturally encoded amino acid comprises a hydrazide group.
- the non-naturally encoded amino acid comprises a hydrazine group.
- the non-naturally encoded amino acid residue comprises a semicarbazide group.
- the non-naturally encoded amino acid residue comprises an azide group.
- the non-naturally encoded amino acid has the structure:
- n is 0-10;
- R ⁇ is an alkyl, aryl, substituted alkyl, substituted aryl or not present;
- X is O, N, S or not present;
- m is 0-10;
- R 2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and
- R 3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
- the non-naturally encoded amino acid comprises an alkyne group. In some embodiments, the non-naturally encoded amino acid has the structure:
- the polypeptide is an agonist, partial agonist, antagonist, partial antagonist, or inverse agonist of at least one activity of the antigen.
- the agonist, partial agonist, antagonist, partial antagonist, or inverse agonist comprises a non-naturally encoded amino acid linked to a water soluble polymer.
- the water soluble polymer comprises a poly(ethylene glycol) moiety.
- the agonist, partial agonist, antagonist, partial antagonist, or inverse agonist comprises a non-naturally encoded amino acid and one or more post-translational modification, linker, polymer, or biologically active molecule.
- the present invention also provides isolated nucleic acids comprising a polynucleotide that encodes an antigen-binding polypeptide wherein the polynucleotide comprises at least one selector codon including, but not limited to, SEQ ID NO: 19, 21 , or a fragment thereof.
- the present invention also provides isolated nucleic acids comprising a polynucleotide that encodes an antigen-binding polypeptide wherein the polynucleotide comprises at least one selector codon including, but not limited to, SEQ ID NO: 19, SEQ ID NO: 21.
- the selector codon is selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, and a four-base codon.
- modified antibodies can comprise any type of variable region that provides for the association of the antibody with the polypeptides of a human FOLR1.
- the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen.
- the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g. cynomolgus monkeys, macaques, etc.) or lupine origin. In some embodiments both the variable and constant regions of the modified immunoglobulins are human.
- variable regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
- variable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
- variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing.
- the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and in certain embodiments from an antibody from a different species. It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the antigen binding site. Given the explanations set forth in U.S. Pat.
- modified antibodies of this invention will comprise antibodies (e.g., full- length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
- the constant region of the modified antibodies will comprise a human constant region.
- Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains. That is, the modified antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL).
- modified constant regions wherein one or more domains are partially or entirely deleted are contemplated.
- the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs).
- the omitted constant region domain will be replaced by a short amino acid spacer (e.g. 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
- the constant region mediates several effector functions.
- binding of the CI component of complement to antibodies activates the complement system.
- Activation of complement is important in the opsonisation and lysis of cell pathogens.
- the activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity.
- antibodies bind to cells via the Fc region, with a Fc receptor site on the antibody Fc region binding to a Fc receptor (FcR) on a cell.
- Fc receptors There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (eta receptors), IgA (alpha receptors) and IgM (mu receptors).
- the present invention also provides methods of making an antigen-binding polypeptide linked to a water soluble polymer.
- the method comprises contacting an isolated antigen-binding polypeptide comprising a non-naturally encoded amino acid with a water soluble polymer comprising a moiety that reacts with the non- naturally encoded amino acid.
- the non-naturally encoded amino acid incorporated into the antigen-binding polypeptide is reactive toward a water soluble polymer that is otherwise unreactive toward any of the 20 common amino acids. In some embodiments, the non-naturally encoded amino acid incorporated into the antigen-binding polypeptide is reactive toward a linker, polymer, or biologically active molecule that is otherwise unreactive toward any of the 20 common amino acids.
- the antigen-binding polypeptide linked to the water soluble polymer is made by reacting an antigen-binding polypeptide comprising a carbonyl- containing amino acid with a poly(ethylene glycol) molecule comprising an aminooxy, hydrazine, hydrazide or semicarbazide group.
- the aminooxy, hydrazine, hydrazide or semicarbazide group is linked to the poly(ethylene glycol) molecule through an amide linkage.
- the antigen-binding polypeptide linked to the water soluble polymer is made by reacting a poly(ethylene glycol) molecule comprising a carbonyl group with a polypeptide comprising a non-naturally encoded amino acid that comprises an aminooxy, hydrazine, hydrazide or semicarbazide group.
- the antigen-binding polypeptide linked to the water soluble polymer is made by reacting an antigen-binding polypeptide comprising an alkyne- containing amino acid with a poly(ethylene glycol) molecule comprising an azide moiety.
- the azide or alkyne group is linked to the poly(ethylene glycol) molecule through an amide linkage.
- the antigen-binding polypeptide linked to the water soluble polymer is made by reacting an antigen-binding polypeptide comprising an azide- containing amino acid with a poly(ethylene glycol) molecule comprising an alkyne moiety.
- the azide or alkyne group is linked to the poly(ethylene glycol) molecule through an amide linkage.
- the poly(ethylene glycol) molecule has a molecular weight of between about 0.1 kDa and about 100 kDa. In some embodiments, the poly(ethylene glycol) molecule has a molecular weight of between 0.1 kDa and 50 kDa. [0052] In some embodiments, the poly(ethylene glycol) molecule is a branched polymer. In some embodiments, each branch of the poly(ethylene glycol) branched polymer has a molecular weight of between 1 kDa and 100 kDa, or between 1 kDa and 50 kDa.
- the water soluble polymer linked to the antigen-binding polypeptide comprises a polyalkylene glycol moiety.
- the non- naturally encoded amino acid residue incorporated into the antigen-binding polypeptide comprises a carbonyl group, an aminooxy group, a hydrazide group, a hydrazine, a semicarbazide group, an azide group, or an alkyne group.
- the non- naturally encoded amino acid residue incorporated into the PSMC comprises a carbonyl moiety and the water soluble polymer comprises an aminooxy, hydrazide, hydrazine, or semicarbazide moiety.
- the non-naturally encoded amino acid residue incorporated into the antigen-binding polypeptide comprises an alkyne moiety and the water soluble polymer comprises an azide moiety. In some embodiments, the non-naturally encoded amino acid residue incorporated into the antigen-binding polypeptide comprises an azide moiety and the water soluble polymer comprises an alkyne moiety.
- compositions comprising an antigen- binding polypeptide comprising a non-naturally-encoded amino acid and a pharmaceutically acceptable carrier.
- the non-naturally encoded amino acid is linked to a water soluble polymer.
- the present invention also provides cells comprising a polynucleotide encoding the antigen-binding polypeptide comprising a selector codon.
- the cells comprise an orthogonal RNA synthetase and/or an orthogonal tRNA for substituting a non-naturally encoded amino acid into the antigen-binding polypeptide.
- the present invention also provides methods of making an antigen-binding polypeptide comprising a non-naturally encoded amino acid.
- the methods comprise culturing cells comprising a polynucleotide or polynucleotides encoding an antigen-binding polypeptide, an orthogonal RNA synthetase and/or an orthogonal tRNA under conditions to permit expression of the antigen-binding polypeptide; and purifying the antigen-binding polypeptide from the cells and/or culture medium.
- the present invention also provides methods of increasing therapeutic half- life, serum half-life or circulation time of the antigen-binding polypeptides.
- the present invention also provides methods of modulating immunogenicity of the antigen-binding polypeptides.
- the methods comprise substituting a non-naturally encoded amino acid for any one or more amino acids in naturally occurring antigen-binding polypeptides and/or linking the antigen-binding polypeptide to a linker, a polymer, a water soluble polymer, or a biologically active molecule.
- the present invention also provides methods of treating a patient in need of such treatment with an effective amount of an antigen-binding polypeptide of the present invention.
- the methods comprise administering to the patient a therapeutically-effective amount of a pharmaceutical composition comprising an antigen- binding polypeptide comprising a non-naturally-encoded amino acid and a pharmaceutically acceptable carrier.
- the non-naturally encoded amino acid is linked to a water soluble polymer.
- the present invention also provides antigen-binding polypeptides comprising a sequence shown in SEQ ID NO: 18, 20, fragments thereof, or polynucleotides, in whole or in part, in SEQ ID NO: 19, 21 , and fragments thereof, or any other antigen-binding polypeptide sequence, except that at least one amino acid is substituted by a non-naturally encoded amino acid.
- the non-naturally encoded amino acid is linked to a water soluble polymer.
- the water soluble polymer comprises a poly(ethylene glycol) moiety.
- the non-naturally encoded amino acid comprises a carbonyl group, an aminooxy group, a hydrazide group, a hydrazine group, a semicarbazide group, an azide group, or an alkyne group.
- the present invention also provides pharmaceutical compositions comprising a pharmaceutically acceptable carrier and an antigen-binding polypeptide comprising the sequence shown in SEQ ID NO: 18, 20.
- the present invention also provides pharmaceutical compositions comprising a polypeptide encoded by the polynucleotides and a pharmaceutically acceptable carrier wherein the antigen-binding polypeptide is encoded by the sequence shown in SEQ ID NO: 19, 21.
- the present invention also provides for an antigen-binding polypeptide comprising the sequence of SP34 with a non-naturally encoded amino acid.
- the present invention also provides for an antigen-binding polypeptide comprising the sequence of Mabtech CD3-1 with a non-naturally encoded amino acid.
- the present invention also provides for an antigen-binding polypeptide comprising the sequence of SP34 with more than one non-naturally encoded amino acid.
- the present invention also provides for an antigen-binding polypeptide comprising the sequence of Mabtech CD3-1 with more than one non-naturally encoded amino acid.
- the present invention also provides pharmaceutical compositions comprising a pharmaceutically acceptable carrier and an antigen-binding polypeptide comprising the sequence shown in SEQ ID NO: 18, 20, fragments thereof, or polynucleotides, in whole or in part, in SEQ ID NO: 19, 21 , and fragments thereof, or any other antigen-binding polypeptide sequence, wherein at least one amino acid is substituted by a non-naturally encoded amino acid.
- the non-naturally encoded amino acid comprises a saccharide moiety.
- the water soluble polymer is linked to the polypeptide via a saccharide moiety.
- a linker, polymer, or biologically active molecule is linked to the antigen- binding polypeptide via a saccharide moiety.
- the present invention also provides an antigen-binding polypeptide comprising a water soluble polymer linked by a covalent bond to the antigen-binding polypeptide at a single amino acid.
- the water soluble polymer comprises a poly(ethylene glycol) moiety.
- the amino acid covalently linked to the water soluble polymer is a non-naturally encoded amino acid present in the polypeptide.
- the present invention provides an antigen-binding polypeptide comprising at least one linker, polymer, or biologically active molecule, wherein said linker, polymer, or biologically active molecule is attached to the polypeptide through a functional group of a non-naturally encoded amino acid ribosomally incorporated into the polypeptide.
- the polypeptide is monoPEGylated.
- the present invention also provides a PSMC polypeptide comprising a linker, polymer, or biologically active molecule that is attached to one or more non-naturally encoded amino acid wherein said non-naturally encoded amino acid is ribosomally incorporated into the polypeptide at pre-selected sites.
- conjugation of the antigen-binding polypeptide comprising one or more non-naturally occurring amino acids to another molecule provides substantially purified antigen-binding polypeptide due to the unique chemical reaction utilized for conjugation to the non-natural amino acid.
- Conjugation of the antigen-binding polypeptide comprising one or more non-naturally encoded amino acids to another molecule, such as PEG may be performed with other purification techniques performed prior to or following the conjugation step to provide substantially pure antigen- binding polypeptide.
- FIG. 1 A diagram of the general structure of an antibody molecule (IgG) and its antigen-binding portions is shown. The CDR's are contained within the antigen recognition site.
- IgG antibody molecule
- Figure 2 - Constructs used for periplasmic ( Figure 2, Panel A) and cytoplasmic ( Figure 2, Panel B) expression/suppression of scFv-108 are shown. Locations of the amber stop codons are indicated. Bicistronic cassette used for expression/suppression of the Fab- 108 fragment ( Figure 2, Panel C) is shown. Constructs used for periplasmic expression suppression of scFv-4D5 fragments are shown ( Figure 2, Panel D and Panel E). A cistron for expression/suppression of Fab-4D5 fragment is shown ( Figure 2, Panel F).
- Figure 3 - Suppression (Figure 3, Panel A) of amber mutations in the second serine of the GlySer linker (S 131Am) and analysis of IMAC purification of the corresponding pAcF-containing scFv ( Figure.3, Panel B) are shown.
- FIG. 4 Figure 4 - Suppression of an amber mutation in the VL chain (LI 56) during cytoplasmic expression of a scFv is shown.
- Figure 5 - PEGylation and dimerization of pAcF-scFv-108 fragments is shown in Figure 5, Panel A. Position , of the mono-PEGylated scFv and the dimer are indicated by the single and double arrowheads respectively.
- Panel B shows PEGylation of pAcF-scFv-108 fragment-(S136).
- Panel C shows that no PEGylation of WT scFv fragments was observed.
- FIG. 6 A gel showing fractions taken during purification of scFv-108 homodimers is shown.
- FIG. 7 Binding of pAcF or pAcF-PEG-containing scFv proteins to A431 cells expressing EGF receptors are shown in Figure 7, Panels A-C.
- Figure 8 - A gel showing pAcF and pAcF-PEG-containing Fab fragments of mAb 108 is shown as Figure 8, Panel A. Binding of Fab fragments of mAb 108 to A431 cells expressing EGF receptors are shown in Figure 8, Panels B-D.
- FIG. 9 An example of a hetero-bifunctional PSMC of the present invention is shown.
- Figure 10 Gels showing the suppression of an amber mutation in the second serine of the GlySer linker of the C-terminal ( Figure 10, Panel A) or N-terminal scFv-4D5 ( Figure 10, Panel B) fragments are shown.
- Figure 1 1 - SDS-PAGE analysis is shown of pAcF-Fab-4D5-(K139) and Fab-
- Figure 1 1 Panel A
- Figure 1 1 Panel B shows a Western blot of the samples shown in Figure 1 1 , Panel A with an anti-His antibody.
- FIG. 12 Figure 12 - HIV-l neutralizing human Fab 4E10 linked to peptide T20 is shown.
- FIG. 13 - A diagram of a dimerization procedure is shown.
- Figure 16 - Shows the T cell engagement of target cells and dose-dependent toxicity by anti-CD3 Fab-folate.
- Figure 16 (A) is a graph of the dose-dependent T cell- mediated cytotoxicity with KB (FR+), OV-90 (FR+) and CAKI-1 (FR-) cells treated with anti-CD3 Fab-folate in the presence of activated human PBMCs (ratio 1 : 10 of target: effector cells).
- Increasing concentrations of anti-CD3 Fab-folate or unconjugated anti-CD3 Fab were incubated with target cells for 12-24h at 37°C and 5% C02.
- FIG. 16 shows SKOV-3 cells maintained in folate-free RPMI-1640 medium supplemented with 10% FBS for at least three passages before being seeded in a 48-well cell culture plate and allowed to attach to plate, after which activated human PBMCs (ratio 1 : 10 of target: effector cells) were added.
- Anti-CD3 Fab or anti-CD3 Fab-folate were diluted in folate-free medium and added at the indicated concentration and the co-culture was incubated for 16 hours. Images were taken with a 25x objective microscope.
- FIG. 17 The in vivo efficacy of the anti-CD3 Fab-folate bispecific agent was assessed in a xenograft model using female NOD-SCID mice. Animals were maintained on a low-folate diet to reduce circulating serum levels of folate that might compete with the bispecific agent. KB (FR+) or A549 (FR-) cells were able to form tumors when mixed with non-activated human PBMCs (ratio 1 : 100 of target: effector cells) or activated human PBMCs (ratio 1 : 10 of target: effector cells) and injected subcutaneously into mice.
- KB cells mixed with activated human PBMCs were implanted into mice and then the mice were injected intravenously with 1.5mg/kg of anti-CD3 Fab-folate or PBS daily for 10 days starting on the same day as tumor cell implantation.
- Figure 17 (A) shows tumor volumes from this experiment. The tumor volume showed a rapid increase in PBS treated mice with a doubling time of approximately 5 days. In contrast, tumors in mice treated with anti-CD3 Fab-folate were barely detectable throughout the duration of the study.
- mice were implanted with KB cells mixed with unactivated human PBMCs (ratio 1 : 100 of target: effector cells) and treated intravenously with 1.5mg/kg of anti- CD3 Fab-folate or PBS daily for 10 days starting on the same day as tumor cell implantation.
- Figure 17 (B) shows tumor volumes from the 1 : 100 target: effector cell experiment. The rate of decrease of the tumors was higher in anti-CD3 Fab-folate treated mice.
- FIG 17 (C) shows a graphical representation of the change in body weight in the mice from both treatment groups.
- Figure 17 (D) shows the serum concentration over time of rats in three test groups: those injected with 1 mg/kg anti- CD3Fab-folate; those injected with 5 mg/kg anti-CD3Fab-folate; and those injected with 1 mg/kg anti-CD3Fab.
- Serum was collected at regular intervals and analyzed by ELISA.
- the serum concentration decreased for both anti-CD3 Fab-folate and the corresponding unconjugated mutant anti-CD3 Fab at the same rate with a serum half-life of 60 mins.
- Figure 18 - Shows the binding of folate conjugates to FR and CD3.
- Figure 18 (A) is a graphical representation of the binding of Folate-CF488 to KB cells (FR+) but not to A549 cells (FR-) analyzed by competition with free folate. Cells were incubated with media containing increasing concentrations of the conjugate and 100 nM folate for 30 mins at 4 ° C and cell bound fluorescence was analyzed by flow cytometry.
- Figure 18 (B) is a graphical representation of the binding of anti-CD3 Fab-CF488 to Jurkat cells (CD3+) but not to KB cells (CD3-). Cells were incubated with increasing concentrations of the conjugate for 30 mins at 4 ° C and binding was analyzed by flow cytometry.
- FIG 19 - Shows the T cell mediated toxicity of the anti-CD3 Fab-folate conjugate by two independent cytotoxicity assays.
- Increasing concentrations of anti-CD3 Fab-folate were incubated with target cells for 12-24h at 37°C and 5% C02.
- the cells were labeled with DIO (green plasma membrane stain) and Propidium iodide was added to a final concentration of 1 ⁇ g/mL. Cytotoxicity was measured by flow cytometry.
- Figure 19 (B) shows a graphical representation of PBMCs that were washed off after 24hrs and ATP content of KB cells was measured using Cell Titer Glo (Promega).
- Figure 20 - Shows a graphical representation of the in vivo efficacy of the anti-CD3 -folate conjugated ADC in an ovarian cancer model.
- Female NOD-SCID xenograft model mice were maintained on a low-folate diet to reduce circulating serum levels of folate that might compete with the bispecific agent.
- OV-90 (FR+) cells were able to form tumors when mixed with non-activated human PBMCs (ratio 1 : 100 of target: effector cells) or activated human PBMCs (ratio 1 : 10 of target: effector cells) and injected subcutaneously into mice.
- OV-90 (FR+) cells mixed with activated human PBMCs were implanted into mice and then the mice were split into different treatment groups and intravenously injected daily for five days following cell implantation.
- Group 1 was a control group and was injected with vehicle (pbs);
- Group 2 was injected with 0.05 mg/kg Folate-anti-CD3;
- Group 3 was injected with 0.5 mg/kg Folate-anti-CD3;
- Group 4 was injected with 5 mg/kg Folate-anti-CD3;
- Group 5 was injected with 5 mg/kg unconjugated anti-CD3.
- Figure 20 (A) shows tumor volumes from this experiment.
- FIG. 20 (B) shows a graphical representation of the change in body weight in the mice from each of the treatment groups
- Figure 21 - Shows a graphical representation of the percent survival in the
- PBS Group 1 vehicle
- Group 2 three injections administered following day 17 of tumor implantation
- Group 3 three injections administered on the days immediately following tumor implantation.
- Figure 22 - Shows a graphical representation of the percent cytotoxicity measured in NCI-H838 cells and KB cells as shown in Figures 22 and 23 when administered with an excess of folic acid.
- Figure 23 - Shows a graphical representation of the percent cytotoxicity in each of theFOLR expressing cells groups (Group 1 : NCI-H1651 ; Group 2: NCI-H2405; Group 3: NCI-H838; Group 4: NCI-H2347; Group 5: KB).
- the cytotoxicity was measured at varying concentrations of conjugated UCHTl -folate (in this example comprising SEQ ID NO: 18 and/or 20) measured in ng/mL.
- the EC50 for each of the respective test groups is shown.
- Group 1 NCI-H1651 EC50 0.22 ng/mL; Group 2: NCI-H2405 EC50 1.48 ng/mL; Group 3: NCI-H838 EC50 0.36 ng/mL; Group 4: NCI-H2347 EC50 .30 ng/mL; Group 5: KB EC50 0.024 ng/mL
- substantially purified refers to a PSMC that may be substantially or essentially free of components that normally accompany or interact with the protein as found in its naturally occurring environment, i.e. a native cell, or host cell in the case of recombinantly produced PSMC.
- PSMC that may be substantially free of cellular material includes preparations of protein having less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than about 1% (by dry weight) of contaminating protein.
- the protein may be present at about 30%, about 25%, about 20%, about 15%, about 10%, about 5%, about 4%, about 3%, about 2%, or about 1% or less of the dry weight of the cells.
- the protein may be present in the culture medium at about 5g/L, about 4g/L, about 3g/L, about 2g/L, about lg/L, about 750mg/L, about 500mg/L, about 250mg/L, about lOOmg/L, about 50mg/L, about l Omg/L, or about lmg/L or less of the dry weight of the cells.
- substantially purified PSMC as produced by the methods of the present invention may have a purity level of at least about 30%, at least about 35%, at least about 40%o, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, specifically, a purity level of at least about 75%, 80%», 85%>, and more specifically, a purity level of at least about 90%, a purity level of at least about 95%, a purity level of at least about 99%) or greater as determined by appropriate methods such as SDS/PAGE analysis, RP-HPLC, SEC, and capillary electrophoresis.
- a "recombinant host cell” or “host cell” refers to a cell that includes an exogenous polynucleotide, regardless of the method used for insertion, for example, direct uptake, transduction, f-mating, or other methods known in the art to create recombinant host cells.
- the exogenous polynucleotide may be maintained as a nonintegrated vector, for example, a plasmid, or alternatively, may be integrated into the host genome.
- the term “medium” or “media” includes any culture medium, solution, solid, semi-solid, or rigid support that may support or contain any host cell, including bacterial host cells, yeast host cells, insect host cells, plant host cells, eukaryotic host cells, mammalian host cells, CHO cells or E. coli, and cell contents.
- the term may encompass medium in which the host cell has been grown, e.g., medium into which the PSMC has been secreted, including medium either before or after a proliferation step.
- the term also may encompass buffers or reagents that contain host cell lysates, such as in the case where the PSMC is produced intracellularly and the host cells are lysed or disrupted to release the PSMC.
- Reducing agent as used herein with respect to protein refolding, is defined as any compound or material which maintains sulfhydryl groups in the reduced state and reduces intra- or intermolecular disulfide bonds.
- Suitable reducing agents include, but are not limited to, dithiothreitol (DTT), 2-mercaptoethanol, dithioerythritol, cysteine, cysteamine (2- aminoethanethiol), and reduced glutathione. It is readily apparent to those of ordinary skill in the art that a wide variety of reducing agents are suitable for use in the methods and compositions of the present invention.
- human folate receptor 1 or "FOLRl”, as used herein, refers to any native human FOLRl, unless otherwise indicated.
- FOLRl encompasses "full-length,” unprocessed FOLRl as well as any form of FOLRl that results from processing within the cell.
- the term also encompasses naturally occurring variants of FOLRl , e.g., splice variants, allelic variants and isoforms.
- the FOLRl polypeptides described herein can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
- FOLRl sequences include, but are not limited to NCBI reference numbers P15328, NP_001092242.1, AAX29268.1 , AAX371 19.1 , NP_057937.1 , and NP_057936.1.
- anti-FOLRl antibody or "an antibody that binds to FOLRl” refers to an antibody that is capable of binding FOLRl with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting FOLRl .
- the extent of binding of an anti-FOLRl antibody to an unrelated, non-FOLRl protein is less than about 10% of the binding of the antibody to FOLRl as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to FOLRl has a dissociation constant (Kd) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
- antibody fragment refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody.
- antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
- a “monoclonal antibody” refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
- the term “monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
- humanized antibody refers to foams of non-human (e.g. murine) antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences.
- humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g.
- the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, affinity, and capability.
- the humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
- the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pat. No. 5,225,539 or 5,639,641.
- variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
- the variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
- the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies.
- CDRs complementarity determining regions
- Oxidizing agent as used hereinwith respect to protein refolding, is defined as any compound or material which is capable of removing an electron from a compound being oxidized.
- Suitable oxidizing agents include, but are not limited to, oxidized glutathione, cystine, cystamine, oxidized dithiothreitol, oxidized erythreitol, and oxygen. It is readily apparent to those of ordinary skill in the art that a wide variety of oxidizing agents are suitable for use in the methods of the present invention.
- Denaturing agent or "denaturant,” as used herein, is defined as any compound or material which will cause a reversible unfolding of a protein.
- the strength of a denaturing agent or denaturant will be determined both by the properties and the concentration of the particular denaturing agent or denaturant.
- Suitable denaturing agents or denaturants may be chaotropes, detergents, organic solvents, water miscible solvents, phospholipids, or a combination of two or more such agents. Suitable chaotropes include, but are not limited to, urea, guanidine, and sodium thiocyanate.
- Useful detergents may include, but are not limited to, strong detergents such as sodium dodecyl sulfate, or polyoxyethylene ethers (e.g. Tween or Triton detergents), Sarkosyl, mild non-ionic detergents (e.g., digitonin), mild cationic detergents such as N->2,3-(Dioleyoxy)-propyl-N,N,N-trimethylammonium, mild ionic detergents (e.g.
- sodium cholate or sodium deoxycholate or zwitterionic detergents including, but not limited to, sulfobetaines (Z witter gent), 3-(3- chlolamidopropyl)dimethylammonio-l -propane sulfate (CHAPS), and 3-(3- chlolamidopropyl)dimethylammonio-2-hydroxy- 1 -propane sulfonate (CHAPSO).
- Z gent sulfobetaines
- CHPS 3-(3- chlolamidopropyl)dimethylammonio-l -propane sulfate
- CHAPSO 3-(3- chlolamidopropyl)dimethylammonio-2-hydroxy- 1 -propane sulfonate
- Organic, water miscible solvents such as acetonitrile, lower alkanols (especially C 2 - C 4 alkanols such as ethanol or isopropanol), or lower alkandiols (especially C 2 - C 4 alkandiols such as ethylene-glycol) may be used as denaturants.
- Phospholipids useful in the present invention may be naturally occurring phospholipids such as phosphatidylethanolamine, phosphatidylcholine, phosphatidylserine, and phosphatidylinositol or synthetic phospholipid derivatives or variants such as dihexanoylphosphatidylcholine or diheptanoylphosphatidylcholine.
- Refolding describes any process, reaction or method which transforms disulfide bond containing polypeptides from an improperly folded or unfolded state to a native or properly folded conformation with respect to disulfide bonds.
- Cofolding refers specifically to refolding processes, reactions, or methods which employ at least two polypeptides which interact with each other and result in the transformation of unfolded or improperly folded polypeptides to native, properly folded polypeptides.
- Antibodies are proteins, which exhibit binding specificity to a specific antigen.
- Native antibodies are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes.
- Each heavy and light chain also has regularly spaced intrachain disulfide bridges.
- Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains.
- VH variable domain
- Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy,chain. Particular amino acid residues are believed to form an interface between the light and heavy chain variable domains.
- variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are responsible for the binding specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed through the variable domains of antibodies. It is concentrated in three segments called Complementarity Determining Regions (CDRs) both in the light chain and the heavy chain variable domains. The more highly conserved portions of the variable domains are called the framework regions (FR).
- CDRs Complementarity Determining Regions
- FR framework regions
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a ⁇ -sheet configuration, connected by three or four CDRs, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions.
- antibodies or immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGl , IgG2, IgG3, and IgG4; IgAl and IgA2.
- the heavy chain constant regions that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ and ⁇ , respectively.
- human immunoglobulin classes only human IgGl , IgG2, IgG3 and IgM are known to activate complement.
- affinity maturation of antibodies is driven by antigen selection of higher affinity antibody variants which are made primarily by somatic hypermutagenesis.
- a "repertoire shift" also often occurs in which the predominant germline genes of the secondary or tertiary response are seen to differ from those of the primary or secondary response.
- the affinity maturation process of the immune system may be replicated by introducing mutations into antibody genes in vitro and using affinity selection to isolate mutants with improved affinity.
- Such mutant antibodies can be displayed on the surface of filamentous bacteriophage or microorganisms such as yeast, and antibodies can be selected by their affinity for antigen or by their kinetics of dissociation (off-rate) from antigen.
- CDR walking mutagenesis has been employed to affinity mature human antibodies which bind the human envelope glycoprotein gpl20 of human immunodeficiency virus type 1 (HIV-1) (Barbas III et al.
- Balint and Larrick Gene 137: 109-1 18 (1993) describe a computer-assisted oligodeoxyribonucleotide-directed scanning mutagenesis whereby all CDRs of a variable region gene are simultaneously and thoroughly searched for improved variants.
- An ⁇ 3- specific humanized antibody was affinity matured using an initial limited mutagenesis strategy in which every position of all six CDRs was mutated followed by the expression and screening of a combinatorial library including the highest affinity mutants (Wu et al. PNAS (USA) 95: 6037-6-42 (1998)).
- Phage displayed antibodies are reviewed in Chiswell and McCafferty TIBTECH 10:80-84 (1992); and Rader and Barbas III Current Opinion in Biotech. 8:503-508 (1997).
- the mutant antibody has amino acid substitutions in a CDR.
- affinity maturation herein is meant the process of enhancing the affinity of an antibody for its antigen. Methods for affinity maturation include but are not limited to computational screening methods and experimental methods.
- antibody herein is meant a protein consisting of one or more polypeptides substantially encoded by all or part of the antibody genes.
- the immunoglobulin genes include, but are not limited to, the kappa, lambda, alpha, gamma (IgGl , IgG2, IgG3, and IgG4), delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable region genes.
- Antibody herein is meant to include full-length antibodies and antibody fragments, and include antibodies that exist naturally in any organism or are engineered (e.g. are variants).
- antibody fragment is meant any form of an antibody other than the full- length form.
- Antibody fragments herein include antibodies that are smaller components that exist within full-length antibodies, and antibodies that have been engineered.
- Antibody fragments include but are not limited to Fv, Fc, Fab, and (Fab') 2 , single chain Fv (scFv), diabodies, triabodies, tetrabodies, bifunctional hybrid antibodies, CDR1 , CDR2, CDR3, combinations of CDR's, variable regions, framework regions, constant regions, and the like (Maynard & Georgiou, 2000, Annu. Rev. Biomed. Eng. 2:339-76; Hudson, 1998, Curr. Opin. Biotechnol. 9:395-402).
- computational screening method herein is meant any method for designing one or more mutations in a protein, wherein said method utilizes a computer to evaluate the energies of the interactions of potential amino acid side chain substitutions with each other and/or with the rest of the protein.
- Fc herein is meant the portions of an antibody that are comprised of immunoglobulin domains Cy2 and Cy3 (Cy2 and Cy3). Fc may also include any residues which exist in the N-terminal hinge between Cy2 and Cyl (Cyl). Fc may refer to this region in isolation, or this region in the context of an antibody or antibody fragment. Fc also includes any modified forms of Fc, including but not limited to the native monomer, the native dimer (disulfide bond linked), modified dimers (disulfide and/or non-covalently linked), and modified monomers (i.e., derivatives).
- full-length antibody herein is meant the structure that constitutes the natural biological form of an antibody H and/or L chain. In most mammals, including humans and mice, this form is a tetramer and consists of two identical pairs of two immunoglobulin chains, each pair having one light and one heavy chain, each light chain comprising immunoglobulin domains V L and C L, and each heavy chain comprising immunoglobulin domains VH, Cyl , Cy2, and Cy3. In each pair, the light and heavy chain variable regions (VL and V H ) are together responsible for binding to an antigen, and the constant regions (CL, Cyl , Cy2, and Cy3, particularly Cy2, and Cy3) are responsible for antibody effector functions. In some mammals, for example in camels and llamas, full-length antibodies may consist of only two heavy chains, each heavy chain comprising immunoglobulin domains VH, Cy2, and Cy3.
- immunoglobulin herein is meant a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes. Immunoglobulins include but are not limited to antibodies. Immunoglobulins may have a number of structural forms, including but not limited to full-length antibodies, antibody fragments, and individual immunoglobulin domains including but not limited to V H , Cyl, Cy2, Cy3, V L , and C L .
- immunoglobulin domain herein is meant a protein domain consisting of a polypeptide substantially encoded by an immunoglobulin gene. Ig domains include but are not limited to V H , Cyl, Cy2, Cy3, VL, and C L as is shown in FIG. 1.
- variant protein sequence as used herein is meant a protein sequence that has one or more residues that differ in amino acid identity from another similar protein sequence.
- Said similar protein sequence may be the natural wild type protein sequence, or another variant of the wild type sequence.
- a starting sequence is referred to as a "parent" sequence, and may either be a wild type or variant sequence.
- preferred embodiments of the present invention may utilize humanized parent sequences upon which computational analyses are done to make variants.
- variable region of an antibody herein is meant a polypeptide or polypeptides composed of the VH immunoglobulin domain, the VL immunoglobulin domains, or the V H and V L immunoglobulin domains as is shown in FIG. 1 (including variants).
- Variable region may refer to this or these polypeptides in isolation, as an Fv fragment, as a scFv fragment, as this region in the context of a larger antibody fragment, or as this region in the context of a full-length antibody or an alternative, non-antibody scaffold molecule.
- the present invention may be applied to antibodies obtained from a wide range of sources.
- the antibody may be substantially encoded by an antibody gene or antibody genes from any organism, including but not limited to humans, mice, rats, rabbits, camels, llamas, dromedaries, monkeys, particularly mammals and particularly human and particularly mice and rats.
- the antibody may be fully human, obtained for example from a patient or subject, by using transgenic mice or other animals (Bruggemann & Taussig, 1997, Curr. Opin. Biotechnol. 8:455-458) or human antibody libraries coupled with selection methods (Griffiths & Duncan, 1998, Curr. Opin. Biotechnol. 9: 102-108).
- the antibody may be from any source, including artificial or naturally occurring.
- the present invention may utilize an engineered antibody, including but not limited to chimeric antibodies and humanized antibodies (Clark, 2000, Immunol. Today 21 :397-402) or derived from a combinatorial library.
- the antibody being optimized may be an engineered variant of an antibody that is substantially encoded by one or more natural antibody genes.
- the antibody being optimized is an antibody that has been identified by affinity maturation.
- PSMC specifically binds refers to PSMC's that bind to one or more epitopes of an antigen or binding partner of interest, but which do not substantially recognize and bind other molecules in a sample containing a mixed population of antigens.
- bispecific PSMC or 'multispecific PSMC as used herein refers to a PSMC comprising two or more antigen-binding sites or binding partner binding sites, a first binding site having affinity for a first antigen or epitope and a second binding site having binding affinity for a second antigen or epitope distinct from the first.
- epitope refers to a site on an antigen or binding partner that is recognized by a PSMC.
- An epitope may be a linear or conformationally formed sequence or shape of amino acids, if the antigen comprises a polypeptide.
- An epitope may also be any location on any type of antigen where a PSMC binds to the antigen.
- antigen-binding polypeptide or "PSMC” shall include those polypeptides and proteins that have at least the biological activity of specific binding to a particular binding partner such as antigen, as well as PSMC analogs, PSMC isoforms, PSMC mimetics, PSMC fragments, hybrid PSMC proteins, fusion proteins, oligomers and multimers, homologues, glycosylation pattern variants, and muteins, thereof, regardless of the biological activity of same, and further regardless of the method of synthesis or manufacture thereof including, but not limited to, recombinant (whether produced from cDNA, genomic DNA, synthetic DNA or other form of nucleic acid), in vitro, in vivo, by microinjection of nucleic acid molecules, synthetic, transgenic, and gene activated methods.
- a particular binding partner such as antigen, as well as PSMC analogs, PSMC isoforms, PSMC mimetics, PSMC fragments, hybrid PSMC proteins, fusion proteins, oligomers and multimers, homologues, glycosylation
- PSMC include, but are not limited to, antibody molecules, heavy chain, light chain, variable region, CDR, Fab, scFv, alternative scaffold non-antibody molecules, ligands, receptors, peptides, or any amino acid sequence that binds to an antigen.
- PSMC or "antigen-binding polypeptide” refers to a PSMC as described above, as well as a polypeptide that retains at least one biological activity of a naturally-occurring antibody, including but not limited to, activities other than antigen binding. Activities other than antigen binding include, but are not limited to, any one or more of the activities associated with the Fc.
- Antigen-binding polypeptides include the pharmaceutically acceptable salts and prodrugs, and prodrugs of the salts, polymorphs, hydrates, solvates, biologically-active fragments, biologically-active variants and stereoisomers of the naturally-occurring huma PSMC as well as agonist, mimetic, and antagonist variants of the naturally-occurring huma PSMC and polypeptide fusions thereof.
- Fusions comprising additional amino acids at the amino terminus, carboxyl terminus, or both, are encompassed by the term "antigen-binding polypeptide.”
- exemplary fusions include, but are not limited to, e.g., methionyl PSMC in which a methionine is linked to the N-terminus of PSMC resulting from the recombinant expression, fusions for the purpose of purification (including but not limited to, to poly- histidine or affinity epitopes), fusions for the purpose of linking PSMC's to other biologically active molecules, fusions with serum albumin binding peptides, and fusions with serum proteins such as serum albumin.
- antigens or binding partner refers to a substance that is the target for the binding activity exhibited by the PSMC. Virtually any substance may be an antigen or binding partner for a PSMC.
- antigens or binding partners include, but are not limited to, Alpha- 1 antitrypsin, Angiostatin, Antihemolytic factor, antibodies, Apolipoprotein, Apoprotein, Atrial natriuretic factor, Atrial natriuretic polypeptide, Atrial peptides, C-X-C chemokines (e.g., T39765, NAP-2, ENA-78, Gro-a, Gro-b, Gro-c, IP-10, GCP-2, NAP-4, SDF- 1 , PF4, MIG), Calcitonin, CC chemokines (e.g., Monocyte chemoattractant protein- 1 , Monocyte chemoattractant protein-2, Monocyte chemoattractant protein-3, Monocyte inflammatory protein- 1
- Additional antigens or binding partners include, but are not limited to, transcriptional and expression activators.
- Example transcriptional and expression activators include genes and proteins that modulate cell growth, differentiation, regulation, or the like. Expression and transcriptional activators are found in prokaryotes, viruses, and eukaryotes, including fungi, plants, and animals, including mammals, providing a wide range of therapeutic targets.
- expression and transcriptional activators regulate transcription by many mechanisms, e.g., by binding to receptors, stimulating a signal transduction cascade, regulating expression of transcription factors, binding to promoters and enhancers, binding to proteins that bind to promoters and enhancers, unwinding DNA, splicing pre-mRNA, polyadenylating RNA, and degrading RNA.
- Antigens or binding partners include, but are not limited to, expression activators such as cytokines, inflammatory molecules, growth factors, their receptors, and oncogene products, e.g., interleukins (e.g., IL- 1 , IL-2, IL-8, etc.), interferons, FGF, IGF-I, IGF-II, FGF, PDGF, TNF, TGF-a, TGF- ⁇ , EGF, KGF, SCF/c-Kit, CD40L/CD40, VL A-4/VC AM- 1 , ICAM-l/LFA-1 , and hyalurin/CD44; signal transduction molecules and corresponding oncogene products, e.g., Mos, Ras, Raf, and Met; and transcriptional activators and suppressors, e.g., p53, Tat, Fos, Myc, Jun, Myb, Rel, and steroid hormone receptors such as those for estrogen, progesterone, testosterone, ald
- Vaccine proteins may be antigens or binding partners including, but not limited to, proteins from infectious fungi, e.g., Aspergillus, Candida species; bacteria, particularly E. coli, which serves a model for pathogenic bacteria, as well as medically important bacteria such as Staphylococci (e.g., aureus), or Streptococci (e.g., pneumoniae); protozoa such as sporozoa (e.g., Plasmodia), rhizopods (e.g., Entamoeba) and flagellates (Trypanosoma, Leishmania, Trichomonas, Giardia, etc.); viruses such as ( + ) RNA viruses (examples include Poxviruses e.g., vaccinia; Picornaviruses, e.g.
- RNA viruses e.g., Rhabdoviruses, e.g., VSV; Paramyxoviruses, e.g., RSV; Orthomyxovimses, e.g., influenza; Bunyaviruses; and Arenaviruses
- dsDNA viruses RNA to DNA viruses, i.e., Retroviruses, e.g., HIV and HTLV, and certain DNA to RNA viruses such as Hepatitis B.
- Antigens or binding partners may be enzymes including, but not limited to, amidases, amino acid racemases, acylases, dehalogenases, dioxygenases, diarylpropane peroxidases, epimerases, epoxide hydrolases, esterases, isomerases, kinases, glucose isomerases, glycosidases, glycosyl transferases, haloperoxidases, monooxygenases (e.g., p450s), lipases, lignin peroxidases, nitrile hydratases, nitrilases, proteases, phosphatases, subtilisins, transaminase, and nucleases.
- enzymes including, but not limited to, amidases, amino acid racemases, acylases, dehalogenases, dioxygenases, diarylpropane peroxidases, epimerases, epoxide hydrolases, esterases, isomerase
- Agriculturally related proteins such as insect resistance proteins (e.g., the Cry proteins), starch and lipid production enzymes, plant and insect toxins, toxin-resistance proteins, Mycotoxin detoxification proteins, plant growth enzymes (e.g., Ribulose 1 ,5- Bisphosphate Carboxylase/Oxygenase, "RUBISCO"), lipoxygenase (LOX), and Phosphoenolpyruvate (PEP) carboxylase may also be antigens or binding partners.
- insect resistance proteins e.g., the Cry proteins
- starch and lipid production enzymes e.g., plant and insect toxins, toxin-resistance proteins, Mycotoxin detoxification proteins
- plant growth enzymes e.g., Ribulose 1 ,5- Bisphosphate Carboxylase/Oxygenase, "RUBISCO”
- LOX lipoxygenase
- the antigen or binding partner may be a disease-associated molecule, such as tumor surface antigen such as B-cell idiotypes, CD20 on malignant B cells, CD33 on leukemic blasts, and HER2/neu on breast cancer.
- the antigen or binding partner may be a growth factor receptor.
- the growth factors include, but are not limited to, epidermal growth factors (EGFs), transferrin, insulin-like growth factor, transforming growth factors (TGFs), interleukin- 1 , and interleukin-2.
- EGFs epidermal growth factors
- TGFs transforming growth factors
- interleukin- 1 interleukin-2
- interleukin-2 interleukin-2
- PSMCs of the invention may be used to treat a variety of cancers.
- the antigen or binding partner may also be cell surface protein or receptor associated with coronary artery disease such as platelet glycoprotein Iib/IIIa receptor, autoimmune diseases such as CD4, CAMPATH-1 and lipid A region of the gram-negative bacterial lipopolysaccharide.
- autoimmune diseases such as CD4
- CAMPATH-1 lipid A region of the gram-negative bacterial lipopolysaccharide.
- Humanized antibodies against CD4 have been tested in clinical trials in the treatment of patients with mycosis fungoides, generalized postular psoriasis, severe psorisis, and rheumatoid arthritis.
- Antibodies against lipid A region of the gram- negative bacterial lipopolysaccharide have been tested clinically in the treatment of septic shock.
- PSMCs of the invention may be used to treat a variety of autoimmune diseases.
- Vaswani et al. (1998) "Humanized antibodies as potential therapeutic drugs” Annals of Allergy, Asthma and Immunology 81 : 105-1 15.
- the antigen or binding partner may also be proteins or peptides associated with human allergic diseases, such as inflammatory mediator proteins, e.g. Interleukin-1 (IL- 1), tumor necrosis factor (TNF), leukotriene receptor and 5-lipoxygenase, and adhesion molecules such as V-CAM/VLA-4.
- IgE may also serve as the antigen or binding partner because IgE plays pivotal role in type I immediate hypersensitive allergic reactions such as asthma. Studies have shown that the level of total serum IgE tends to correlate with severity of diseases, especially in asthma. Burrows et al. (1989) "Association of asthma with serum IgE levels and skin-test reactivity to allergens" New Engl. L. Med. 320:271-277.
- PSMCs selected against IgE may be used to reduce the level of IgE or block the binding of IgE to mast cells and basophils in the treatment of allergic diseases without having substantial impact on normal immune functions.
- the antigen or binding partner may also be a viral surface or core protein which may serve as an antigen to trigger immune response of the host.
- viral proteins include, but are not limited to, glycoproteins (or surface antigens, e.g., GP120 and GP41) and capsid proteins (or structural proteins, e.g., P24 protein); surface antigens or core proteins of hepatitis A, B, C, D or E virus (e.g.
- SHBsAg small hepatitis B surface antigen (SHBsAg) of hepatitis B virus and the core proteins of hepatitis C virus, NS3, NS4 and NS5 antigens); glycoprotein (G-protein) or the fusion protein (F-protein) of respiratory syncytial virus (RSV); surface and core proteins of herpes simplex virus HSV-1 and HSV-2 (e.g., glycoprotein D from HSV-2).
- SHBsAg small hepatitis B surface antigen
- G-protein glycoprotein
- F-protein fusion protein
- RSV respiratory syncytial virus
- HSV-1 and HSV-2 e.g., glycoprotein D from HSV-2
- the antigen or binding partner may also be a mutated tumor suppressor gene product that has lost its tumor-suppressing function and may render the cells more susceptible to cancer.
- Tumor suppressor genes are genes that function to inhibit the cell growth and division cycles, thus preventing the development of neoplasia. Mutations in tumor suppressor genes cause the cell to ignore one or more of the components of the network of inhibitory signals, overcoming the cell cycle check points and resulting in a higher rate of controlled cell growth—cancer.
- the tumor suppressor genes include, but are not limited to, DPC-4, NF-1 , NF-2, RB, p53, WT1 , BRCA1 and BRCA2.
- DPC-4 is involved in pancreatic cancer and participates in a cytoplasmic pathway that inhibits cell division.
- NF-1 codes for a protein that inhibits Ras, a cytoplasmic inhibitory protein.
- NF-1 is involved in neurofibroma and pheochromocytomas of the nervous system and myeloid leukemia.
- NF-2 encodes a nuclear protein that is involved in meningioma, schwanoma, and ependymoma of the nervous system.
- RB codes for the pRB protein, a nuclear protein that is a major inhibitor of cell cycle. RB is involved in retinoblastoma as well as bone, bladder, small cell lung and breast cancer.
- p53 codes for p53 protein that regulates cell division and can induce apoptosis. Mutation and/or inaction of p53 is found in a wide ranges of cancers. WT1 is involved in Wilms tumor of the kidneys. BRCA1 is involved in breast and ovarian cancer, and BRCA2 is involved in breast cancer. Thus, PSMCs may be used to block the interactions of the gene product with other proteins or biochemicals in the pathways of tumor onset and development.
- the antigen or binding partner may be a CD molecule including but not limited to, CD la, CDlb, CDlc, CDld, CD2, CD3y, CD35, CD38, CD4, CD5, CD6, CD7, CD8cc, CD8 , CD9, CD10, CDl la, CDl lb, CD l lc, CDwl2, CD13, CD14, CD15, CD15s, CD 16a, CD 16b, CD 18, CD 19, CD20, CD21 , CD22, CD23, CD24, CD25, CD26, CD27, CD28, CD29, CD30, CD31 , CD32, CD33, CD34, CD35, CD36, CD37, CD38, CD39, CD40, CD41 , CD42a, CD42b, CD42c, CD42d, CD43, CD44, CD45, CD45R, CD46, CD47, CD48, CD49a, CD49b, CD49c, CD49d, CD49e, CD49f, CD50, CD41 ,
- bispecific PSMCs include, but are not limited to, those with one PSMC directed against a tumor cell antigen and the other PSMC directed against a cytotoxic trigger molecule such as anti-FcyRI/anti-CD 15, anti-pl 85 HER2 /FcyRIII (CD16), anti- CD3/anti-malignant B-cell (ID 10), anti-CD3/anti-pl 85 HER2 , anti-CD3/anti-p97, anti- CD3/anti-renal cell carcinoma, anti-CD3/anti-OVCAR-3, anti-CD3/L-Dl (anti-colon carcinoma), anti-CD3/anti-melanocyte stimulating hormone analog, anti-EGF receptor/anti- CD3, anti-CD3/anti-CAMAl , anti-CD3/anti-CD19, anti-CD3/MoV18, anti-neural cell adhesion molecule (NCAM)/anti-CD3, anti-folate binding protein (FBP)/anti-CD3, anti-pan carcinoma associated antigen (AMOC-31)/
- bispecific PSMCs for use in therapy of infectious diseases such as anti-CD3/anti-herpes simplex virus (HSV), anti-T-cell receptor:CD3 complex/anti-infiuenza, anti-FcyR/anti-HIV; bispecific PSMCs for tumor detection in vitro or in vivo such as anti-CEA/anti-EOTUBE, anti-CEA/anti-DPTA, anti-pl 85 HER2 /anti-hapten; bispecific PSMCs as vaccine adjuvants (see Fanger, MW et al., Crit Rev Immunol.
- bispecific PSMCs as diagnostic tools such as anti-rabbit IgG/anti-ferritin, anti-horse radish peroxidase (HRP)/anti- hormone, anti-somatostatin/anti-substance P, anti-HRP/anti-FITC, anti-CEA/anti- ⁇ - galactosidase (see Nolan, O et R. O'Kennedy, Biochim Biophys Acta. 1990 Aug 1 ; 1040(1): 1- 1 1 , which is incorporated by reference herein).
- Examples of trispecific PSMCs include anti- CD3/anti-CD4/anti-CD37, anti-CD3/anti-CD5/anti-CD37 and anti-CD3/anti-CD8/anti-CD37.
- PSMC polypeptide conjugation or glycosylation
- antigen-binding polypeptide includes, but is not limited to, polypeptides conjugated to a polymer such as PEG and may be comprised of one or more additional derivitizations of cysteine, lysine, N or C-terminal amino acids, or other residues.
- the PSMC may comprise a linker, polymer or biologically active molecule, wherein the amino acid to which the linker, polymer, or biologically active molecule is conjugated may be a non-natural amino acid according to the present invention, or may be conjugated to a naturally encoded amino acid utilizing techniques known in the art such as coupling to lysine or cysteine.
- U.S. Pat. No. 4,904,584 discloses PEGylated lysine depleted polypeptides, wherein at least one lysine residue has been deleted or replaced with any other amino acid residue.
- WO 99/67291 discloses a process for conjugating a protein with PEG, wherein at least one amino acid residue on the protein is deleted and the protein is contacted with PEG under conditions sufficient to achieve conjugation to the protein.
- WO 99/03887 discloses PEGylated variants of polypeptides belonging to the growth hormone superfamily, wherein a cysteine residue has been substituted with a non-essential amino acid residue located in a specified region of the polypeptide.
- WO 00/26354 discloses a method of producing a glycosylated polypeptide variant with reduced allergenicity, which as compared to a corresponding parent polypeptide comprises at least one additional glycosylation site.
- antigen-binding polypeptide also includes glycosylated PSMCs, such as but not limited to, polypeptides glycosylated at any amino acid position, N-linked or O-linked glycosylated forms of the polypeptide. Variants containing single nucleotide changes are also considered as biologically active variants of PSMC. In addition, splice variants are also included.
- antigen-binding polypeptide also includes PSMC heterodimers, homodimers, heteromultimers, or homomultimers of any one or more PSMC or any other polypeptide, protein, carbohydrate, polymer, small molecule, linker, ligand, or other biologically active molecule of any type, linked by chemical means or expressed as a fusion protein, as well as polypeptide analogues containing, for example, specific deletions or other modifications yet maintain biological activity.
- the antigen-binding polypeptides further comprise an addition, substitution or deletion that modulates biological activity of the PSMC.
- the additions, substitutions or deletions may modulate one or more properties or activities of the PSMC, including but not limited to, modulating affinity for the antigen, modulate (including but not limited to, increases or decreases) antigen conformational or other secondary, tertiary or quaternary structural changes, stabilize antigen conformational or other secondary, tertiary or quaternary structural changes, induce or cause antigen conformational or other secondary, tertiary or quaternary structural changes, modulate circulating half-life, modulate therapeutic half-life, modulate stability of the polypeptide, modulate dose, modulate release or bio-availability, facilitate purification, or improve or alter a particular route of administration.
- antigen-binding polypeptides may comprise protease cleavage sequences, reactive groups, antibody-binding domains (including but not limited to, FLAG or poly-His) or other affinity based sequences (including but not limited to, FLAG, poly-His, GST, etc.) or linked molecules (including but not limited to, biotin) that improve detection (including but not limited to, GFP), purification or other traits of the polypeptide.
- antigen-binding polypeptide also encompasses PSMC homodimers, heterodimers, homomultimers, and heteromultimers that are linked, including but not limited to those linked directly via non-naturally encoded amino acid side chains, either to the same or different non-naturally encoded amino acid side chains, to naturally- encoded amino acid side chains, as fusions, or indirectly via a linker.
- linkers include but are not limited to, small organic compounds, water soluble polymers of a variety of lengths such as poly(ethylene glycol) or polydextran, or polypeptides of various lengths.
- amino acid positions corresponding to positions in a particular antigen-binding polypeptide sequence can be readily identified in a fragment of the antigen-binding polypeptide or related antigen-binding polypeptide, etc.
- sequence alignment programs such as BLAST can be used to align and identify a particular position in a protein that corresponds with a position in a related sequence.
- antigen-binding polypeptide encompasses antigen-binding polypeptides comprising one or more amino acid substitutions, additions or deletions.
- Antigen-binding polypeptides of the present invention may be comprised of modifications with one or more natural amino acids in conjunction with one or more non-natural amino acid modification. Exemplary substitutions in a wide variety of amino acid positions in naturally- occurring PSMC polypeptides have been described, including but not limited to substitutions that modulate one or more of the biological activities of the antigen-binding polypeptide, such as but not limited to, increase agonist activity, increase solubility of the polypeptide, convert the polypeptide into an antagonist, etc. and are encompassed by the term "PSMC.”
- non-naturally encoded amino acid refers to an amino acid that is not one of the 20 common amino acids or pyrolysine or selenocysteine.
- Other terms that may be used synonymously with the term “non-naturally encoded amino acid” are “non-natural amino acid,” “unnatural amino acid,” “non-naturally-occurring amino acid,” and variously hyphenated and non-hyphenated versions thereof.
- the term “non-naturally encoded amino acid” also includes, but is not limited to, amino acids that occur by modification (e.g.
- a naturally encoded amino acid including but not limited to, the 20 common amino acids or pyrolysine and selenocysteine
- a naturally encoded amino acid including but not limited to, the 20 common amino acids or pyrolysine and selenocysteine
- non-naturally-occurring amino acids include, but are not limited to, N- acetylglucosaminyl-L-serine, N-acetylglucosaminyl-L-threonine, and O-phosphotyrosine.
- amino terminus modification group refers to any molecule that can be attached to the amino terminus of a polypeptide.
- a “carboxy terminus modification group” refers to any molecule that can be attached to the carboxy terminus of a polypeptide.
- Terminus modification groups include, but are not limited to, various water soluble polymers, peptides or proteins such as serum albumin, or other moieties that increase serum half-life of peptides.
- linkage or “linker” is used herein to refer to groups or bonds that normally are formed as the result of a chemical reaction and typically are covalent linkages.
- Hydrolytically stable linkages means that the linkages are substantially stable in water and do not react with water at useful pH values, including but not limited to, under physiological conditions for an extended period of time, perhaps even indefinitely.
- Hydrolytically unstable or degradable linkages mean that the linkages are degradable in water or in aqueous solutions, including for example, blood.
- Enzymatically unstable or degradable linkages mean that the linkage can be degraded by one or more enzymes.
- PEG and related polymers may include degradable linkages in the polymer backbone or in the linker group between the polymer backbone and one or more of the terminal functional groups of the polymer molecule.
- ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent generally hydrolyze under physiological conditions to release the agent.
- hydrolytically degradable linkages include, but are not limited to, carbonate linkages; imine linkages resulted from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyl group of a peptide; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
- Branched linkers may be used in antigen-binding polypeptides of the invention
- biologically active molecule when used herein means any substance which can affect any physical or biochemical properties of a biological system, pathway, molecule, or interaction relating to an organism, including but not limited to, viruses, bacteria, bacteriophage, transposon, prion, insects, fungi, plants, animals, and humans.
- biologically active molecules include, but are not limited to, any substance intended for diagnosis, cure, mitigation, treatment, or prevention of disease in humans or other animals, or to otherwise enhance physical or mental well-being of humans or animals.
- biologically active molecules include, but are not limited to, peptides, proteins, enzymes, small molecule drugs, hard drugs, soft drugs, dyes, lipids, nucleosides, oligonucleotides, toxins, cells, viruses, liposomes, microparticles and micelles.
- Classes of biologically active agents that are suitable for use with the invention include, but are not limited to, drugs, prodrugs, radionuclides, imaging agents, polymers, antibiotics, fungicides, anti-viral agents, anti-inflammatory agents, anti-tumor agents, cardiovascular agents, anti-anxiety agents, hormones, growth factors, steroidal agents, microbially derived toxins, and the like.
- the PSMC molecules of this invention can be used to direct biologically active molecules or detectable labels to a tumor site. This can facilitate -tumor killing, detection and/or localization or other effect. Diagnostic probes or imaging probes may also be linked to PSMC molecules of the invention.
- the biologically active molecule component of the PSMC is a "radiopaque" label, e.g. a label that can be easily visualized using for example x-rays. Radiopaque materials are well known to those of skill in the art. The most common radiopaque materials include iodide, bromide or barium salts.
- radiopaque materials include, but are not limited to organic bismuth derivatives (see, e.g., U.S. Pat. No. 5,939,045), radiopaque multiurethanes (see U.S. Pat. No. 5,346,981), organobismuth composites (see, e.g., U.S. Pat. No. 5,256,334), radiopaque barium multimer complexes (see, e.g., U.S. Pat. No. 4,866,132), and the like.
- the PSMC's of this invention can be coupled directly to the radiopaque moiety or they can be attached to a "package" (e.g. a chelate, a liposome, a multimer microbead, etc.) carrying or containing the radiopaque material.
- a "package” e.g. a chelate, a liposome, a multimer microbead, etc.
- Detectable labels suitable for use as the biologically active molecule component of the PSMC's of this invention include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means.
- Useful labels in the present invention include magnetic beads (e.g.
- DynabeadsTM fluorescent dyes (e.g., fluorescein isothiocyanate, texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., 3 H, 125 I, 35 S, 14 C, or 32 P), enzymes (e.g., horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (e.g. multistyrene, multipropylene, latex, etc.) beads.
- radiolabels include, but are not limited to Tc, Pb, Ga,
- radiolabels may be detected using photographic film, scintillation detectors, and the like.
- Fluorescent markers may be detected using a photodetector to detect emitted illumination.
- Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
- this invention contemplates the use of immunoconjugates (chimeric moieties) for the detection of tumors and/or other cancer cells.
- the bispecific antibodies of this invention can be conjugated to gamma- emitting radioisotopes (e.g., Na-22, Cr-51 , Co-60, Tc-99, 1-125, 1-131, Cs-137, Ga-67, Mo- 99) for detection with a gamma camera, to positron emitting isotopes (e.g.
- bispecific antibodies of this invention can be used in traditional immunohistochemistry (e.g. fluorescent labels, nanocrystal labels, enzymatic and colormetric labels etc.).
- the biologically active molecule can be a radiosensitizer that enhances the cytotoxic effect of ionizing radiation (e.g., such as might be produced by 60 Co or an x-ray source) on a cell.
- radiosensitizing agents include, but are not limited to benzoporphyrin derivative compounds (see, e.g., U.S. Pat. No. 5,945,439), 1 ,2,4-benzotriazine oxides (see, e.g., U.S. Pat. No. 5,849,738), compounds containing certain diamines (see, e.g., U.S. Pat. No.
- the biologically active molecule may also be a ligand, an epitope tag, a peptide, a protein, or another PSMC.
- Ligand and antibodies may be those that bind to surface markers on immune cells. Chimeric molecules utilizing such antibodies as biologically active molecules act as bifunctional linkers establishing an association between the immune cells bearing binding partner for the ligand or PSMC and the tumor cells expressing the EGFR family member(s).
- chelating molecule is typically coupled to a molecule (e.g. biotin, avidin, streptavidin, etc.) that specifically binds an epitope tag attached to the bispecific and/or multispecific PSMC.
- a molecule e.g. biotin, avidin, streptavidin, etc.
- chelating groups are well known to those of skill in the art.
- chelating groups are derived from ethylene diamine tetra-acetic acid (EDTA), diethylene triamine penta-acetic acid (DTP A), cyclohexyl 1 ,2-diamine tetra-acetic acid (CDTA), ethyleneglycol-0,0'-bis(- 2-aminoethyl)-N,N,N',N'-tetra-acetic acid (EGTA), N,N- bis(hydroxybenzyl)-ethylenediamine-N,N'-diacetic acid (HBED), triethylene tetramine hexa- acetic acid (TTHA), l,4,7,10-tetraazacyclododecane-N,N'-,N",N"'-tetra-acetic acid (DOTA), hydroxyethyldiamine triacetic acid (HEDTA), 1,4,8,1 1 -t
- EDTA
- Examples of certain preferred chelators include unsubstituted or, substituted 2- iminothiolanes and 2-iminothiacyclohexanes, in particular 2-imino-4- mercaptomethylthiolane, and SAPS (N-(4-[21 lAt] astatophenethyl) succinimate).
- chelating agent l ,4,7,10-tetraazacyclododecane-N,N, N", N"'-tetraacetic acid (DOTA)
- DOTA dioxaenoic acid
- Conjugates of DOTA and proteins such as antibodies have been described.
- U.S. Pat. No. 5,428, 156 teaches a method for conjugating DOTA to antibodies and PSMC fragments.
- one carboxylic acid group of DOTA is converted to an active ester which can react with an amine or sulfhydryl group on the PSMC or PSMC fragment.
- 5: 565-576 describes a similar method wherein one carboxyl group of DOTA is converted to an active ester, and the activated DOTA is mixed with a PSMC, linking the PSMC to DOTA via the epsilon-amino group of a lysine residue of the PSMC, thereby converting one carboxyl group of DOTA to an amide moiety.
- the chelating agent can be coupled, directly or through a linker, to an epitope tag or to a moiety that binds an epitope tag.
- Conjugates of DOTA and biotin have been described (see, e.g., Su (1995) J. Nucl. Med., 36 (5 Suppl): 154P, which discloses the linkage of DOTA to biotin via available amino side chain biotin derivatives such as DOTA-LC-biotin or DOTA-benzyl-4-(6-amino-caproamide)-biotin).
- Yau et al., WO 95/15335 disclose a method of producing nitro-benzyl-DOTA compounds that can be conjugated to biotin.
- the method comprises a cyclization reaction via transient projection of a hydroxy group; tosylation of an amine; deprotection of the transiently protected hydroxy group; tosylation of the deprotected hydroxy group; and intramolecular tosylate cyclization.
- Wu et al. (1992) Nucl. Med. Biol., 19(2): 239-244 discloses a synthesis of macrocylic chelating agents for radiolabeling proteins with m IN and 90 Y.
- Wu et al. makes a labeled DOTA-biotin conjugate to study the stability and biodistribution of conjugates with avidin, a model protein for studies. This conjugate was made using a biotin hydrazide which contained a free amino group to react with an in situ generated activated DOTA derivative.
- PSMC's of this invention may be fused to other biologically active molecules, including, but are not limited to, cytotoxic drugs, toxins, peptides, proteins, enzymes and viruses (Chester, (2000) Dis. Markers 16:53-62; Rippmann et al. Biochem J. (2000) Biochem J. 349 (Pt. 3):805-812, Kreitman, R.J. (2001) Curr. Pharm. Biotechnol. 2:313-325; Rybak, S.M. (2001) Expert Opin. Biol. Ther. 1 :995-1003; van Beusechem, V.W. et al. J. Virol. (2002) 76:2753-2762).
- a potent cytotoxic agent, or payload may be bound to PSMC's that target and bind to antigens that are found predominantly on target cells (including but not limited to, cancer cells).
- the payload agent is linked to the PSMC via a link that is stable in the bloodstream, or may be susceptible to cleavage under conditions present at, for example, the tumor site.
- Payload agents such as toxins are delivered to target cells and thus cell killing can be initiated via a mechanism dependent on the toxin.
- Examples of such toxins include, but are not limited to, small molecules such as fungal derived calicheamicins (Hinman et al. (1993) Cancer Res. 53 : 3336-3342) and maytansinoids (Liu et al. (1996) PNAS USA 93:8618-8623, Smith, S. (2001) Curr. Opin. Mol. Ther. 3(2): 198-203), trichothene, and CC 1065, or proteins, e.g. ricin A chain (Messman, et al. (2000) Clin. Cancer Res. 6(4): 1302-1313), Pseudomonas exotoxin (Tur et al. (2001) Intl. J.
- small molecules such as fungal derived calicheamicins (Hinman et al. (1993) Cancer Res. 53 : 3336-3342) and maytansinoids (Liu et al. (1996) PNAS USA 93:8618-8623
- calicheamicin molecules may be used.
- Members of the calicheamicin family of antibiotics are capable of producing double- stranded DNA breaks at sub-picomolar concentrations. Structured analogues of calicheamicin are also known. See Hinman et al., Cancer Research 53: 3336-42 (1993); Lode et al. (1998) Cancer Research 58:2925-28.
- PSMC's of this invention may be fused to toxins.
- PSMC's of the invention may be fused with botulinum A neurotoxin, a protein complex produced by the bacterium Clostridium botulinum.
- the PSMC's of the invention may comprise one or more enzymatically active toxins and/or fragments thereof.
- toxins include non-binding active fragments of diphtheria toxin, diphtheria A chain, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, dianthin proteins, Phytolaca americana proteins (PAPI, PAP All, and PAP-S), momordica charantia inhibitor, curcin, crotin sapaonaria, officinalis inhibitor, gelonin, mitogellin, restrictoein, phenomycin, enomycin, and the tricothecenes.
- cytotoxins include Pseudomonas exotoxins (PE), Diphtheria toxins, ricin, and abrin. Pseudomonas exotoxin and Dipthteria toxin are well known. Like PE, diphtheria toxin (DT) kills cells by ADP-ribosylating elongation factor 2 thereby inhibiting protein synthesis. Additional citations regarding immunotoxins include Brinkmann, U.
- Suitable biologically active molecules include pharmacological agents or encapsulation systems containing various pharmacological agents.
- the targeting molecule of the chimeric molecule may be attached directly to a drug that is to be delivered directly to the tumor.
- drugs are well known to those of skill in the art and include, but are not limited to, doxirubicin, vinblastine, genistein, an antisense molecule, and the like.
- the biologically active molecule may be an encapsulation system, such as a viral capsid, a liposome, or micelle that contains a therapeutic composition such as a drug, a nucleic acid (e.g. an antisense nucleic acid), or another therapeutic moiety that is preferably shielded from direct exposure to the circulatory system.
- a therapeutic composition such as a drug, a nucleic acid (e.g. an antisense nucleic acid), or another therapeutic moiety that is preferably shielded from direct exposure to the circulatory system.
- Means of preparing liposomes attached to antibodies are well known to those of skill in the art. See, for example, U.S. Pat. No. 4,957,735, Connor et al. (1985) Pharm. Ther., 28: 341 -365. Due to their antigen specificity, PSMC's of the invention may be used to direct drug-loaded liposomes to their target. See Park, J.W. et al. (2002) Clin
- PSMC's of the invention may be conjugated to molecules such as PEG to improve in vivo delivery and pharmacokinetic profiles.
- molecules such as PEG to improve in vivo delivery and pharmacokinetic profiles.
- Leong et al. describe site-specific PEGylation of a Fab' fragment of an anti-IL-8 antibody with a decreased clearance rate over the non-PEGylated form and little or no loss of antigen binding activity (Leong, S.R. et al. (2001) Cytokine 16: 106-1 19).
- the PSMC's of the present invention may be linked to a prodrug.
- prodrug as used herein means a pharmacologically inactive, or reduced activity, derivative of an active drug.
- Prodrugs may be designed to modulate the amount of a drug or biologically active molecule that reaches a desired site of action through the manipulation of the properties of a drug, such as physicochemical, biopharmaceutical, or pharmacokinetic properties. Prodrugs are converted into active drug within the body through enzymatic or non-enzymatic reactions. Prodrugs may provide improved physicochemical properties such as better solubility, enhanced delivery characteristics, such as specifically targeting a particular cell, tissue, organ or ligand, and improved therapeutic value of the drug.
- PSMC's of the invention may be fused to enzymes for prodrug activation (Kousparou, C.A., et al. (2002) Int. J. Cancer 99, 138-148).
- (2002) Recombinant molecules may comprise a PSMC and an enzyme that acts upon a prodrug to release a cytotoxin such as cyanide.
- the therapeutic agents may be administered as a prodrug and subsequently activated by a prodrug-activating enzyme that converts a prodrug like peptidyl chemotherapeutic agent to an active anti-cancer drug.
- a prodrug-activating enzyme that converts a prodrug like peptidyl chemotherapeutic agent to an active anti-cancer drug.
- the enzyme component includes any enzyme capable of acting on a prodrug in such a way as to convert it into its more active, cytotoxic form.
- Enzymes that may be useful include, but are not limited to, alkaline phosphatase useful for converting phosphate-containing prodrugs into free drugs, arylsulfatase useful for converting sulfate containing prodrugs into free drugs; cytosine deaminase useful for converting non-toxic 5-fluorocytosine into the anti-cancer drug, 5- fluorouracil; proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases and cathepsins (such as cathepsins B and L), that are useful for converting peptide-containing prodrugs into free drugs; D-alanylcarboxypeptidases, useful for converting prodrugs that contain D-amino acid substituents; carbohydrate cleaving enzymes such as ⁇ -galactosidase and neuraminidase useful for converting glycosylated prodrugs into free drugs; ⁇ -lac
- antibodies with enzymatic activity may be used to convert the prodrugs of the invention into free active drugs. See e.g., Massey, (1987) 328:457-48.
- the bispecific and/or multispecific PSMC of this invention and the biologically active molecule moieties can typically be joined together in any order.
- the targeting molecule is a single chain protein
- the biologically active molecule may be joined to either the amino or carboxy termini of the targeting molecule.
- the biologically active molecule can also be joined to an internal region of the bispecific and/or multispecific PSMC, or conversely.
- the bispecific and/or multispecific PSMC can be joined to an internal location or a terminus of the biologically active molecule. In any case, attachment points are selected that do not interfere with the respective activities of the bispecific and/or multispecific PSMC or the biologically active molecule.
- the bispecific and/or multispecific PSMC and the biologically active molecule can be attached by any of a number of means well known to those of skill in the art.
- the biologically active molecule is conjugated, either directly or through a linker (spacer), to the bispecific PSMC.
- linker spacer
- both the biologically active molecule and the bispecific PSMC are both polypeptides it may be desired to recombinantly express the chimeric molecule as a single-chain fusion protein.
- the bispecific and/or multispecific PSMC is chemically conjugated to the biologically active molecule (e.g., a cytotoxin, a label, a ligand, a drug, a PSMC, a liposome, etc.).
- the biologically active molecule e.g., a cytotoxin, a label, a ligand, a drug, a PSMC, a liposome, etc.
- Means of chemically conjugating molecules are well known to those of skill in the art.
- polypeptides typically contain variety of functional groups; e.g., carboxylic acid (COOH) or free amine (— NH 2 ) groups, which are available for reaction with a suitable functional group on a biologically active molecule to bind the biologically active molecule thereto.
- functional groups e.g., carboxylic acid (COOH) or free amine (— NH 2 ) groups, which are available for reaction with a suitable functional group on a biologically active molecule to bind the biologically active molecule thereto.
- the bispecific PSMC and/or biologically active molecule can be derivatized to expose or attach additional reactive functional groups.
- the derivatization can involve attachment of any of a number of linker molecules such as those available from Pierce Chemical Company, Rockford, 111.
- chimeric conjugates comprising linkages that are cleavable in the vicinity of the target site can be used when the biologically active molecule is to be released at the target site. Cleaving of the linkage to release the agent from the PSMC may be prompted by enzymatic activity or conditions to which the immunoconjugate is subjected either inside the target cell or in the vicinity of the target site.
- a linker which is cleavable under conditions present at the tumor site (e.g. when exposed to tumor-associated enzymes or acidic pH) may be used.
- the biologically active molecule comprises a chelate that is attached to a PSMC or to an epitope tag.
- the bispecific and/or multispecific PSMC bears a corresponding epitope tag or PSMC so that simple contacting of the bispecific and/or multispecific PSMC to the chelate results in attachment of the PSMC to the biologically active molecule.
- the combining step can be performed after the moiety is used (pretargeting strategy) or the target tissue can be bound to the bispecific and/or multispecific PSMC before the chelate is delivered.
- Methods of producing chelates suitable for coupling to various targeting moieties are well known to those of skill in the art (see, e.g., U.S. Pat. Nos.
- the bispecific and/or multispecific PSMC and/or the biologically active molecule are both single chain proteins and relatively short (i.e., less than about 50 amino acids) they can be synthesized using standard chemical peptide synthesis techniques. Where both components are relatively short, the chimeric moiety can be synthesized as a single contiguous polypeptide.
- a bispecific and/or multispecific PSMC and the biologically active molecule may be synthesized separately and then fused by condensation of the amino terminus of one molecule with the carboxyl terminus of the other molecule thereby forming a peptide bond.
- the bispecific and/or multispecific PSMC and biologically active molecules may each be condensed with one end of a peptide spacer molecule thereby forming a contiguous fusion protein.
- Solid phase synthesis in which the C-terminal amino acid of the sequence is attached to an insoluble support followed by sequential addition of the remaining amino acids in the sequence is the preferred method for the chemical synthesis of the polypeptides of this invention.
- Techniques for solid phase synthesis are described by Barany and Merrifield, Solid-Phase Peptide Synthesis; pp. 3-284 in The Peptides: Analysis, Synthesis, Biology. Vol. 2: Special Methods in Peptide Synthesis, Part A., Merrifield, et al. J. Am. Chem. Soc, 85: 2149-2156 (1963), and Stewart et al., Solid Phase Peptide Synthesis, 2nd ed. Pierce Chem. Co., Rockford, 111. (1984).
- a "bifunctional polymer” refers to a polymer comprising two discrete functional groups that are capable of reacting specifically with other moieties (including but not limited to, amino acid side groups) to form covalent or non-covalent linkages.
- a bifunctional linker having one functional group reactive with a group on a particular biologically active component, and another group reactive with a group on a second biological component may be used to form a conjugate that includes the first biologically active component, the bifunctional linker and the second biologically active component.
- Many procedures and linker molecules for attachment of various compounds to peptides are known. See, e.g., European Patent Application No. 188,256; U.S. Patent Nos.
- a "multi-functional polymer” refers to a polymer comprising two or more discrete functional groups that are capable of reacting specifically with other moieties (including but not limited to, amino acid side groups) to form covalent or non-covalent linkages.
- a bi-functional polymer or multi-functional polymer may be any desired molecular length or molecular weight, and may be selected to provide a particular desired spacing or conformation between one of molecules linked to the PSMC.
- substituent groups are specified by their conventional chemical formulas, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, for example, the structure -CH 2 0- is equivalent to the structure -OCH 2 -.
- non-interfering substituents include but is not limited to "non-interfering substituents".
- Non-interfering substituents are those groups that yield stable compounds. Suitable non- interfering substituents or radicals include, but are not limited to, halo, C ⁇ -C 10 alkyl, C 2 -Ci 0 alkenyl, C 2 -Ci 0 alkynyl, Ci-Cio alkoxy, Ci-C 12 aralkyl, C1-C12 alkaryl, C 3 -Ci 2 cycloalkyl, C 3 -Ci 2 cycloalkenyl, phenyl, substituted phenyl, toluoyl, xylenyl, biphenyl, C 2 - Ci 2 alkoxyalkyl, C 2 -Ci 2 alkoxyaryl, C 7 -C[ 2 aryloxyalkyl, C 7 -Ci 2 oxyaryl,
- halogen includes fluorine, chlorine, iodine, and bromine.
- alkyl by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain, or cyclic hydrocarbon radical, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e. CpCio means one to ten carbons).
- saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, cyclohexyl, (cyclohexyl)methyl, cyclopropylmethyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like.
- An unsaturated alkyl group is one having one or more double bonds or triple bonds.
- alkyl groups examples include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3- (1 ,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers.
- alkyl unless otherwise noted, is also meant to include those derivatives of alkyl defined in more detail below, such as “heteroalkyl.”
- Alkyl groups which are limited to hydrocarbon groups are termed "homoalkyl".
- alkylene by itself or as part of another substituent means a divalent radical derived from an alkane, as exemplified, but not limited, by the structures -CH 2 CH 2 - and -CH 2 CH 2 CH 2 CH 2 -, and further includes those groups described below as “heteroalkylene.”
- an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred in the present invention.
- a “lower alkyl” or “lower alkylene” is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
- alkoxy alkylamino and “alkylthio” (or thioalkoxy) are used in their conventional sense, and refer to those alkyl groups attached to the remainder of the molecule via an oxygen atom, an amino group, or a sulfur atom, respectively.
- heteroalkyl by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or cyclic hydrocarbon radical, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom selected from the group consisting of O, N, Si and S, and wherein the nitrogen and sulfur atoms may optionally be oxidized and the nitrogen heteroatom may optionally be quaternized.
- the heteroatom(s) O, N and S and Si may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule.
- heteroalkylene by itself or as part of another substituent means a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH 2 - CH 2 -S-CH 2 -CH 2 - and -CH 2 -S-CH 2 -CH 2 -NH-CH 2 -.
- heteroalkylene groups the same or different heteroatoms can also occupy either or both of the chain termini (including but not limited to, alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, aminooxyalkylene, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula -C(0) 2 R'- represents both -C(0) 2 R'- and -R'C(0) 2 -.
- cycloalkyl and “heterocycloalkyl”, by themselves or in combination with other terms, represent, unless otherwise stated, cyclic versions of “alkyl” and “heteroalkyl”, respectively.
- a cycloalkyl or heterocycloalkyl include saturated and unsaturated ring linkages.
- a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule.
- Examples of cycloalkyl include, but are not limited to, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3- cyclohexenyl, cycloheptyl, and the like.
- heterocycloalkyl examples include, but are not limited to, l-(l ,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4- morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1-piperazinyl, 2-piperazinyl, and the like. Additionally, the term encompasses bicyclic and tricyclic ring structures.
- heterocycloalkylene by itself or as part of another substituent means a divalent radical derived from heterocycloalkyl
- cycloalkylene by itself or as part of another substituent means a divalent radical derived from cycloalkyl
- water soluble polymer refers to any polymer that is soluble in aqueous solvents. Linkage of water soluble polymers to PSMC can result in changes including, but not limited to, increased or modulated serum half-life, or increased or modulated therapeutic half-life relative to the unmodified form, modulated immunogenicity, modulated physical association characteristics such as aggregation and multimer formation, altered receptor binding and altered receptor dimerization or multimerization.
- the water soluble polymer may or may not have its own biological activity, and may be utilized as a linker for attaching a PSMC to other substances, including but not limited to one or more PSMC's, or one or more biologically active molecules.
- Suitable polymers include, but are not limited to, polyethylene glycol, polyethylene glycol propionaldehyde, mono CI -CIO alkoxy or aryloxy derivatives thereof (described in U.S. Patent No. 5,252,714 which is incorporated by reference herein), monomethoxy-polyethylene glycol, polyvinyl pyrrolidone, polyvinyl alcohol, polyamino acids, divinylether maleic anhydride, N-(2-Hydroxypropyl)- methacrylamide, dextran, dextran derivatives including dextran sulfate, polypropylene glycol, polypropylene oxide/ethylene oxide copolymer, polyoxyethylated polyol, heparin, heparin fragments, polysaccharides, oligosaccharides, glycans, cellulose and cellulose derivatives, including but not limited to methylcellulose and carboxymethyl cellulose, starch and starch derivatives, polypeptides, polyal
- polyalkylene glycol or “poly(alkene glycol)” refers to polyethylene glycol (poly(ethylene glycol)), polypropylene glycol, polybutylene glycol, and derivatives thereof.
- polyalkylene glycol encompasses both linear and branched polymers and average molecular weights of between 0.1 kDa and 100 kDa.
- Other exemplary embodiments are listed, for example, in commercial supplier catalogs, such as Shearwater Corporation's catalog “Polyethylene Glycol and Derivatives for Biomedical Applications” (2001).
- aryl means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent which can be a single ring or multiple rings (preferably from 1 to 3 rings) which are fused together or linked covalently.
- heteroaryl refers to aryl groups (or rings) that contain from one to four heteroatoms selected from N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. A heteroaryl group can be attached to the remainder of the molecule through a heteroatom.
- Non-limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2- imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5- benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinoly
- arylalkyl is meant to include those radicals in which an aryl group is attached to an alkyl group (including but not limited to, benzyl, phenethyl, pyridylmethyl and the like) including those alkyl groups in which a carbon atom (including but not limited to, a methylene group) has been replaced by, for example, an oxygen atom (including but not limited to, phenoxymethyl, 2-pyridyloxymethyl, 3-(l -naphthyloxy)propyl, and the like).
- aryl and heteroaryl are meant to include both substituted and unsubstituted forms of the indicated radical. Exemplary substituents for each type of radical are provided below.
- R', R", R'" and R" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1 -3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups.
- each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present.
- R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring.
- - NR'R is meant to include, but not be limited to, 1 -pyrrolidinyl and 4-morpholinyl.
- alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF 3 and -CH 2 CF 3 ) and acyl (including but not limited to, -C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 OCH 3 , and the like).
- the term "modulated serum half-life” means the positive or negative change in circulating half-life of a modified PSMC relative to its non-modified form. Serum half-life is measured by taking blood samples at various time points after administration of PSMC, and determining the concentration of that molecule in each sample. Correlation of the serum concentration with time allows calculation of the serum half-life. Increased serum half-life desirably has at least about two-fold, but a smaller increase may be useful, for example where it enables a satisfactory dosing regimen or avoids a toxic effect. In some embodiments, the increase is at least about three-fold, at least about five-fold, or at least about ten-fold.
- modulated therapeutic half-life means the positive or negative change in the half-life of the therapeutically effective amount of a PSMC or PSMC comprising a modified biologically active molecule, relative to its non-modified form.
- Therapeutic half-life is measured by measuring pharmacokinetic and/or pharmacodynamic properties of the molecule at various time points after administration. Increased therapeutic half-life desirably enables a particular beneficial dosing regimen, a particular beneficial total dose, or avoids an undesired effect. In some embodiments, the increased therapeutic half-life results from increased potency, increased or decreased binding of the modified molecule to its target, or an increase or decrease in another parameter or mechanism of action of the non- modified molecule.
- isolated when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is substantially free of other cellular components with which it is associated in the natural state. It can be in a homogeneous state. Isolated substances can be in either a dry or semi-dry state, or in solution, including but not limited to, an aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein which is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames which flank the gene and encode a protein other than the gene of interest.
- nucleic acid or protein gives rise to substantially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least 85% pure, at least 90% pure, at least 95% pure, at least 99% or greater pure.
- nucleic acid refers to deoxyribonucleotides, deoxyribonucleosides, ribonucleosides, or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides.
- the term also refers to oligonucleotide analogs incuding PNA (peptidonucleic acid), analogs of DNA used in antisense technology (phosphorothioates, phosphoroamidates, and the like).
- PNA peptidonucleic acid
- analogs of DNA used in antisense technology phosphorothioates, phosphoroamidates, and the like.
- a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (including but not limited to, degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated.
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res.
- polypeptide peptide
- protein protein
- polypeptide peptide
- peptide protein
- the terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally encoded amino acid.
- the terms encompass amino acid chains of any length, including full length proteins ⁇ i.e. , antigens), wherein the amino acid residues are linked by covalent peptide bonds.
- amino acid refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
- Constantly modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, “conservatively modified variants” refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
- nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid.
- each codon in a nucleic acid except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan
- TGG which is ordinarily the only codon for tryptophan
- amino acid sequences one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same. Sequences are “substantially identical” if they have a percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, optionally about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. This definition also refers to the complement of a test sequence.
- the identity can exist over a region that is at least about 50 amino acids or nucleotides in length, or over a region that is 75-100 amino acids or nucleotides in length, or, where not specified, across the entire sequence or a polynucleotide or polypeptide.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
- a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are well-known in the art.
- Optimal alignment of sequences for comparison can be conducted, including but not limited to, by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol.
- BLAST and BLAST 2.0 algorithms are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm is typically performed with the "low complexity" filter turned off.
- the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., arlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01 , and most preferably less than about 0.001.
- the phrase "selectively (or specifically) hybridizes to” refers to the binding, duplexing, or hybridizing of a molecule only to a particular nucleotide sequence under stringent ⁇ hybridization conditions when that sequence is present in a complex mixture (including but not limited to, total cellular or library DNA or R A).
- stringent hybridization conditions refers to conditions of low ionic strength and high temperature as is known in the art. Typically, under stringent conditions a probe will hybridize to its target subsequence in a complex mixture of nucleic acid (including but not limited to, total cellular or library DNA or RNA) but does not hybridize to other sequences in the complex mixture. Stringent conditions are sequence- dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher .temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology— Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993).
- stringent conditions are selected to be about 5-10° C lower than the thermal melting point (T m ) for the specific sequence at a defined ionic strength pH.
- T m is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at T m , 50% of the probes are occupied at equilibrium).
- Stringent conditions may be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (including but not limited to, 10 to 50 nucleotides) and at least about 60° C for long probes (including but not limited to, greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal may be at least two times background, optionally 10 times background hybridization.
- Exemplary stringent hybridization conditions can be as following: 50% formamide, 5X SSC, and 1% SDS, incubating at 42°C, or 5X SSC, 1% SDS, incubating at 65°C, with wash in 0.2X SSC, and 0.1% SDS at 65°C. Such washes can be performed for 5, 15, 30, 60, 120, or more minutes.
- the term "eukaryote” refers to organisms belonging to the phylogenetic domain Eucarya such as animals (including but not limited to, mammals, insects, reptiles, birds, etc.), ciliates, plants (including but not limited to, monocots, dicots, algae, etc.), fungi, yeasts, flagellates, microsporidia, protists, etc.
- non-eukaryote refers to non-eukaryotic organisms.
- a non-eukaryotic organism can belong to the Eubacteria (including but not limited to, Escherichia coli, Thermus thermophilus, Bacillus stearothermophilus, Pse domonas fluorescens, Pseudomonas aeruginosa, Pseudomonas putida, etc.) phylogenetic domain, or the Archaea (including but not limited to, Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium such as Haloferax volcanii and Halobacterium species NRC-1, Archaeoglobus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Aeuropyrum pernix, etc.) phylogenetic domain.
- Eubacteria including but not limited to, Escherichia coli, Thermus thermophilus, Bacillus stearothermophilus, Pse domonas flu
- subject refers to an animal, preferably a mammal, most preferably a human, who is the object of treatment, observation or experiment.
- compositions containing the (modified) non-natural amino acid polypeptide described herein can be administered for prophylactic, enhancing, and/or therapeutic treatments.
- the terms “enhance” or “enhancing” means to increase or prolong either in potency or duration a desired effect.
- the term “enhancing” refers to the ability to increase or prolong, either in potency or duration, the effect of other therapeutic agents on a system.
- An “enhancing-effective amount,” as used herein, refers to an amount adequate to enhance the effect of another therapeutic agent in a desired system. When used in a patient, amounts effective for this use will depend on the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician.
- modified refers to the presence of a post- translational modification on a polypeptide.
- form “(modified)” term means that the polypeptides being discussed are optionally modified, that is, the polypeptides under discussion can be modified or unmodified.
- post-translationally modified refers to any modification of a natural or non-natural amino acid that occurs to such an amino acid after it has been incorporated into a polypeptide chain.
- the term encompasses, by way of example only, co-translational in vivo modifications, post-translational in vivo modifications, and post- translational in vitro modifications.
- compositions containing the (modified) non- natural amino acid polypeptide are administered to a patient susceptible to or otherwise at risk of a particular disease, disorder or condition.
- a patient susceptible to or otherwise at risk of a particular disease, disorder or condition is defined to be a "prophylactically effective amount.”
- prophylactically effective amounts In this use, the precise amounts also depend on the patient's state of health, weight, and the like. It is considered well within the skill of the art for one to determine such prophylactically effective amounts by routine experimentation (e.g., a dose escalation clinical trial).
- the term "protected” refers to the presence of a “protecting group” or moiety that prevents reaction of the chemically reactive functional group under certain reaction conditions.
- the protecting group will vary depending on the type of chemically reactive group being protected. For example, if the chemically reactive group is an amine or a hydrazide, the protecting group can be selected from the group of tert-butyloxycarbonyl (t- Boc) and 9-fluorenylmethoxycarbonyl (Fmoc). If the chemically reactive group is a thiol, the protecting group can be orthopyridyldi sulfide.
- the chemically reactive group is a carboxylic acid, such as butanoic or propionic acid, or a hydroxyl group
- the protecting group can be benzyl or an alkyl group such as methyl, ethyl, or tert-butyl.
- Other protecting groups-known in the art may also be used in or with the methods and compositions described herein.
- blocking/protecting groups may be selected from:
- compositions containing the (modified) non- natural amino acid polypeptide are administered to a patient already suffering from a disease, condition or disorder, in an amount sufficient to cure or at least partially arrest the symptoms of the disease, disorder or condition.
- an amount is defined to be a "therapeutically effective amount,” and will depend on the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician. It is considered well within the skill of the art for one to determine such therapeutically effective amounts by routine experimentation (e.g., a dose escalation clinical trial).
- treating is used to refer to either prophylactic and/or therapeutic treatments.
- PSMC molecules comprising at least one unnatural amino acid are provided in the invention.
- PSMC with at least one unnatural amino acid includes at least one post-translational modification.
- the at least one post-translational modification comprises attachment of a molecule including but not limited to, a label, a dye, a polymer, a water-soluble polymer, a derivative of polyethylene glycol, a photocrosslinker, a cytotoxic compound, a radionuclide, a drug, an affinity label, a photoaffinity label, a reactive compound, a resin, a second protein or polypeptide or polypeptide analog, an antibody or antibody fragment, a metal chelator, a cofactor, a fatty acid, a carbohydrate, a polynucleotide, a DNA, a RNA, an antisense polynucleotide, a water- soluble dendrimer, a cyclodextrin, an inhibitory
- the first reactive group is an alkynyl moiety (including but not limited to, in the unnatural amino acid -propargyloxyphenylalanine, where the propargyl group is also sometimes referred to as an acetylene moiety) and the second reactive group is an azido moiety, and [3+2] cycloaddition chemistry methodologies are utilized.
- the first reactive group is the azido moiety (including but not limited to, in the unnatural amino acid >-azido- L-phenylalanine) and the second reactive group is the alkynyl moiety.
- At least one unnatural amino acid comprising at least one post-translational modification
- the at least one post-translational modification comprises a saccharide moiety.
- the post-translational modification is made in vivo in a eukaryotic cell or in a non-eukaryotic cell.
- the protein includes at least one post-translational modification that is made in vivo by one host cell, where the post-translational modification is not normally made by another host cell type.
- the protein includes at least one post-translational modification that is made in vivo by a eukaryotic cell, where the post-translational modification is not normally made by a non-eukaryotic cell.
- post-translational modifications include, but are not limited to, acetylation, acylation, lipid- modification, palmitoylation, palmitate addition, phosphorylation, glycolipid-linkage modification, and the like.
- the post-translational modification comprises attachment of an oligosaccharide to an asparagine by a GlcNAc-asparagine linkage (including but not limited to, where the oligosaccharide comprises (GlcNAc-Man) 2 -Man- GlcNAc-GlcNAc, and the like).
- the post-translational modification comprises attachment of an oligosaccharide (including but not limited to, Gal-GalNAc, Gal- GlcNAc, etc.) to a serine or threonine by a GalNAc-serine, a GalNAc-threonine, a GlcNAc- serine, or a GlcNAc-threonine linkage.
- a protein or polypeptide of the invention can comprise a secretion or localization sequence, an epitope tag, a FLAG tag, a polyhistidine tag, a GST fusion, and/or the like.
- secretion signal sequences include, but are not limited to, a prokaryotic secretion signal sequence, an eukaryotic secretion signal sequence, an eukaryotic secretion signal sequence 5 '-optimized for bacterial expression, a novel secretion signal sequence, pectate lyase secretion signal sequence, Omp A secretion signal sequence, and a phage secretion signal sequence.
- secretion signal sequences include, but are not limited to, STII (prokaryotic), Fd GUI and Ml 3 (phage), Bgl2 (yeast), and the signal sequence bla derived from a transposon.
- An antigen-binding polypeptide comprising a non-natural amino acid may be used to modulate the therapeutic half-life, serum half-life, or circulation time of biologically active molecules, including but not limited to, small molecules, peptides, and oligonucleotides.
- biologically active molecules including but not limited to, small molecules, peptides, and oligonucleotides.
- small molecules, peptides, and oligonucleotides may have biological activities that include, but are not limited to, binding and/or recognition of a target molecule or cell type, anti-tumor, anti-angiogenic, anti-viral, and apoptotic activities.
- the antigen-binding polypeptide comprising a non-natural amino acid may provide a desired activity, including, but not limited to, effector function such as ADCC, phagocytosis, or complement-dependent cytotoxicity, activation of prodrugs, enzymatic activity, catalytic activity, blocking of protein-protein interactions, binding to a desired antigen, and targeting of the small molecule to a desired site.
- effector function such as ADCC, phagocytosis, or complement-dependent cytotoxicity
- activation of prodrugs enzymatic activity
- catalytic activity blocking of protein-protein interactions, binding to a desired antigen, and targeting of the small molecule to a desired site.
- the blocking of protein-protein interactions of a PSMC may modulate one or more activities of the attached biologically active molecule.
- Small molecules may be used as antagonists to interfere with the binding activities of other proteins or molecules.
- the antigen-binding polypeptide and the small molecule may be joined by a linker, polymer or covalent bond.
- the linker, polymer, or small molecule itself may comprise a functional group that is unreactive toward the 20 common amino acids.
- the linker or polymer may be bifunctional.
- One or more bonds involved in joining the antigen- binding polypeptide via the linker, polymer, or covalent bond to the biologically active molecule may be irreversible, reversible or labile under desired conditions.
- One or more bonds involved in joining the antigen-binding polypeptide via the linker, polymer, or covalent bond to a molecule may allow modulated release of the antigen-binding polypeptide or other molecule.
- a diversity of small molecules may be generated by one skilled in the art by chemical means, isolation as natural products, or other means.
- the complex described was created by a reversible covalent bond between mAb 38C2, a catalytic antibody that mimics natural aldolase enzymes, and a diketone derivative of an integrin targeting Arg-Gly-Asp peptidomimetic via a reactive lysine residue on the antibody.
- the complex showed selective retargeting of the antibody to the surface of integrin ⁇ ⁇ ⁇ 3 and ⁇ ⁇ ⁇ 5 expressing cells.
- the protein or polypeptide of interest can contain at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or ten or more unnatural amino acids.
- the unnatural amino acids can be the same or different, for example, there can be 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more different sites in the protein that comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more different unnatural amino acids.
- at least one, but fewer than all, of a particular amino acid present in a naturally occurring version of the protein is substituted with an unnatural amino acid.
- the present invention provides methods and compositions based on antigen- binding polypeptides, or PSMC, comprising at least one non-naturally encoded amino acid.
- PSMC antigen- binding polypeptides
- Introduction of at least one non-naturally encoded amino acid into a PSMC can allow for the application of conjugation chemistries that involve specific chemical reactions, including, but not limited to, with one or more non-naturally encoded amino acids while not reacting with the commonly occurring 20 amino acids.
- the PSMC comprising the non-naturally encoded amino acid is linked to a water soluble polymer, such as polyethylene glycol (PEG), via the side chain of the non-naturally encoded amino acid.
- PEG polyethylene glycol
- This invention provides a highly efficient method for the selective modification of proteins with PEG derivatives, which involves the selective incorporation of non-genetically encoded amino acids, including but not limited to, those amino acids containing functional groups or substituents not found in the 20 naturally incorporated amino acids, including but not limited to a ketone, an azide or acetylene moiety, into proteins in response to a selector codon and the subsequent modification of those amino acids with a suitably reactive PEG derivative.
- the amino acid side chains can then be modified by utilizing chemistry methodologies known to those of ordinary skill in the art to be suitable for the particular functional groups or substituents present in the naturally encoded amino acid.
- Known chemistry methodologies of a wide variety are suitable for use in the present invention to incorporate a water soluble polymer into the protein.
- Such methodologies include but are not limited to a Huisgen [3+2] cycloaddition reaction ⁇ see, e.g., Padwa, A. in Comprehensive Organic Synthesis. Vol. 4. (1991) Ed. Trost, B. M., Pergamon, Oxford, p. 1069-1 109; and, Huisgen, R. in 1 ,3-Dipolar Cycloaddition Chemistry, (1984) Ed. Padwa, A., Wiley, New York, p. 1-176) with, including but not limited to, acetylene or azide derivatives, respectively.
- the Huisgen [3+2] cycloaddition method involves a cycloaddition rather than a nucleophilic substitution reaction, proteins can be modified with extremely high selectivity.
- the reaction can be carried out at room temperature in aqueous conditions with excellent regioselectivity (1 ,4 > 1 ,5) by the addition of catalytic amounts of Cu(I) salts to the reaction mixture. See, e.g., Tornoe, et al., (2002) Org. Chem. 67:3057-3064; and, Rostovtsev, et al., (2002) Angew. Chem. Int. Ed. 41 :2596-2599; and WO 03/101972.
- a molecule that can be added to a protein of the invention through a [3+2] cycloaddition includes virtually any molecule with a suitable functional group or substituent including but not limited to an azido or acetylene derivative. These molecules can be added to an unnatural amino acid with an acetylene group, including but not limited to, p- propargyloxyphenylalanine, or azido group, including but not limited to p-azido- phenylalanine, respectively.
- the five-membered ring that results from the Huisgen [3+2] cycloaddition is not generally reversible in reducing environments and is stable against hydrolysis for extended periods in aqueous environments. Consequently, the physical and chemical characteristics of a wide variety of substances can be modified under demanding aqueous conditions with the active PEG derivatives of the present invention. Even more important, because the azide and acetylene moieties are specific for one another (and do not, for example, react with any of the 20 common, genetically-encoded amino acids), proteins can be modified in one or more specific sites with extremely high selectivity.
- the invention also provides water soluble and hydrolytically stable derivatives of PEG derivatives and related hydrophilic polymers having one or more acetylene or azide moieties.
- the PEG polymer derivatives that contain acetylene moieties are highly selective for coupling with azide moieties that have been introduced selectively into proteins in response to a selector codon.
- PEG polymer derivatives that contain azide moieties are highly selective for coupling with acetylene moieties that have been introduced selectively into proteins in response to a selector codon.
- the azide moieties comprise, but are not limited to, alkyl azides, aryl azides and derivatives of these azides.
- the derivatives of the alkyl and aryl azides can include other substituents so long as the acetylene-specific reactivity is maintained.
- the acetylene moieties comprise alkyl and aryl acetylenes and derivatives of each.
- the derivatives of the alkyl and aryl acetylenes can include other substituents so long as the azide-specific reactivity is maintained.
- PSMC comprising a non-naturally encoded amino acid may be used in assays that utilize the specificity of antibodies.
- PSMC molecules of the invention may be used to screen a population of potential antigens.
- the present invention provides conjugates of substances having a wide variety of functional groups, substituents or moieties, with other substances including but not limited to a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a radionuclide; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a water- soluble dendrimer; a cyclodextrin; an inhibitory ribonucleic acid; a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a
- the present invention also includes conjugates of substances having azide or acetylene moieties with PEG polymer derivatives having the corresponding acetylene or azide moieties.
- a PEG polymer containing an azide moiety can be coupled to a biologically active molecule at a position in the protein that contains a non-genetically encoded amino acid bearing an acetylene functionality.
- the linkage by which the PEG and the biologically active molecule are coupled includes but is not limited to the Huisgen [3+2] cycloaddition product. [00247] It is well established in the art that PEG can be used to modify the surfaces of biomaterials (see, e.g., U.S.
- Patent 6,610,281 Mehvar, R., J. Pharmaceut. Sci., 3(1): 125-136 (2000) which are incorporated by reference herein).
- the invention also includes biomaterials comprising a surface having one or more reactive azide or acetylene sites and one or more of the azide- or acetylene-containing polymers of the invention coupled to the surface via the Huisgen [3+2] cycloaddition linkage.
- Biomaterials and other substances can also be coupled to the azide- or acetylene-activated polymer derivatives through a linkage other than the azide or acetylene linkage, such as through a linkage comprising a carboxylic acid, amine, alcohol or thiol moiety, to leave the azide or acetylene moiety available for subsequent reactions.
- the invention includes a method of synthesizing the azide- and acetylene- containing polymers of the invention.
- the azide can be bonded directly to a carbon atom of the polymer.
- the azide- containing PEG derivative can be prepared by attaching a linking agent that has the azide moiety at one terminus to a conventional activated polymer so that the resulting polymer has the azide moiety at its terminus.
- the acetylene-containing PEG derivative the acetylene can be bonded directly to a carbon atom of the polymer.
- the acetylene-containing PEG derivative can be prepared by attaching a linking agent that has the acetylene moiety at one terminus to a conventional activated polymer so that the resulting polymer has the acetylene moiety at its terminus.
- a water soluble polymer having at least one active hydroxyl moiety undergoes a reaction to produce a substituted polymer having a more reactive moiety, such as a mesylate, tresylate, tosylate or halogen leaving group, thereon.
- a substituted polymer having a more reactive moiety such as a mesylate, tresylate, tosylate or halogen leaving group.
- the preparation and use of PEG derivatives containing sulfonyl acid halides, halogen atoms and other leaving groups are well known to the skilled artisan.
- the resulting substituted polymer then undergoes a reaction to substitute for the more reactive moiety an azide moiety at the terminus of the polymer.
- a water soluble polymer having at least one active nucleophilic or electrophilic moiety undergoes a reaction with a linking agent that has an azide at one terminus so that a covalent bond is formed between the PEG polymer and the linking agent and the azide moiety is positioned at the terminus of the polymer.
- Nucleophilic and electrophilic moieties including amines, thiols, hydrazides, hydrazines, alcohols, carboxylates, aldehydes, ketones, thioesters and the like, are well known to the skilled artisan.
- a water soluble polymer having at least one active hydroxyl moiety undergoes a reaction to displace a halogen or other activated leaving group from a precursor that contains an acetylene moiety.
- a water soluble polymer having at least one active nucleophilic or electrophilic moiety undergoes a reaction with a linking agent that has an acetylene at one terminus so that a covalent bond is formed between the PEG polymer and the linking agent and the acetylene moiety is positioned at the terminus of the polymer.
- the invention also provides a method for the selective modification of proteins to add other substances to the modified protein, including but not limited to water soluble polymers such as PEG and PEG derivatives containing an azide or acetylene moiety.
- water soluble polymers such as PEG and PEG derivatives containing an azide or acetylene moiety.
- the azide- and acetylene-containing PEG derivatives can be used to modify the properties of surfaces and molecules where biocompatibility, stability, solubility and lack of immunogenicity are important, while at the same time providing a more selective means of attaching the PEG derivatives to proteins than was previously known in the art.
- PSMC PSMC's. PSMCs are themselves specific for a very wide variety of antigens. There is also a large number of a very wide variety of PSMC fragments that are antigen-specific. PSMC therefore is intended to include any polypeptide that demonstrates an ability to specifically bind to a target molecule or antigen. Any known antibody or antibody fragment is a PSMC.
- PSMC's of the invention may comprise an Fc region or Fc-like region.
- the Fc domain provides the link to effector functions such as complement or phagocytic cells.
- the Fc portion of an immunoglobulin has a long plasma half-life, whereas the Fab is shortlived (Capon, et al. (1989), Nature, 337:525-531).
- an Fc domain can provide longer half-life or incorporate such functions as Fc receptor binding, protein A binding, complement fixation and perhaps even placental transfer.
- the Fc region of an IgGl antibody has been fused to the N-terminal end of CD30-L, a molecule which binds CD30 receptors expressed on Hodgkin's Disease tumor cells, anaplastic lymphoma cells, T-cell leukemia cells and other malignant cell types (U.S. Pat. No. 5,480,981).
- IL-10 an anti-inflammatory and antirejection agent has been fused to murine Fcy2a in order to increase the cytokine's short circulating half-life. Zheng, X. et al. (1995), The Journal of Immunology, 154: 5590-5600.
- interleukin 2 has also been fused to the Fc portion of IgGl or IgG3 to overcome the short half life of interleukin 2 and its systemic toxicity (Harvill et al. (1995), Immunotechnology, 1 : 95-105).
- Fc regions of antibodies are made up of monomeric polypeptide segments that may be linked into dimeric or multimeric forms by disulfide bonds or by non-covalent association.
- the number of intermolecular disulfide bonds between monomeric subunits of native Fc molecules ranges from 1 to 4 depending on the class (e.g., IgG, IgA, IgE) or subclass (e.g., IgGl , IgG2, IgG3, IgAl, IgGA2) of antibody involved.
- the term "Fc" as used herein is generic to the monomeric, dimeric, and multimeric forms of Fc molecules.
- Fc monomers will spontaneously dimerize when the appropriate Cys residues are present unless particular conditions are present that prevent dimerization through disulfide bond formation. Even if the Cys residues that normally form disulfide bonds in the Fc dimer are removed or replaced by other residues, the monomeric chains will generally dimerize through non-covalent interactions.
- the term "Fc” herein is used to mean any of these forms: the native monomer, the native dimer (disulfide bond linked), modified dimers (disulfide and/or non-covalently linked), and modified monomers (i.e., derivatives).
- Variants, analogs or derivatives of the Fc portion may be constructed by, for example, making various substitutions of residues or sequences including non-naturally encoded amino acids.
- Variant (or analog) polypeptides include insertion variants, wherein one or more amino acid residues supplement an Fc amino acid sequence. Insertions may be located at either or both termini of the protein, or may be positioned within internal regions of the Fc amino acid sequence. Insertional variants with additional residues at either or both termini can include for example, fusion proteins and proteins including amino acid tags or labels.
- the Fc molecule may optionally contain an N-terminal Met, especially when the molecule is expressed recombinantly in a bacterial cell such as E. coli.
- Fc deletion variants one or more amino acid residues in an Fc polypeptide are removed. Deletions can be effected at one or both termini of the Fc polypeptide, or with removal of one or more residues within the Fc amino acid sequence. Deletion variants, therefore, include all fragments of an Fc polypeptide sequence.
- Fc substitution variants one or more amino acid residues of an Fc polypeptide are removed and replaced with alternative residues.
- the substitutions are conservative in nature, however, the invention embraces substitutions that are also non-conservative. For example, cysteine residues can be deleted or replaced with other amino acids to prevent formation of some or all disulfide crosslinks of the Fc sequences.
- a protein may have one or more cysteine residues, and one may remove each of these cysteine residues or substitute one or more such cysteine residues with other amino acids, such as Ala or Ser, or a non-naturally encoded amino acid.
- modifications may also be made to introduce amino acid substitutions to (1) ablate the Fc receptor binding site; (2) ablate the complement (Clq) binding site; and/or to (3) ablate the antibody dependent cell-mediated cytotoxicity (ADCC) site.
- Such sites are known in the art, and any known substitutions are within the scope of Fc as used herein. For example, see Molecular Immunology, Vol. 29, No. 5, 633-639 (1992) with regards to ADCC sites in IgGl .
- one or more tyrosine residues can be replaced by phenylalanine residues as well.
- other variant amino acid insertions, deletions (e.g., from 1 -25 amino acids) and/or substitutions are also contemplated and are within the scope of the present invention.
- Conservative amino acid substitutions will generally be preferred.
- alterations may be in the form of altered amino acids, such as peptidomimetics or D-amino acids.
- Fc sequences may also be derivatized, i.e., bearing modifications other than insertion, deletion, or substitution of amino acid residues.
- the modifications are covalent in nature, and include for example, chemical bonding with polymers, lipids, other organic moieties, and inorganic moieties.
- Derivatives of the invention may be prepared to increase circulating half-life, or may be designed to improve targeting capacity for the polypeptide to desired cells, tissues, or organs. It is also possible to use the salvage receptor binding domain of the intact Fc molecule as the Fc part of the inventive compounds, such as described in WO 96/32478, entitled "Altered Polypeptides with Increased Half-Life".
- Additional members of the class of molecules designated as Fc herein are those that are described in WO 97/34631 , entitled “Immunoglobulin-Like Domains with Increased Half- Lives". Both of the published PCT applications cited in this paragraph are hereby incorporated by reference. [00257] Additional PSMCs are likely to be discovered in the future. New PSMCs can be identified through computer-aided secondary and tertiary structure analyses of the predicted protein sequences, and by selection techniques designed to identify molecules that bind to a particular target. Such later discovered PSMCs also are included within this invention.
- PSMCs are provided for illustrative purposes and by way of example only and not as a limit on the scope of the methods, compositions, strategies and techniques described herein. Further, reference to PSMCs in this application is intended to use the generic term as an example of any PSMC. Thus, it is understood that the modifications and chemistries described herein with reference to a specific antigen-binding polypeptide or protein can be equally applied to any antigen-binding polypeptide, including those specifically listed herein.
- nucleic acids encoding a PSMC of interest will be isolated, cloned and often altered using recombinant methods. Such embodiments are used, including but not limited to, for protein expression or during the generation of variants, derivatives, expression cassettes, or other sequences derived from an antigen-binding polypeptide.
- sequences encoding the polypeptides of the invention are operably linked to a heterologous promoter.
- a nucleotide sequence encoding an antigen-binding polypeptide comprising a non-naturally encoded amino acid may be synthesized on the basis of the amino acid sequence of the parent polypeptide and then changing the nucleotide sequence so as to effect introduction (i.e., incorporation or substitution) or removal (i.e., deletion or substitution) of the relevant amino acid residue(s).
- the nucleotide sequence may be conveniently modified by site-directed mutagenesis in accordance with conventional methods.
- the nucleotide sequence may be prepared by chemical synthesis, including but not limited to, by using an oligonucleotide synthesizer, wherein oligonucleotides are designed based on the amino acid sequence of the desired polypeptide, and preferably selecting those codons that are favored in the host cell in which the recombinant polypeptide will be produced.
- oligonucleotides are designed based on the amino acid sequence of the desired polypeptide, and preferably selecting those codons that are favored in the host cell in which the recombinant polypeptide will be produced.
- several small oligonucleotides coding for portions of the desired polypeptide may be synthesized and assembled by PCR, ligation or ligation chain reaction. See, e.g., Barany, et al, Proc. Natl. Acad. Sci. 88: 189-193 (1991); U.S.
- Patent 6,521 ,427 which are incorporated by reference herein.
- This invention utilizes routine techniques in the field of recombinant genetics. Basic texts disclosing the general methods of use in this invention include Sambrook et ah, Molecular Cloning, A Laboratory Manual (3rd ed. 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al, eds., 1994)).
- mutagenesis Various types are used in the invention for a variety of purposes, including but not limited to, to produce libraries of tRNAs, to produce libraries of synthetases, to produce selector codons, to insert selector codons that encode unnatural amino acids in a protein or polypeptide of interest.
- mutagenesis methods include but are not limited to site-directed, random point mutagenesis, homologous recombination, DNA shuffling or other recursive , mutagenesis methods, chimeric construction, mutagenesis using uracil containing templates, oligonucleotide-directed mutagenesis, phosphorothioate-modified DNA mutagenesis, mutagenesis using gapped duplex DNA or the like, or any combination thereof.
- Additional suitable methods include point mismatch repair, mutagenesis using repair-deficient host strains, restriction-selection and restriction-purification, deletion mutagenesis, mutagenesis by total gene synthesis, double-strand break repair, and the like.
- Mutagenesis including but not limited to, involving chimeric constructs, are also included in the present invention.
- mutagenesis can be guided by known information of the naturally occurring molecule or altered or mutated naturally occurring molecule, including but not limited to, sequence, sequence comparisons, physical properties, secondary, tertiary, or quaternary structure, crystal structure or the like. [00264] The texts and examples found herein describe these procedures. Additional information is found in the following publications and references cited within: Ling et al., Approaches to DNA mutagenesis: an overview, Anal Biochem.
- Taylor et al. The use of phosphorothioate-modified DNA in restriction enzyme reactions to prepare nicked DNA, Nucl. Acids Res. 13 : 8749-8764 (1985); Taylor et al., The rapid generation of oligonucleotide-directed mutations at high frequency using phosphorothioate-modified DNA, Nucl. Acids Res. 13: 8765-8787 (1985); Nakamaye & Eckstein, Inhibition of restriction endonuclease Nci I cleavage by phosphorothioate groups and its application to oligonucleotide-directed mutagenesis, Nucl. Acids Res.
- the invention also relates to eukaryotic host cells, non-eukaryotic host cells, and organisms for the in vivo incorporation of an unnatural amino acid via orthogonal tRNA/RS pairs.
- Host cells are genetically engineered (including but not limited to, transformed, transduced or transfected) with the polynucleotides of the invention or constructs which include a polynucleotide of the invention, including but not limited to, a vector of the invention, which can be, for example, a cloning vector or an expression vector.
- the vector can be, for example, in the form of a plasmid, a bacterium, a virus, a naked polynucleotide, or a conjugated polynucleotide.
- the vectors are introduced into cells and/or microorganisms by standard methods including electroporation (From et al., Proc. Natl. Acad. Sci. USA 82, 5824 (1985), infection by viral vectors, high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface (Klein et al., Nature 327. 70-73 (1987)).
- the engineered host cells can be cultured in conventional nutrient media modified as appropriate for such activities as, for example, screening steps, activating promoters or selecting transformants. These cells can optionally be cultured into transgenic organisms.
- Other useful references including but not limited to for cell isolation and culture (e.g., for subsequent nucleic acid isolation) include Freshney (1994) Culture of Animal Cells, a Manual of Basic Technique, third edition, Wiley- Liss, New York and the references cited therein; Payne et al. (1992) Plant Cell and Tissue Culture in Liquid Systems John Wiley & Sons, Inc.
- Several well-known methods of introducing target nucleic acids into cells are available, any of which can be used in the invention. These include: fusion of the recipient cells with bacterial protoplasts containing the DNA, electroporation, projectile bombardment, and infection with viral vectors (discussed further, below), etc.
- Bacterial cells can be used to amplify the number of plasmids containing DNA constructs of this invention. The bacteria are grown to log phase and the plasmids within the bacteria can be isolated by a variety of methods known in the art ⁇ see, for instance, Sambrook).
- kits are commercially available for the purification of plasmids from bacteria, (see, e.g., EasyPrepTM, FlexiPrepTM, both from Pharmacia Biotech; StrataCleanTM from Stratagene; and, QIAprepTM from Qiagen).
- the isolated and purified plasmids are then further manipulated to produce other plasmids, used to transfect cells or incorporated into related vectors to infect organisms.
- Typical vectors contain transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular target nucleic acid.
- the vectors optionally comprise generic expression cassettes containing at least one independent terminator sequence, sequences permitting replication of the cassette in eukaryotes, or prokaryotes, or both, (including but not limited to, shuttle vectors) and selection markers for both prokaryotic and eukaryotic systems.
- Vectors are suitable for replication and integration in prokaryotes, eukaryotes, or preferably both. See, Giliman & Smith, Gene 8:81 (1979); Roberts, et al, Nature, 328:731 (1987); Schneider, B., et al , Protein Expr. Purif. 6435: 10 (1995); Ausubel, Sambrook, Berger (all supra).
- a catalogue of bacteria and bacteriophages useful for cloning is provided, e.g., by the ATCC, e.g., The ATCC Catalogue of Bacteria and Bacteriophage (1992) Gherna et al (eds) published by the ATCC. Additional basic procedures for sequencing, cloning and other aspects of molecular biology and underlying theoretical considerations are also found in Watson et al. (1992) Recombinant DNA Second Edition Scientific American Books, NY.
- nucleic acid and virtually any labeled nucleic acid, whether standard or non-standard
- Selector codons of the invention expand the genetic codon framework of protein biosynthetic machinery.
- a selector codon includes, but is not limited to, a unique three base codon, a nonsense codon, such as a stop codon, including but not limited to, an amber codon (UAG), or an opal codon (UGA), an unnatural codon, a four or more base codon, a rare codon, or the like.
- selector codons that can be introduced into a desired gene, including but not limited to, one or more, two or more, more than three, 4, 5, 6, 7, 8, 9, 10 or more in a single polynucleotide encoding at least a portion of PSMC.
- the methods involve the use of a selector codon that is a stop codon for the incorporation of unnatural amino acids in vivo in a eukaryotic cell.
- a selector codon that is a stop codon for the incorporation of unnatural amino acids in vivo in a eukaryotic cell.
- an O-tRNA is produced that recognizes the stop codon, including but not limited to, UAG, and is aminoacylated by an O-RS with a desired unnatural amino acid.
- This O-tRNA is not recognized by the naturally occurring host's aminoacyl-tRNA synthetases.
- Conventional site-directed mutagenesis can be used to introduce the stop codon, including but not limited to, TAG, at the site of interest in a polypeptide of interest. See, e.g., Sayers, J.R., et al.
- the incorporation of unnatural amino acids in vivo can be done without significant perturbation of the eukaryotic host cell.
- the suppression efficiency for the UAG codon depends upon the competition between the O-tRNA, including but not limited to, the amber suppressor tR A, and a eukaryotic release factor (including but not limited to, eRF) (which binds to a stop codon and initiates release of the growing peptide from the ribosome)
- the suppression efficiency can be modulated by, including but not limited to, increasing the expression level of O-tRNA, and/or the suppressor tRNA.
- Selector codons also comprise extended codons, including but not limited to, four or more base codons, such as, four, five, six or more base codons.
- four base codons include, including but not limited to, AGGA, CUAG, UAGA, CCCU and the like.
- five base codons include, but are not limited to, AGGAC, CCCCU, CCCUC, CUAGA, CUACU, UAGGC and the like.
- a feature of the invention includes using extended codons based on frameshift suppression.
- Four or more base codons can insert, including but not limited to, one or multiple unnatural amino acids into the same protein.
- the four or more base codon is read as single amino acid.
- the anticodon loops can decode, including but not limited to, at least a four- base codon, at least a five-base codon, or at least a six-base codon or more. Since there are 256 possible four-base codons, multiple unnatural amino acids can be encoded in the same cell using a four or more base codon.
- Moore et al. examined the ability of tRNALeu derivatives with NCUA anticodons to suppress UAGN codons (N can be U, A, G, or C), and found that the quadruplet UAGA can be decoded by a tRNALeu with a UCUA anticodon with an efficiency of 13 to 26% with little decoding in the 0 or -1 frame. See, Moore et al., (2000) J. Mol. Biol., 298: 195.
- extended codons based on rare codons or nonsense codons can be used in the present invention, which can reduce missense readthrough and frameshift suppression at other unwanted sites.
- a selector codon can also include one of the natural three base codons, where the endogenous system does not use (or rarely uses) the natural base codon.
- this includes a system that is lacking a tRNA that recognizes the natural three base codon, and/or a system where the three base codon is a rare codon.
- Selector codons optionally include unnatural base pairs. These unnatural base pairs further expand the existing genetic alphabet. One extra base pair increases the number of triplet codons from 64 to 125.
- Properties of third base pairs include stable and selective base pairing, efficient enzymatic incorporation into DNA with high fidelity by a polymerase, and the efficient continued primer extension after synthesis of the nascent unnatural base pair. Descriptions of unnatural base pairs which can be adapted for methods and compositions include, e.g., Hirao, et al., (2002) An unnatural base pair for incorporating amino acid analogues into protein, Nature Biotechnology, 20: 177-182. Other relevant publications are listed below.
- the unnatural nucleoside is membrane permeable and is phosphorylated to form the corresponding triphosphate.
- the increased genetic information is stable and not destroyed by cellular enzymes.
- Previous efforts by Benner and others took advantage of hydrogen bonding patterns that are different from those in canonical Watson-Crick pairs, the most noteworthy example of which is the iso-C:iso-G pair. See, e.g., Switzer et al., (1989) J. Am. Chem. Soc, 1 1 1 :8322; and Piccirilli et al., (1990) Nature, 343:33; Kool, (2000) Curr. Opin. Chem. Biol., 4:602.
- a PICS:PICS self-pair is found to be more stable than natural base pairs, and can be efficiently incorporated into DNA by Klenow fragment of Escherichia coli DNA polymerase I ( F). See, e.g., McMinn et al., (1999) J. Am. Chem. Soc. 121 : 1 1586; and Ogawa et al., (2000) J. Am. Chem. Soc. 122:3274.
- a 3MN:3MN self-pair can be synthesized by KF with efficiency and selectivity sufficient for biological function. See, e.g., Ogawa et al., (2000) L Am. Chem. Soc, 122:8803.
- both bases act as a chain terminator for further replication.
- a mutant DNA polymerase has been recently evolved that can be used to replicate the PICS self pair.
- a 7AI self pair can be replicated. See, e.g., Tae et al., (2001) J. Am. Chem. Soc , 123:7439.
- a novel metallobase pair, DipicPy has also been developed, which forms a stable pair upon binding Cu(II). See, Meggers et al., (2000) J. Am. Chem. Soc. 122: 10714. Because extended codons and unnatural codons are intrinsically orthogonal to natural codons, the methods of the invention can take advantage of this property to generate orthogonal tRNAs for them.
- a translational bypassing system can also be used to incorporate an unnatural amino acid in a desired polypeptide.
- a large sequence is incorporated into a gene but is not translated into protein.
- the sequence contains a structure that serves as a cue to induce the ribosome to hop over the sequence and resume translation downstream of the insertion.
- the protein or polypeptide of interest (or portion thereof) in the methods and/or compositions of the invention is encoded by a nucleic acid.
- the nucleic acid comprises at least one selector codon, at least two selector codons, at least three selector codons, at least four selector codons, at least five selector codons, at least six selector codons, at least seven selector codons, at least eight selector codons, at least nine selector codons, ten or more selector codons.
- Genes coding for proteins or polypeptides of interest can be mutagenized using methods well-known to one of skill in the art and described herein to include, for example, one or more selector codon for the incorporation of an unnatural amino acid.
- a nucleic acid for a protein of interest is mutagenized to include one or more selector codon, providing for the incorporation of one or more unnatural amino acids.
- the invention includes any such variant, including but not limited to, mutant, versions of any protein, for example, including at least one unnatural amino acid.
- the invention also includes corresponding nucleic acids, i.e., any nucleic acid with one or more selector codon that encodes one or more unnatural amino acid.
- Nucleic acid molecules encoding a protein of .interest such as PSMC may be readily mutated to introduce a cysteine at any desired position of the polypeptide.
- Cysteine is widely used to introduce reactive molecules, water soluble polymers, proteins, or a wide variety of other molecules, onto a protein of interest.
- Methods suitable for the incorporation of cysteine into a desired position of the antigen-binding polypeptide are well known in the art, such as those described in U.S. Patent No. 6,608,183, which is incorporated by reference herein, and standard mutagenesis techniques.
- non-naturally encoded amino acids are suitable for use in the present invention. Any number of non-naturally encoded amino acids can be introduced into PSMC. In general, the introduced non-naturally encoded amino acids are substantially chemically inert toward the 20 common, genetically-encoded amino acids (i.e., alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine).
- alanine arginine
- asparagine asparagine
- cysteine glutamine
- glutamic acid glutamic acid
- histidine isoleucine
- leucine leucine
- lysine methionine
- phenylalanine proline
- serine threonine
- the non-naturally encoded amino acids include side chain functional groups that react efficiently and selectively with functional groups not found in the 20 common amino acids (including but not limited to, azido, ketone, aldehyde and aminooxy groups) to form stable conjugates.
- antigen-binding polypeptide that includes a non-naturally encoded amino acid containing an azido functional group can be reacted with a polymer (including but not limited to, poly(ethylene glycol) or, alternatively, a second polypeptide containing an alkyne moiety to form a stable conjugate resulting for the selective reaction of the azide and the alkyne functional groups to form a Huisgen [3+2] cycloaddition product.
- a non-naturally encoded amino acid is typically any structure having the above-listed formula wherein the R group is any substituent other than one used in the twenty natural amino acids, and may be suitable for use in the present invention. Because the non- naturally encoded amino acids of the invention typically differ from the natural amino acids only in the structure of the side chain, the non-naturally encoded amino acids form amide bonds with other amino acids, including but not limited to, natural or non-naturally encoded, in the same manner in which they are formed in naturally occurring polypeptides. However, the non-naturally encoded amino acids have side chain groups that distinguish them from the natural amino acids.
- R optionally comprises an alkyl-, aryl-, acyl-, keto-, azido- , hydroxyl-, hydrazine, cyano-, halo-, hydrazide, alkenyl, alkynl, ether, thiol, seleno-, sulfonyl-, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, ester, thioacid, hydroxylamine, amino group, or the like or any combination thereof.
- amino acids comprising a photoactivatable cross-linker include, but are not limited to, amino acids comprising a photoactivatable cross-linker, spin-labeled amino acids, fluorescent amino acids, metal binding amino acids, metal-containing amino acids, radioactive amino acids, amino acids with novel functional groups, amino acids that covalently or noncovalently interact with other molecules, photocaged and/or photoisomerizable amino acids, amino acids comprising biotin or a biotin analogue, glycosylated amino acids such as a sugar substituted serine, other carbohydrate modified amino acids, keto-containing amino acids, amino acids comprising polyethylene glycol or polyether, heavy atom substituted amino acids, chemically cleavable and/or photocleavable amino acids, amino acids with an elongated side chains as compared to natural amino acids, including but not limited to, polyethers or long chain hydrocarbons, including but not limited to, greater than about 5 or greater than about 10 carbons, carbon- linked sugar-containing amino acids,
- non-naturally encoded amino acids that may be suitable for use in the present invention and that are useful for reactions with water soluble polymers include, but are not limited to, those with carbonyl, aminooxy, hydrazine, hydrazide, semicarbazide, azide and alkyne reactive groups.
- non-naturally encoded amino acids comprise a saccharide moiety.
- amino acids examples include N-acetyl-L- glucosaminyl-L-serine, N-acetyl-L-galactosaminyl-L-serine, N-acetyl-L-glucosaminyl-L- threonine, N-acetyl-L-glucosaminyl-L-asparagine and O-mannosaminyl-L-serine.
- amino acids also include examples where the naturally-occuring N- or O- linkage between the amino acid and the saccharide is replaced by a covalent linkage not commonly found in nature - including but not limited to, an alkene, an oxime, a thioether, an amide and the like.
- amino acids also include saccharides that are not commonly found in naturally-occuring proteins such as 2-deoxy-glucose, 2-deoxygalactose and the like.
- unnatural amino acids that may be suitable for use in the present invention also optionally comprise modified backbone structures, including but not limited to, as illustrated by the structures of Formula II and III:
- Z typically comprises OH, NH 2 , SH, NH-R', or S-R';
- X and Y which can be the same or different, typically comprise S or O, and R and R, which are optionally the same or different, are typically selected from the same list of constituents for the R group described above for the unnatural amino acids having Formula I as well as hydrogen.
- unnatural amino acids of the invention optionally comprise substitutions in the amino or carboxyl group as illustrated by Formulas II and III.
- Unnatural amino acids of this type include, but are not limited to, a-hydroxy acids, a-thioacids, a-aminothiocarboxylates, including but not limited to, with side chains corresponding to the common twenty natural amino acids or unnatural side chains.
- substitutions at the a-carbon optionally include, but are not limited to, L, D, or ⁇ - ⁇ -disubstituted amino acids such as D-glutamate, D-alanine, D-methyl-O-tyrosine, aminobutyric acid, and the like.
- Other structural alternatives include cyclic amino acids, such as proline analogues as well as 3, 4 , 6, 7, 8, and 9 membered ring proline analogues, ⁇ and ⁇ amino acids such as substituted ⁇ -alanine and ⁇ - amino butyric acid.
- Tyrosine analogs include, but are not limited to, para-substituted tyrosines, ortho- substituted tyrosines, and meta substituted tyrosines, where the substituted tyrosine comprises, including but not limited to, a keto group (including but not limited to, an acetyl group), a benzoyl group, an amino group, a hydrazine, an hydroxyamine, a thiol group, a carboxy group, an isopropyl group, a methyl group, a C 6 - C 20 straight chain or branched hydrocarbon, a saturated or unsaturated hydrocarbon, an O-methyl group, a polyether group, a nitro group, an alkynyl group or the like.
- a keto group including but not limited to, an acetyl group
- benzoyl group an amino group, a hydrazine, an hydroxyamine, a thiol group, a carboxy group
- Glutamine analogs that may be suitable for use in the present invention include, but are not limited to, a-hydroxy derivatives, ⁇ -substituted derivatives, cyclic derivatives, and amide substituted glutamine derivatives.
- Example phenylalanine analogs that may be suitable for use in the present invention include, but are not limited to, para- substituted phenylalanines, ortho-substituted phenyalanines, and meta-substituted phenylalanines, where the substituent comprises, including but not limited to, a hydroxy group, a methoxy group, a methyl group, an allyl group, an aldehyde, an azido, an iodo, a bromo, a keto group (including but not limited to, an acetyl group), a benzoyl, an alkynyl group, or the like.
- unnatural amino acids include, but are not limited to, a 7-acetyl-L- phenylalanine, an O- methyl-L-tyrosine, an L-3-(2-naphthyl)alanine, a 3-methyl-phenylalanine, an O-4-allyl-L- tyrosine, a 4-propyl-L-tyrosine, a tri-O-acetyl-GlcNAcP-serine, an L-Dopa, a fluorinated phenylalanine, an isopropyl-L-phenylalanine, a -azido-L-phenylalanine, a -acyl-L- phenylalanine, a p-benzoyl-L-phenylalanine, an L-phosphoserine, a phosphonoserine, a phosphonotyrosine, a /?-iod
- compositions of PSMC that include an unnatural amino acid are provided.
- an unnatural amino acid such as /?-(propargyloxy)-phenyalanine
- compositions comprising /?-(propargyloxy)-phenyalanine and, including but not limited to, proteins and/or cells are also provided.
- a composition that includes the /?-(propargyloxy)- phenyalanine unnatural amino acid further includes an orthogonal tRNA.
- the unnatural amino acid can be bonded (including but not limited to, covalently) to the orthogonal tRNA, including but not limited to, covalently bonded to the orthogonal tRNA though an amino-acyl bond, covalently bonded to a 3 ⁇ or a 2 ⁇ of a terminal ribose sugar of the orthogonal tRNA, etc.
- the chemical moieties via unnatural amino acids that can be incorporated into proteins offer a variety of advantages and manipulations of the protein.
- the unique reactivity of a keto functional group allows selective modification of proteins with any of a number of hydrazine- or hydroxylamine-containing reagents in vitro and in vivo.
- a heavy atom unnatural amino acid for example, can be useful for phasing X-ray structure data.
- the site-specific introduction of heavy atoms using unnatural amino acids also provides selectivity and flexibility in choosing positions for heavy atoms.
- Photoreactive unnatural amino acids include but not limited to, amino acids with benzophenone and arylazides (including but not limited to, phenylazide) side chains), for example, allow for efficient in vivo and in vitro photocrosslinking of protein.
- photoreactive unnatural amino acids include, but are not limited to, p-azido-phenylalanine and p-benzoyl-phenylalanine.
- the protein with the photoreactive unnatural amino acids can then be crosslinked at will by excitation of the photoreactive group-providing temporal control.
- the methyl group of an unnatural amino can be substituted with an isotopically labeled, including but not limited to, methyl group, as a probe of local structure and dynamics, including but not limited to, with the use of nuclear magnetic resonance and vibrational spectroscopy.
- Alkynyl or azido functional groups allow the selective modification of proteins with molecules through a [3+2] cycloaddition reaction.
- a non-natural amino acid incorporated into a polypeptide at the amino terminus can be composed of an R group that is any substituent other than one used in the twenty natural amino acids and a 2 nd reactive group different from the NH 2 group normally present in a-amino acids (see Formula I).
- a similar non-natural amino acid can be incorporated at the carboxyl terminus with a 2 nd reactive group different from the COOH group normally present in a-amino acids (see Formula I).
- Amino acids with a carbonyl reactive group allow for a variety of reactions to link molecules (including but not limited to, PEG or other water soluble molecules) via nucleophilic addition or aldol condensation reactions among others.
- Exemplary carbonyl-containing amino acids can be represented as follows:
- n is 1, R ⁇ is phenyl and R 2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the para position relative to the alkyl side chain.
- n 1
- Ri is phenyl and R 2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the meta position relative to the alkyl side chain.
- a polypeptide comprising a non-naturally encoded amino acid is chemically modified to generate a reactive carbonyl functional group.
- an aldehyde functionality useful for conjugation reactions can be generated from a functionality having adjacent amino and hydroxyl groups.
- an N-terminal serine or threonine which may be normally present or may be exposed via chemical or enzymatic digestion
- an aldehyde functionality under mild oxidative cleavage conditions using periodate. See, e.g., Gaertner, et al, Bioconjug. Chem. 3 : 262-268 (1992); Geoghegan, K.
- a non-naturally encoded amino acid bearing adjacent hydroxyl and amino groups can be incorporated into the polypeptide as a "masked" aldehyde functionality.
- 5-hydroxylysine bears a hydroxyl group adjacent to the epsilon amine.
- Reaction conditions for generating the aldehyde typically involve addition of molar excess of sodium metaperiodate under mild conditions to avoid oxidation at other sites within the polypeptide.
- the pH of the oxidation reaction is typically about 7.0.
- a typical reaction involves the addition of about 1.5 molar excess of sodium meta periodate to a buffered solution of the polypeptide, followed by incubation for about 10 minutes in the dark. See, e.g. U.S. Patent No. 6,423,685, which is incorporated by reference herein.
- the carbonyl functionality can be reacted selectively with a hydrazine-, hydrazide-, hydroxylamine-, or semicarbazide-containing reagent under mild conditions in aqueous solution to form the corresponding hydrazone, oxime, or semicarbazone linkages, respectively, that are stable under physiological conditions.
- a hydrazine-, hydrazide-, hydroxylamine-, or semicarbazide-containing reagent under mild conditions in aqueous solution to form the corresponding hydrazone, oxime, or semicarbazone linkages, respectively, that are stable under physiological conditions.
- the unique reactivity of the carbonyl group allows for selective modification in the presence of the other amino acid side chains. See, e.g. , Cornish, V. W., et al, J. Am. Chem. Soc. 1 18:8150-8151 (1996); Geoghegan, K. F. & Stroh, J. G., Bioconjug. Chem. 3: 138-146 (1992); Mahal, L. K., et al , Science 276: 1 125-1 128 (1997).
- Non-naturally encoded amino acids containing a nucleophilic group such as a hydrazine, hydrazide or semicarbazide, allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
- hydrazine, hydrazide or semicarbazide -containing amino acids can be represented as follows:
- n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X, is O, N, or S or not present; R 2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R 3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
- n is 4, Ri is not present, and X is N.
- n is 2, R ⁇ is not present, and X is not present.
- n is 1 , R ⁇ is phenyl, X is O, and the oxygen atom is positioned para to the alphatic group on the aryl ring.
- Hydrazide-, hydrazine-, and semicarbazide-containing amino acids are available from commercial sources.
- L-glutamate-y-hydrazide is available from Sigma Chemical (St. Louis, MO).
- Other amino acids not available commercially can be prepared by one skilled in the art. See, e.g., U.S. Pat. No. 6,281 ,21 1, which is incorporated by reference herein.
- Polypeptides containing non-naturally encoded amino acids that bear hydrazide, hydrazine or semicarbazide functionalities can be reacted efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 1 17:3893-3899 (1995).
- hydrazide, hydrazine and semicarbazide functional groups make them significantly more reactive toward aldehydes, ketones and other electrophilic groups as compared to the nucleophilic groups present on the 20 common amino acids (including but not limited to, the hydroxyl group of serine or threonine or the amino groups of lysine and the N-terminus).
- Non-naturally encoded amino acids containing an aminooxy (also called a hydroxylamine) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
- an aminooxy (also called a hydroxylamine) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
- the enhanced nucleophilicity of the aminooxy group permits it to react efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 1 17:3893-3899 (1995); H. Hang and C. Bertozzi, Acc. Chem. Res.
- n is 1
- Ri is phenyl
- X is O
- m 1
- Y present.
- n is 2, Ri and X are not present, m is 0, and Y is not present.
- Aminooxy-containing amino acids can be prepared from readily available amino acid precursors (homoserine, serine and threonine). See, e.g., M. Carrasco and R. Brown, J. Org. Chem. 68: 8853-8858 (2003). Certain aminooxy-containing amino acids, such as L-2-amino-4-(aminooxy)butyric acid), have been isolated from natural sources (Rosenthal, G. et al., Life Sci. 60: 1635-1641 (1997). Other aminooxy-containing amino acids can be prepared by one skilled in the art.
- azide and alkyne functional groups make them extremely useful for the selective modification of polypeptides and other biological molecules.
- Organic azides, particularly alphatic azides, and alkynes are generally stable toward common reactive chemical conditions.
- both the azide and the alkyne functional groups are inert toward the side chains (i.e., R groups) of the 20 common amino acids found in naturally-occuring polypeptides.
- R groups side chains
- the "spring-loaded" nature of the azide and alkyne groups is revealed and they react selectively and efficiently via Huisgen [3+2] cycloaddition reaction to generate the corresponding triazole.
- the Huisgen cycloaddition reaction involves a selective cycloaddition reaction ⁇ see, e.g., Padwa, A., in COMPREHENSIVE ORGANIC SYNTHESIS, Vol. 4, (ed. Trost, B. M., 1991), p. 1069-1 109; Huisgen, R. in 1 ,3-DIPOLAR CYCLOADDITION CHEMISTRY, (ed. Padwa, A., 1984) , p.
- Cycloaddition reaction involving azide or alkyne-containing PSMC can be carried out at room temperature under aqueous conditions by the addition of Cu(II) (including but not limited to, in the form of a catalytic amount of CuS0 4 ) in the presence of a reducing agent for reducing Cu(II) to Cu(I), in situ, in catalytic amount.
- Cu(II) including but not limited to, in the form of a catalytic amount of CuS0 4
- a reducing agent for reducing Cu(II) to Cu(I in situ, in catalytic amount.
- Exemplary reducing agents include, including but not limited to, ascorbate, metallic copper, quinine, hydroquinone, vitamin K, glutathione, cysteine, Fe 2+ , Co 2+ , and an applied electric potential.
- the antigen-binding polypeptide comprises a non-naturally encoded amino acid comprising an alkyne moiety and the water soluble polymer to be attached to the amino acid comprises an azide moiety.
- the converse reaction i.e., with the azide moiety on the amino acid and the alkyne moiety present on the water soluble polymer can also be performed.
- the azide functional group can also be reacted selectively with a water soluble polymer containing an aryl ester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage.
- the aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with a proximal ester linkage to generate the corresponding amide. See, e.g., E. Saxon and C. Bertozzi, Science 287, 2007-2010 (2000).
- the azide-containing amino acid can be either an alkyl azide (including but not limited to, 2- amino-6-azido-l -hexanoic acid) or an aryl azide (p-azido-phenylalanine).
- Exemplary water soluble polymers containing an aryl ester and a phosphine moiety can be represented as follows:
- R can be H, alkyl, aryl, substituted alkyl and substituted aryl groups.
- R groups include but are not limited to -CH 2 , -C(CH 3 ) 3 , -OR', -NR'R", -SR ⁇ -halogen, -C(0)R', - CONR'R", -S(0) 2 R', -S(0) 2 NR'R", -CN and -N0 2 .
- R', R", R"' and R" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups.
- each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present.
- R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring.
- -NR'R is meant to include, but not be limited to, 1 -pyrrolidinyl and 4-morpholinyl.
- alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF 3 and -CH 2 CF 3 ) and acyl (including but not limited to, - C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 OCH 3 , and the like).
- the azide functional group can also be reacted selectively with a water soluble polymer containing a thioester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage.
- the aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with the thioester linkage to generate the corresponding amide.
- Exemplary water soluble polymers containing a thioester and a phosphine moiety can be represented as follows:
- Exemplary alkyne-containing amino acids can be represented as follows:
- X is O, N, S or not present;
- m is 0-10, R 2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R 3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
- n is 1
- Rj is phenyl
- X is not present
- m is 0 and the acetylene moiety is positioned in the para position relative to the alkyl side chain.
- n is 1, Rj is phenyl, X is O, m is 1 and the propargyloxy group is positioned in the para position relative to the alkyl side chain (i.e., O-propargyl-tyrosine).
- n is 1
- Ri and X are not present and m is 0 (i.e., proparylglycine).
- alkyne-containing amino acids are commercially available.
- propargylglycine is commercially available from Peptech (Burlington, MA).
- alkyne-containing amino acids can be prepared according to standard methods.
- -propargyloxyphenylalanine can be synthesized, for example, as described in Deiters, A., et al, J. Am. Chem. Soc. 125: 1 1782-1 1783 (2003)
- 4-alkynyl-L-phenylalanine can be synthesized as described in Kayser, B., et al, Tetrahedron 53(7): 2475-2484 (1997).
- Other alkyne-containing amino acids can be prepared by one skilled in the art.
- Exemplary azide-containing amino acids can be represented as follows:
- n is 1
- Ri is phenyl
- X is not present, m is 0 and the azide moiety is positioned para to the alkyl side chain.
- n is 1
- Rj is phenyl, X is O, m is 2 and the ⁇ -azidoethoxy moiety is positioned in the para position relative to the alkyl side chain.
- Azide-containing amino acids are available from commercial sources.
- 4-azidophenylalanine can be obtained from Chem-Impex International, Inc. (Wood Dale, IL).
- the azide group can be prepared relatively readily using standard methods known to those of skill in the art, including but not limited to, via displacement of a suitable leaving group (including but not limited to, halide, mesylate, tosylate) or via opening of a suitably protected lactone. See, e.g., Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York).
- beta-substituted aminothiol functional groups make them extremely useful for the selective modification of polypeptides and other biological molecules that contain aldehyde groups via formation of the thiazolidine. See, e.g., J. Shao and J. Tarn, J. Am. Chem. Soc. 1995, 1 17 (14) 3893-3899.
- beta- substituted aminothiol amino acids can be incorporated into PSMC polypeptides and then reacted with water soluble polymers comprising an aldehyde functionality.
- a water soluble polymer, drug conjugate or other payload can be coupled to a PSMC polypeptide comprising a beta- substituted aminothiol amino acid via formation of the thiazolidine.
- Unnatural amino acid uptake by a eukaryotic cell is one issue that is typically considered when designing and selecting unnatural amino acids, including but not limited to, for incorporation into a protein.
- unnatural amino acids including but not limited to, for incorporation into a protein.
- the high charge density of -amino acids suggests that these compounds are unlikely to be cell permeable.
- Natural amino acids are taken up into the eukaryotic cell via a collection of protein-based transport systems. A rapid screen can be done which assesses which unnatural amino acids, if any, are taken up by cells.
- biosynthetic pathways already exist in cells for the production of amino acids and other compounds. While a biosynthetic method for a particular unnatural amino acid may not exist in nature, including but not limited to, in a eukaryotic cell, the invention provides such methods.
- biosynthetic pathways for unnatural amino acids are optionally generated in host cell by adding new enzymes or modifying existing host cell pathways. Additional new enzymes are optionally naturally occurring enzymes or artificially evolved enzymes.
- the biosynthesis of ?-aminophenylalanine (as presented in an example in WO 2002/085923 entitled "In vivo incorporation of unnatural amino acids") relies on the addition of a combination of known enzymes from other organisms.
- the genes for these enzymes can be introduced into a eukaryotic cell by transforming the cell with a plasmid comprising the genes.
- the genes when expressed in the cell, provide an enzymatic pathway to synthesize the desired compound. Examples of the types of enzymes that are optionally added are provided in the examples below. Additional enzymes sequences are found, for example, in Genbank. Artificially evolved enzymes are also optionally added into a cell in the same manner. In this manner, the cellular machinery and resources of a cell are manipulated to produce unnatural amino acids.
- a variety of methods are available for producing novel enzymes for use in biosynthetic pathways or for evolution of existing pathways.
- recursive recombination including but not limited to, as developed by Maxygen, Inc. (available on the World Wide Web at maxygen.com), is optionally used to develop novel enzymes and pathways. See, e.g., Stemmer (1994), Rapid evolution of a protein in vitro by DNA shuffling, Nature 370(4): 389-391 ; and, Stemmer, (1994), DNA shuffling by random fragmentation and reassembly: In vitro recombination for molecular evolution, Proc. Natl. Acad. Sci. USA., 91 : 10747-10751.
- DesignPathTM developed by Genencor (available on the World Wide Web at genencor.com) is optionally used for metabolic pathway engineering, including but not limited to, to engineer a pathway to create O-methyl-L-tyrosine in a cell.
- This technology reconstructs existing pathways in host organisms using a combination of new genes, including but not limited to, identified through functional genomics, and molecular evolution and design.
- Diversa Corporation (available on the World Wide Web at diversa.com) also provides technology for rapidly screening libraries of genes and gene pathways, including but not limited to, to create new pathways.
- the unnatural amino acid produced with an engineered biosynthetic pathway of the invention is produced in a concentration sufficient for efficient protein biosynthesis, including but not limited to, a natural cellular amount, but not to such a degree as to affect the concentration of the other amino acids or exhaust cellular resources.
- concentrations produced in vivo in this manner are about 10 mM to about 0.05 mM.
- an unnatural amino acid can be done for a variety of purposes, including but not limited to, tailoring changes in protein structure and/or function, changing size, acidity, nucleophilicity, hydrogen bonding, hydrophobicity, accessibility of protease target sites, targeting to a moiety (including but not limited to, for a protein array), adding a biologically active molecule, attaching a polymer, attaching a radionuclide, modulating serum half-life, modulating tissue penetration (e.g. tumors), modulating active transport, modulating tissue, cell or organ specificity, modulating immunogenicity, modulating protease resistance, etc. Proteins that include an unnatural amino acid can have enhanced or even entirely new catalytic or biophysical properties.
- compositions including proteins that include at least one unnatural amino acid are useful for, including but not limited to, novel therapeutics, diagnostics, catalytic enzymes, industrial enzymes, binding proteins (including but not limited to, antibodies), and including but not limited to, the study of protein structure and function. See, e.g., Dougherty, (2000) Unnatural Amino Acids as Probes of Protein Structure and Function, Current Opinion in Chemical Biology, 4:645-652.
- a composition includes at least one protein with at least one, including but not limited to, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten or more unnatural amino acids.
- the unnatural amino acids can be the same or different, including but not limited to, there can be 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more different sites in the protein that comprise 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more different unnatural amino acids.
- a composition includes a protein with at least one, but fewer than all, of a particular amino acid present in the protein is substituted with the unnatural amino acid.
- the unnatural amino acids can be identical or different (including but not limited to, the protein can include two or more different types of unnatural amino acids, or can include two of the same unnatural amino acid).
- the unnatural amino acids can be the same, different or a combination of a multiple unnatural amino acid of the same kind with at least one different unnatural amino acid.
- PSMC's of interest with at least one unnatural amino acid are a feature of the invention.
- the invention also includes polypeptides or proteins with at least one unnatural amino acid produced using the compositions and methods of the invention.
- An excipient (including but not limited to, a pharmaceutically acceptable excipient) can also be present with the protein.
- proteins or polypeptides of interest will typically include eukaryotic post-translational modifications.
- a protein includes at least one unnatural amino acid and at least one post-translational modification that is made in vivo by a eukaryotic cell, where the post-translational modification is not made by a prokaryotic cell.
- the post-translation modification includes, including but not limited to, acetylation, acylation, lipid-modification, palmitoylation, palmitate addition, phosphorylation, glycolipid-linkage modification, glycosylation, and the like.
- the post-translational modification includes attachment of an oligosaccharide (including but not limited to, (GlcNAc-Man) 2 -Man-GlcNAc-GlcNAc)) to an asparagine by a GlcNAc- asparagine linkage.
- an oligosaccharide including but not limited to, (GlcNAc-Man) 2 -Man-GlcNAc-GlcNAc)
- GlcNAc- asparagine linkage See Table 1 which lists some examples of N-linked oligosaccharides of eukaryotic proteins (additional residues can also be present, which are not shown).
- the post-translational modification includes attachment of an oligosaccharide (including but not limited to, Gal-GalNAc, Gal-GlcNAc, etc.) to a serine or threonine by a GalNAc-serine or GalNAc-threonine linkage, or a GlcNAc-serine or a GlcNAc-threonine linkage.
- an oligosaccharide including but not limited to, Gal-GalNAc, Gal-GlcNAc, etc.
- the post-translation modification includes proteolytic processing of precursors (including but not limited to, calcitonin precursor, calcitonin gene- related peptide precursor, preproparathyroid hormone, preproinsulin, proinsulin, prepro- opiomelanocortin, pro-opiomelanocortin and the like), assembly into a multisubunit protein or macromolecular assembly, translation to another site in the cell (including but not limited to, to organelles, such as the endoplasmic reticulum, the Golgi apparatus, the nucleus, lysosomes, peroxisomes, mitochondria, chloroplasts, vacuoles, etc., or through the secretory pathway).
- precursors including but not limited to, calcitonin precursor, calcitonin gene- related peptide precursor, preproparathyroid hormone, preproinsulin, proinsulin, prepro- opiomelanocortin, pro-opiomelanocortin and the like
- the protein comprises a secretion or localization sequence, an epitope tag, a FLAG tag, a polyhistidine tag, a GST fusion, or the like.
- an unnatural amino acid presents additional chemical moieties that can be used to add additional molecules. These modifications can be made in vivo in a eukaryotic or non-eukaryotic cell, or in vitro.
- the post-translational modification is through the unnatural amino acid.
- the post-translational modification can be through a nucleophilic-electrophilic reaction.
- Post-translational modifications including but not limited to, through an azido amino acid, can also made through the Staudinger ligation (including but not limited to, with triarylphosphine reagents). See, e.g., Kiick et al., (2002) Incorporation of azides into recombinant proteins for chemoselective modification by the Staudinger ligation, PNAS 99: 19-24.
- This invention provides another highly efficient method for the selective modification of proteins, which involves the genetic incorporation of unnatural amino acids, including but not limited to, containing an azide or alkynyl moiety into proteins in response to a selector codon.
- These amino acid side chains can then be modified by, including but not limited to, a Huisgen [3+2] cycloaddition reaction ⁇ see, e.g., Padwa, A. in Comprehensive Organic Synthesis, Vol. 4, (1991) Ed. Trost, B. M., Pergamon, Oxford, p. 1069-1 109; and, Huisgen, R. in 1 ,3-Dipolar Cycloaddition Chemistry, (1984) Ed.
- Another method that can be used is the ligand exchange on a bisarsenic compound with a tetracysteine motif, see, e.g., Griffin, et al., (1998) Science 281 :269-272.
- a molecule that can be added to a protein of the invention through a [3+2] cycloaddition includes virtually any molecule with an azide or alkynyl derivative.
- Molecules include, but are not limited to, dyes, fluorophores, crosslinking agents, saccharide derivatives, polymers (including but not limited to, derivatives of polyethylene glycol), photocrosslinkers, cytotoxic compounds, affinity labels, derivatives of biotin, resins, beads, a second protein or polypeptide (or more), polynucleotide(s) (including but not limited to, DNA, RNA, etc.), metal chelators, cofactors, fatty acids, carbohydrates, and the like.
- These molecules can be added to an unnatural amino acid with an alkynyl group, including but not limited to, p- propargyloxyphenylalanine, or azido group, including but not limited to, p-azido- phenylalanine, respectively.
- alkynyl group including but not limited to, p- propargyloxyphenylalanine, or azido group, including but not limited to, p-azido- phenylalanine, respectively.
- the antigen-binding polypeptides of the invention can be generated in vivo using modified tRNA and tRNA synthetases to add to or substitute amino acids that are not encoded in naturally-occurring systems.
- the O-RS preferentially aminoacylates the O-tRNA with at least one non-naturally occurring amino acid in the translation system and the O-tRNA recognizes at least one selector codon that is not recognized by other tRNAs in the system.
- the translation system thus inserts the non- naturally-encoded amino acid into a protein produced in the system, in response to an encoded selector codon, thereby "substituting" an amino. acid into a position in the encoded polypeptide.
- orthogonal tRNAs and aminoacyl tRNA synthetases have been described in the art for inserting particular synthetic amino acids into polypeptides, and are generally suitable for use in the present invention.
- keto-specific O- tRNA/aminoacyl-tRNA synthetases are described in Wang, L., et al, Proc. Natl. Acad. Sci. USA 100:56-61 (2003) and Zhang, Z. et al., Biochem. 42(22):6735-6746 (2003).
- Exemplary O-RS, or portions thereof are encoded by polynucleotide sequences and include amino acid sequences disclosed in U.S.
- Corresponding O-tRNA molecules for use with the O-RSs are also described in U.S. Patent Application Publications 2003/0082575 (Serial No. 10/126,927) and 2003/0108885 (Serial No. 10/126,931) which are incorporated by reference herein.
- O-tRNA/aminoacyl-tRNA synthetase system An example of an azide-specific O-tRNA/aminoacyl-tRNA synthetase system is described in Chin, J. W., et al, J. Am. Chem. Soc. 124:9026-9027 (2002).
- Exemplary O- RS sequences for -azido-L-Phe include, but are not limited to, nucleotide sequences SEQ ID NOs: 14-16 and 29-32 and amino acid sequences SEQ ID NOs: 46-48 and 61-64 as disclosed in U.S. Patent Application Publication 2003/0108885 (Serial No. 10/126,931) which is incorporated by reference herein.
- O-tRNA sequences suitable for use in the present invention include, but are not limited to, nucleotide sequences SEQ ID NOs: 1 -3 as disclosed in U.S. Patent Application Publication 2003/0108885 (Serial No. 10/126,931) which is incorporated by reference herein.
- Other examples of O-tRNA/aminoacyl-tRNA synthetase pairs specific to particular non-naturally encoded amino acids are described in U.S. Patent Application Publication 2003/0082575 (Serial No. 10/126,927) which is incorporated by reference herein.
- O-RS and O-tRNA that incorporate both keto- and azide- containing amino acids in S. cerevisiae are described in Chin, J. W., et al., Science 301 :964- 967 (2003).
- O-tRNA/aminoacyl-tRNA synthetases involves selection of a specific codon which encodes the non-naturally encoded amino acid. While any codon can be used, it is generally desirable to select a codon that is rarely or never used in the cell in which the O- tRNA/aminoacyl-tRNA synthetase is expressed.
- exemplary codons include nonsense codon such as stop codons (amber, ochre, and opal), four or more base codons and other natural three-base codons that are rarely or unused.
- Specific selector codon(s) can be introduced into appropriate positions in the PSMC polynucleotide coding sequence using mutagenesis methods known in the art (including but not limited to, site-specific mutagenesis, cassette mutagenesis, restriction selection mutagenesis, etc.).
- Methods for producing at least one recombinant orthogonal aminoacyl-tRNA synthetase comprise: (a) generating a library of (optionally mutant) RSs derived from at least one aminoacyl-tRNA synthetase (RS) from a first organism, including but not limited to, a prokaryotic organism, such as Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, P. furiosus, P. horikoshii, A. pernix, T.
- a prokaryotic organism such as Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, P. furiosus, P. horikoshii, A. pernix, T.
- thermophilus or the like, or a eukaryotic organism; (b) selecting (and/or screening) the library of RSs (optionally mutant RSs) for members that aminoacylate an orthogonal tRNA (O-tRNA) in the presence of a non-naturally encoded amino acid and a natural amino acid, thereby providing a pool of active (optionally mutant) RSs; and/or, (c) selecting (optionally through negative selection) the pool for active RSs (including but not limited to, mutant RSs) that preferentially aminoacylate the O-tRNA in the absence of the non-naturally encoded amino acid, thereby providing the at least one recombinant O-RS; wherein the at least one recombinant O-RS preferentially aminoacylates the O-tRNA with the non-naturally encoded amino acid.
- O-tRNA orthogonal tRNA
- the RS is an inactive RS.
- the inactive RS can be generated by mutating an active RS.
- the inactive RS can be generated by mutating at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, or at least about 10 or more amino acids to different amino acids, including but not limited to, alanine.
- mutant RSs can be generated using various techniques known in the art, including but not limited to rational design based on protein three dimensional RS structure, or mutagenesis of RS nucleotides in a random or rational design technique.
- the mutant RSs can be generated by site-specific mutations, random mutations, diversity generating recombination mutations, chimeric constructs, rational design and by other methods described herein or known in the art.
- selecting (and/or screening) the library of RSs (optionally mutant RSs) for members that are active, including but not limited to, that aminoacylate an orthogonal tRNA (O-tRNA) in the presence of a non-naturally encoded amino acid and a natural amino acid includes: introducing a positive selection or screening marker, including but not limited to, an antibiotic resistance gene, or the like, and the library of (optionally mutant) RSs into a plurality of cells, wherein the positive selection and/or screening marker comprises at least one selector codon, including but not limited to, an amber, ochre, or opal codon; growing the plurality of cells in the presence of a selection agent; identifying cells that survive (or show a specific response) in the presence of the selection and/or screening agent by suppressing the at least one selector codon in the positive selection or screening marker, thereby providing a subset of positively selected cells that contains the pool of active (optionally mutant) RSs.
- the positive selection or screening marker including but not limited to
- the positive selection marker is a chloramphenicol acetyltransferase (CAT) gene and the selector codon is an amber stop codon in the CAT gene.
- the positive selection marker is a ⁇ -lactamase gene and the selector codon is an amber stop codon in the ⁇ -lactamase gene.
- the positive screening marker comprises a fluorescent or luminescent screening marker or an affinity based screening marker (including but not limited to, a cell surface marker).
- a negative selection or screening marker with the pool of active (optionally mutant) RSs from the positive selection or screening into a plurality of cells of a second organism, wherein the negative selection or screening marker comprises at least one selector codon (including but not limited to, an antibiotic resistance gene, including but not limited to, a chloramphenicol acetyltransferase (CAT) gene); and, identifying cells that survive or show a specific screening response in a first medium supplemented with the non-naturally encoded amino acid and a screening or selection agent, but fail to survive or to show the specific response in a second medium not supplemented with the non-naturally encoded amino acid and the selection or screening agent, thereby providing surviving cells or screened cells with the at least one recombinant O-RS.
- the negative selection or screening marker comprises at least one selector codon (including but not limited to, an antibiotic resistance gene, including but not limited to, a chloramphenicol acetyltransferase (CAT) gene)
- a CAT identification protocol optionally acts as a positive selection and/or a negative screening in determination of appropriate O-RS recombinants.
- a pool of clones is optionally replicated on growth plates containing CAT (which comprises at least one selector codon) either with or without one or more non-naturally encoded amino acid. Colonies growing exclusively on the plates containing non-naturally encoded amino acids are thus regarded as containing recombinant O-RS.
- the concentration of the selection (and/or screening) agent is varied.
- the first and second organisms are different.
- the first and/or second organism optionally comprises: a prokaryote, a eukaryote, a mammal, an Escherichia coli, a fungi, a yeast, an archaebacterium, a eubacterium, a plant, an insect, a protist, etc.
- the screening marker comprises a fluorescent or luminescent screening marker or an affinity based screening marker.
- screening or selecting (including but not limited to, negatively selecting) the pool for active (optionally mutant) RSs includes: isolating the pool of active mutant RSs from the positive selection step (b); introducing a negative selection or screening marker, wherein the negative selection or screening marker comprises at least one selector codon (including but not limited to, a toxic marker gene, including but not limited to, a ribonuclease barnase gene, comprising at least one selector codon), and the pool of active (optionally mutant) RSs into a plurality of cells of a second organism; and identifying cells that survive or show a specific screening response in a first medium not supplemented with the non-naturally encoded amino acid, but fail to survive or show a specific screening response in a second medium supplemented with the non-naturally encoded amino acid, thereby providing surviving or screened cells with the at least one recombinant O-RS, wherein the at least one recombinant O-RS is specific for
- the at least one selector codon comprises about two or more selector codons.
- Such embodiments optionally can include wherein the at least one selector codon comprises two or more selector codons, and wherein the first and second organism are different (including but not limited to, each organism is optionally, including but not limited to, a prokaryote, a eukaryote, a mammal, an Escherichia coli, a. fungi, a yeast, an archaebacteria, a eubacteria, a plant, an insect, a protist, etc.).
- the negative selection marker comprises a ribonuclease barnase gene (which comprises at least one selector codon).
- the screening marker optionally comprises a fluorescent or luminescent screening marker or an affinity based screening marker.
- the screenings and/or selections optionally include variation of the screening and/or selection stringency.
- the methods for producing at least one recombinant orthogonal aminoacyl-tR A synthetase can further comprise: (d) isolating the at least one recombinant O-RS; (e) generating a second set of O-RS (optionally mutated) derived from the at least one recombinant O-RS; and, (f) repeating steps (b) and (c) until a mutated O-RS is obtained that comprises an ability to preferentially aminoacylate the O-tRNA.
- steps (d)-(f) are repeated, including but not limited to, at least about two times.
- the second set of mutated O-RS derived from at least one recombinant O-RS can be generated by mutagenesis, including but not limited to, random mutagenesis, site-specific mutagenesis, recombination or a combination thereof.
- the stringency of the selection/screening steps optionally includes varying the selection/screening stringency.
- the positive selection/screening step (b), the negative selection/screening step (c) or both the positive and negative selection/screening steps (b) and (c) comprise using a reporter, wherein the reporter is detected by fluorescence-activated cell sorting (FACS) or wherein the reporter is detected by luminescence.
- FACS fluorescence-activated cell sorting
- the reporter is displayed on a cell surface, on a phage display or the like and selected based upon affinity or catalytic activity involving the non-naturally encoded amino acid or an analogue.
- the mutated synthetase is displayed on a cell surface, on a phage display or the like.
- Methods for producing a recombinant orthogonal tRNA include: (a) generating a library of mutant tRNAs derived from at least one tRNA, including but not limited to, a suppressor tRNA, from a first organism; (b) selecting (including but not limited to, negatively selecting) or screening the library for (optionally mutant) tRNAs that are aminoacylated by an aminoacyl-tRNA synthetase (RS) from a second organism in the absence of a RS from the first organism, thereby providing a pool of tRNAs (optionally mutant); and, (c) selecting or screening the pool of tRNAs (optionally mutant) for members that are aminoacylated by an introduced orthogonal RS (O-RS), thereby providing at least one recombinant O-tRNA; wherein the at least one recombinant O-tRNA recognizes a selector codon and is not efficiency recognized by the RS from the second organism and is prefer
- the at least one tRNA is a suppressor tRNA and/or comprises a unique three base codon of natural and/or unnatural bases, or is a nonsense codon, a rare codon, an unnatural codon, a codon comprising at least 4 bases, an amber codon, an ochre codon, or an opal stop codon.
- the recombinant O-tRNA possesses an improvement of orthogonality. It will be appreciated that in some embodiments, O-tRNA is optionally imported into a first organism from a second organism without the need for modification.
- the first and second organisms are either the same or different and are optionally chosen from, including but not limited to, prokaryotes (including but not limited to, Methanococcus jannaschii, Methanobacteium thermoautotrophicum, Escherichia coli, Halobacterium, etc.), eukaryotes, mammals, fungi, yeasts, archaebacteria, eubacteria, plants, insects, protists, etc.
- the recombinant tRNA is optionally aminoacylated by a non-naturally encoded amino acid, wherein the non-naturally encoded amino acid is biosynthesized in vivo either naturally or through genetic manipulation.
- the non-naturally encoded amino acid is optionally added to a growth medium for at least the first or second organism.
- selecting (including but not limited to, negatively selecting) or screening the library for (optionally mutant) tRNAs that are aminoacylated by an aminoacyl- tRNA synthetase includes: introducing a toxic marker gene, wherein the toxic marker gene comprises at least one of the selector codons (or a gene that leads to the production of a toxic or static agent or a gene essential to the organism wherein such marker gene comprises at least one selector codon) and the library of (optionally mutant) tRNAs into a plurality of cells from the second organism; and, selecting surviving cells, wherein the surviving cells contain the pool of (optionally mutant) tRNAs comprising at least one orthogonal tRNA or nonfunctional tRNA.
- surviving cells can be selected by using a comparison ratio cell density assay.
- the toxic marker gene can include two or more selector codons.
- the toxic marker gene is a ribonuclease barnase gene, where the ribonuclease barnase gene comprises at least one amber codon.
- the ribonuclease barnase gene can include two or more amber codons.
- selecting or screening the pool of (optionally mutant) tRNAs for members that are aminoacylated by an introduced orthogonal RS can include: introducing a positive selection or screening marker gene, wherein the positive marker gene comprises a drug resistance gene (including but not limited to, ⁇ -lactamase gene, comprising at least one of the selector codons, such as at least one amber stop codon) or a gene essential to the organism, or a gene that leads to detoxification of a toxic agent, along with the O-RS, and the pool of (optionally mutant) tRNAs into a plurality of cells from the second organism; and, identifying surviving or screened cells grown in the presence of a selection or screening agent, including but not limited to, an antibiotic, thereby providing a pool of cells possessing the at least one recombinant tRNA, where the at least one recombinant tRNA is aminoacylated by the O-RS and inserts an amino acid into a translation product
- a drug resistance gene including but not limited to,
- Methods for generating specific O-tRNA/O-RS pairs include: (a) generating a library of mutant tRNAs derived from at least one tRNA from a first organism; (b) negatively selecting or screening the library for (optionally mutant) tRNAs that are aminoacylated by an aminoacyl-tRNA synthetase (RS) from a second organism in the absence of a RS from the first organism, thereby providing a pool of (optionally mutant) tRNAs; (c) selecting or screening the pool of (optionally mutant) tRNAs for members that are aminoacylated by an introduced orthogonal RS (O-RS), thereby providing at least one recombinant O-tRNA.
- RS aminoacyl-tRNA synthetase
- the at least one recombinant O-tRNA recognizes a selector codon and is not efficiency recognized by the RS from the second organism and is preferentially aminoacylated by the O-RS.
- the method also includes (d) generating a library of (optionally mutant) RSs derived from at least one aminoacyl-tRNA synthetase (RS) from a third organism; (e) selecting or screening the library of mutant RSs for members that preferentially aminoacylate the at least one recombinant O-tRNA in the presence of a non-naturally encoded amino acid and a natural amino acid, thereby providing a pool of active (optionally mutant) RSs; and, (f) negatively selecting or screening the pool for active (optionally mutant) RSs that preferentially aminoacylate the at least one recombinant O-tRNA in the absence of the non-naturally encoded amino acid, thereby providing the at least one specific 0-tRNA/O- RS pair, wherein the at least one specific O
- the specific O-tRNA/O-RS pair can include, including but not limited to, a mutRNATyr-mutTyrRS pair, such as a mutRNATyr-SS 12TyrRS pair, a mutRNALeu- mutLeuRS pair, a mutRNAThr-mutThrRS pair, a mutRNAGlu-mutGluRS pair, or the like.
- a mutRNATyr-mutTyrRS pair such as a mutRNATyr-SS 12TyrRS pair, a mutRNALeu- mutLeuRS pair, a mutRNAThr-mutThrRS pair, a mutRNAGlu-mutGluRS pair, or the like.
- such methods include wherein the first and third organism are the same (including but not limited to, Methanococcus jannaschii).
- Methods for selecting an orthogonal tRNA-tRNA synthetase pair for use in an in vivo translation system of a second organism are also included in the present invention.
- the methods include: introducing a marker gene, a tRNA and an aminoacyl-tRNA synthetase (RS) isolated or derived from a first organism into a first set of cells from the second organism; introducing the marker gene and the tRNA into a duplicate cell set from a second organism; and, selecting for surviving cells in the first set that fail to survive in the duplicate cell set or screening for cells showing a specific screening response that fail to give such response in the duplicate cell set, wherein the first set and the duplicate cell set are grown in the presence, of a selection or screening agent, wherein the surviving or screened cells comprise the orthogonal tRNA-tRNA synthetase pair for use in the in the in vivo translation system of the second organism.
- comparing and selecting or screening includes an in vivo complementation assay
- the organisms of the present invention comprise a variety of organism and a variety of combinations.
- the first and the second organisms of the methods of the present invention can be the same or different.
- the organisms are optionally a prokaryotic organism, including but not limited to, Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, P. furiosus, P. horikoshii, A. pernix, T. thermophilus, or the like.
- the organisms optionally comprise a eukary otic organism, including but not limited to, plants (including but not limited to, complex plants such as monocots, or dicots), algae, protists, fungi (including but not limited to, yeast, etc), animals (including but not limited to, mammals, insects, arthropods, etc.), or the like.
- the second organism is a prokaryotic organism, including but not limited to, Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, Halobacterium, P. furiosus, P. horikoshii, A. pernix, T. thermophilics, or the like.
- the second organism can be a eukaryotic organism, including but not limited to, a yeast, a animal cell, a plant cell, a fungus, a mammalian cell, or the like.
- the first and second organisms are different.
- the present invention contemplates incorporation of one or more non- naturally-occurring amino acids into PSMC.
- One or more non-naturally-occurring amino acids may be incorporated at a particular position which does not disrupt activity of the polypeptide. This can be achieved by making "conservative" substitutions, including but not limited to, substituting hydrophobic amino acids with hydrophobic amino acids, bulky amino acids for bulky amino acids, hydrophilic amino acids for hydrophilic amino acids) and/or inserting the non-naturally-occurring amino acid in a location that is not required for activity.
- Selection of desired sites may be for producing a PSMC molecule having any desired property or activity, including but not limited to, agonists, super-agonists, inverse agonists, antagonists, receptor binding modulators, receptor activity modulators, dimer or multimer formation, no change to activity or property compared to the native molecule, or manipulating any physical or chemical property of the polypeptide such as solubility, aggregation, or stability.
- locations in the polypeptide required for biological activity of PSMC can be identified using alanine scanning or homolog scanning methods known in the art.
- Residues other than those identified as critical to biological activity by alanine or homolog scanning mutagenesis may be good candidates for substitution with a non-naturally encoded amino acid depending on the desired activity sought for the polypeptide.
- the sites identified as critical to biological activity may also be good candidates for substitution with a non-naturally encoded amino acid, again depending on the desired activity sought for the polypeptide.
- Another alternative would be to simply make serial substitutions in each position on the polypeptide chain with a non- naturally encoded amino acid and observe the effect on the activities of the polypeptide. It is readily apparent to those of ordinary skill in the art that any means, technique, or method for selecting a position for substitution with a non-natural amino acid into any polypeptide is suitable for use in the present invention.
- Exemplary residues of incorporation of a non-naturally encoded amino acid include, but are not limited to, those that are excluded from potential antigen binding regions, may be fully or partially solvent exposed, have minimal or no hydrogen-bonding interactions with nearby residues, may be minimally exposed to nearby reactive residues, may be on one or more of the exposed faces of PSMC, may be a site or sites of PSMC that are juxtaposed to a second PSMC, or other molecule or fragment thereof, may be in regions that are highly flexible, or structurally rigid, as predicted by the three-dimensional, secondary, tertiary, or quaternary structure of PSMC, bound or unbound to its antigen, or coupled or not coupled to another PSMC or other biologically active molecule, or may modulate the conformation of the PSMC itself or a dimer or multimer comprising one or more PSMC, by altering the flexibility or rigidity of the complete structure as desired.
- Residues for incorporation of non-natural amino acids may be a part of a cleavage sequence, linker sequence joining antibody fragments or PSMCs, antibody-binding domain (including but not limited to, myc tag, FLAG or poly-His) or other affinity based sequence (including but not limited to, FLAG, poly-His, GST, etc.).
- Residues for incorporation of a non-natural amino acid may be N-terminal or C- terminal residues of a PSMC or non-antigen binding residues of a PSMC.
- non-naturally encoded amino acids can be substituted for, or incorporated into, a given position in PSMC.
- a particular non-naturally encoded amino acid is selected for incorporation based on an examination of the three dimensional crystal structure of PSMC with its antigen or the secondary, tertiary, or quartemary structure of PSMC determined by any other means, a preference for conservative substitutions (i.e., aryl-based non-naturally encoded amino acids, such as p-acetylphenylalanine or O- propargyltyrosine substituting for Phe, Tyr or Trp), and the specific conjugation chemistry that one desires to introduce into the antigen-binding polypeptide (e.g., the introduction of 4- azidophenylalanine if one wants to effect a Huisgen [3+2] cycloaddition with a water soluble polymer bearing an alkyne moiety or a amide bond formation with a water soluble poly
- the method further includes incorporating into the protein the unnatural amino acid, where the unnatural amino acid comprises a first reactive group; and contacting the protein with a molecule (including but not limited to, a label, a dye, a polymer, a water-soluble polymer, a derivative of polyethylene glycol, a photocrosslinker, a radionuclide, a cytotoxic compound, a drug, an affinity label, a photoaffinity label, a reactive compound, a resin, a second protein or polypeptide or polypeptide analog, an antibody or antibody fragment, a metal chelator, a cofactor, a fatty acid, a carbohydrate, a polynucleotide, a DNA, a RNA, an antisense polynucleotide, a water-soluble dendrimer, a cyclodextrin, an inhibitory ribonucleic acid, a biomaterial, a nanoparticle, a spin label, a fluoride, a molecule (
- the first reactive group reacts with the second reactive group to attach the molecule to the unnatural amino acid through a [3+2] cycloaddition.
- the first reactive group is an alkynyl or azido moiety and the second reactive group is an azido or alkynyl moiety.
- the first reactive group is the alkynyl moiety (including but not limited to, in unnatural amino acid p- propargyloxyphenylalanine) and the second reactive group is the azido moiety.
- the first reactive group is the azido moiety (including but not limited to, in the unnatural amino acid p-azido-L-phenylalanine) and the second reactive group is the alkynyl moiety.
- the non-naturally encoded amino acid substitution(s) will be combined with other additions, substitutions or deletions within the antigen-binding polypeptide to affect other biological traits of PSMC.
- the other additions, substitutions or deletions may increase the stability (including but not limited to, resistance to proteolytic degradation) of the PSMC or increase affinity of the PSMC for a PSMC receptor or antigen.
- the other additions, substitutions or deletions may increase the solubility (including but not limited to, when expressed in E. coli or other host cells) of the antigen-binding polypeptide.
- substitutions or deletions may increase the polypeptide solubility following expression in coli or other recombinant host cells.
- sites are selected for substitution with a naturally encoded or non-natural amino acid in addition to another site for incorporation of a non-natural amino acid that results in increasing the polypeptide solubility following expression in E. coli or other recombinant host cells.
- the antigen-binding polypeptides comprise another addition, substitution or deletion that modulates affinity for the PSMC receptor, modulates (including but not limited to, increases or decreases) receptor dimerization, stabilizes receptor dimers, modulates circulating half-life, modulates release or bio-availability, facilitates purification, or improves or alters a particular route of administration.
- antigen-binding polypeptides can comprise chemical or enzyme cleavage sequences, protease cleavage sequences, reactive groups, antibody-binding domains (including but not limited to, FLAG or poly-His) or other affinity based sequences (including, but not limited to, FLAG, poly-His, GST, etc.) or linked molecules (including, but not limited to, biotin) that improve detection (including, but not limited to, GFP), purification, transport through tissues or cell membranes, prodrug release or activation, PSMC size reduction, or other traits of the polypeptide.
- antibody-binding domains including but not limited to, FLAG or poly-His
- affinity based sequences including, but not limited to, FLAG, poly-His, GST, etc.
- linked molecules including, but not limited to, biotin
- 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acids are substituted with one or more non-naturally-encoded amino acids.
- the PSMC further includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more substitutions of one or more non-naturally encoded amino acids for naturally-occurring amino acids.
- at least two residues in the following regions of PSMC are substituted with one or more non-naturally encoded amino acids.
- the two or more non-naturally encoded residues are linked to one or more lower molecular weight linear or branched PEGs (approximately ⁇ 5- 20 kDa in mass or less), thereby enhancing binding affinity and comparable serum half-life relative to the species attached to a single, higher molecular weight PEG.
- up to two of the residues of an antigen-binding polypeptide are substituted with one or more non-naturally-encoded amino acids.
- Suitable bacterial promoters are well known in the art and described, e.g., in Sambrook et al. and Ausubel et al.
- Bacterial expression systems for expressing PSMC polypeptides of the invention are available in, including but not limited to, E. coli, Bacillus sp., Pseudomonas fluorescens, Pseudomonas aeruginosa, Pseudomonas putida, and Salmonella (Palva et al., Gene 22:229-235 (1983); Mosbach et al, Nature 302:543-545 (1983)). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available.
- host cells for expression are selected based on their ability to use the orthogonal components.
- Exemplary host cells include Gram-positive bacteria (including but not limited to B. brevis, B. subtilis, or Streptomyces) and Gram-negative bacteria E. coli, Pseudomonas fluorescens, Pseudomonas aeruginosa, Pseudomonas putida), as well as yeast and other eukaryotic cells.
- Cells comprising O-tR A/O-RS pairs can be used as described herein.
- a eukaryotic host cell or non-eukaryotic host cell of the present invention provides the ability to synthesize proteins that comprise unnatural amino acids in large useful quantities.
- the composition optionally includes, including but not limited to, at least 10 micrograms, at least 50 micrograms, at least 75 micrograms, at least 100 micrograms, at least 200 micrograms, at least 250 micrograms, at least 500 micrograms, at least 1 milligram, at least 10 milligrams, at least 100 milligrams, at least one gram, or more of the protein that comprises an unnatural amino acid, or an amount that can be achieved with in vivo protein production methods (details on recombinant protein production and purification are provided herein).
- the protein is optionally present in the composition at a concentration of, including but not limited to, at least 10 micrograms of protein per liter, at least 50 micrograms of protein per liter, at least 75 micrograms of protein per liter, at least 100 micrograms of protein per liter, at least 200 micrograms of protein per liter, at least 250 micrograms of protein per liter, at least 500 micrograms of protein per liter, at least 1 milligram of protein per liter, or at least 10 milligrams of protein per liter or more, in, including but not limited to, a cell lysate, a buffer, a pharmaceutical buffer, or other liquid suspension (including but not limited to, in a volume of, including but not limited to, anywhere from about 1 nl to about 100 L).
- the production of large quantities (including but not limited to, greater that that typically possible with other methods, including but not limited to, in vitro translation) of a protein in a eukaryotic cell including at least one unnatural amino acid is a feature of
- a eukaryotic host cell or non-eukaryotic host cell of the present invention provides the ability to biosynthesize proteins that comprise unnatural amino acids in large useful quantities.
- proteins comprising an unnatural amino acid can be produced at a concentration of, including but not limited to, at least 10 ⁇ g/liter, at least 50 ⁇ g/liter, at least 75 ⁇ g/liter, at least 100 ⁇ g/liter, at least 200 ⁇ g/liter, at least 250 ⁇ g/liter, or at least 500 ⁇ g/liter, at least lmg/liter, at least 2mg/liter, at least 3 mg/liter, at least 4 mg/liter, at least 5 mg/liter, at least 6 mg/liter, at least 7 mg/liter, at least 8 mg/liter, at least 9 mg/liter, at least 10 mg/liter, at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900 mg/liter, 1 g/liter,
- PSMC may be expressed in any number of suitable expression systems including, for example, yeast, insect cells, mammalian cells, and bacteria. A description of exemplary expression systems is provided below.
- yeast includes any of the various yeasts capable of expressing a gene encoding PSMC. Such yeasts include, but are not limited to, ascosporogenous yeasts ⁇ Endomycetales), basidiosporogenous yeasts and yeasts belonging to the Fungi imperfecti ⁇ Blastomycetes) group. The ascosporogenous yeasts are divided into two families, Spermophthoraceae and Saccharomycetaceae.
- the latter is comprised of four subfamilies, Schizosaccharomycoideae (e.g., genus Schizosaccharomyces), Nadsonioideae, Lipomycoideae and Saccharomycoideae (e.g., genera Pichia, Kluyveromyces and Saccharomyces).
- the basidiosporogenous yeasts include the genera Leucosporidium, Rhodosporidium, Sporidiobolus, Filobasidium, and Filobasidiella.
- Yeasts belonging to the Fungi Imperfecti ⁇ Blastomycetes) group are divided into two families, Sporobolomycetaceae (e.g., genera Sporobolomyces and Bullera) and Cryptococcaceae (e.g., genus Candida).
- Sporobolomycetaceae e.g., genera Sporobolomyces and Bullera
- Cryptococcaceae e.g., genus Candida
- Candida Of particular interest for use with the present invention are species within the genera Pichia, Kluyveromyces, Saccharomyces, Schizosaccharomyces, Hansenula, Torulopsis, and Candida, including, but not limited to, P. pastoris, P. guillerimondii, S. cerevisiae, S. carlsbergensis, S. diastaticus, S. douglasii, S. kluyveri, S, norbensis, S. oviformis, K. lactis
- suitable yeast for expression of PSMC is within the skill of one of ordinary skill in the art.
- suitable hosts may include those shown to have, for example, good secretion capacity, low proteolytic activity, good secretion capacity, good soluble protein production, and overall robustness.
- Yeast are generally available from a variety of sources including, but not limited to, the Yeast Genetic Stock Center, Department of Biophysics and Medical Physics, University of California (Berkeley, CA), and the American Type Culture Collection (“ATCC”) (Manassas, VA).
- yeast host or "yeast host cell” includes yeast that can be, or has been, used as a recipient for recombinant vectors or other transfer DNA.
- the term includes the progeny of the original yeast host cell that has received the recombinant vectors or other transfer DNA. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement to the original parent, due to accidental or deliberate mutation. Progeny of the parental cell that are sufficiently similar to the parent to be characterized by the relevant property, such as the presence of a nucleotide sequence encoding PSMC, are included in the progeny intended by this definition.
- Expression and transformation vectors including extrachromosomal replicons or integrating vectors, have been developed for transformation into many yeast hosts.
- expression vectors have been developed for S. cerevisiae (Sikorski et al., GENETICS (1998) 1 12: 19; Ito et al., J. BACTERIOL. (1983) 153 : 163; Hinnen et al., PROC. NATL. ACAD. SCI. USA (1978) 75: 1929); C. albicans (Kurtz et al., MOL. CELL. BIOL. (1986) 6: 142); C. maltosa (Kunze et al., J. BASIC MICROBIOL.
- P. pastoris U.S. Patent Nos. 5,324,639; 4,929,555; and 4,837,148; Cregg et al., MOL. CELL. BIOL. (1985) 5:3376); Schizosaccharomyces pombe (Beach and Nurse, NATURE (1981) 300:706); and Y. lipolytica (Davidow et al., CURR. GENET. (1985) 10:380 (1985); Gaillardin et al., CURR. GENET. (1985) 10:49); A. nidulans (Ballance et al., BiOCHEM. BiOPHYS. RES. COMMUN.
- Control sequences for yeast vectors are well known to those of ordinary skill in the art and include, but are not limited to, promoter regions from genes such as alcohol dehydrogenase (ADH) (EP 0 284 044); enolase; glucokinase; glucose-6-phosphate isomerase; glyceraldehydes-3-phosphate-dehydrogenase (GAP or GAPDH); hexokinase; phosphofructokinase; 3-phosphoglycerate mutase; and pyruvate kinase (PyK) (EP 0 329 203).
- ADH alcohol dehydrogenase
- GAP glyceraldehydes-3-phosphate-dehydrogenase
- hexokinase phosphofructokinase
- 3-phosphoglycerate mutase 3-phosphoglycerate mutase
- pyruvate kinase PyK
- the yeast PH05 gene encoding acid phosphatase, also may provide useful promoter sequences (Myanohara et al., PROC. NATL. ACAD. SCI. USA (1983) 80: 1).
- Other suitable promoter sequences for use with yeast hosts may include the promoters for 3- phosphoglycerate kinase (Hitzeman et al., J. BIOL. CHEM. (1980) 255:2073); and other glycolytic enzymes, such as pyruvate decarboxylase, triosephosphate isomerase, and phosphoglucose isomerase (Holland et al., BIOCHEMISTRY (1978) 17:4900; Hess et al., J. ADV.
- Inducible yeast promoters having the additional advantage of transcription controlled by growth conditions may include the promoter regions for alcohol dehydrogenase 2; isocytochrome C; acid phosphatase; metallothionein; glyceraldehyde-3 -phosphate dehydrogenase; degradative enzymes associated with nitrogen metabolism; and enzymes responsible for maltose and galactose utilization. Suitable vectors and promoters for use in yeast expression are further described in EP 0 073 657.
- Yeast enhancers also may be used with yeast promoters.
- synthetic promoters may also function as yeast promoters.
- the upstream activating sequences (UAS) of a yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter.
- hybrid promoters include the ADH regulatory sequence linked to the GAP transcription activation region. See U.S. Patent Nos. 4,880,734 and 4,876,197, which are incorporated by reference herein.
- Other examples of hybrid promoters include promoters that consist of the regulatory sequences of the ADH2, GAL4, GAL 10, or PH05 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such as GAP or PyK. See EP 0 164 556.
- a yeast promoter may include naturally occurring promoters of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription.
- yeast expression vectors include terminators, for example, from GAPDH or the enolase genes (Holland et al, J. BIOL. CHE . (1981) 256: 1385).
- the origin of replication from the 2 ⁇ plasmid origin is suitable for yeast.
- a suitable selection gene for use in yeast is the trpl gene present in the yeast plasmid. See Tschemper et al., GENE (1980) 10: 157; Kingsman et al., GENE (1979) 7: 141.
- the trpl gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan.
- Leu2-deficient yeast strains (ATCC 20,622 or 38,626) are complemented by known plasmids bearing the Leu2 gene.
- Methods of introducing exogenous DNA into yeast hosts are well known to those of ordinary skill in the art, and typically include, but are not limited to, either the transformation of spheroplasts or of intact yeast host cells treated with alkali cations.
- transformation of yeast can be carried out according to the method described in Hsiao et al., PROC. NATL. ACAD. SCI. USA (1979) 76:3829 and Van Solingen et al., J. BACT. (1977) 130:946.
- other methods for introducing DNA into cells such as by nuclear injection, electroporation, or protoplast fusion may also be used as described generally in SAMBROO ET AL., MOLECULAR CLONING: A LAB. MANUAL (2001).
- Yeast host cells may then be cultured using standard techniques known to those of ordinary skill in the art.
- the yeast host strains may be grown in fermentors during the amplification stage using standard feed batch fermentation methods well known to those of ordinary skill in the art.
- the fermentation methods may be adapted to account for differences in a particular yeast host's carbon utilization pathway or mode of expression control.
- fermentation of a Saccharomyces yeast host may require a single glucose feed, complex nitrogen source (e.g., casein hydrolysates), and multiple vitamin supplementation.
- the methylotrophic yeast P. pastoris may require glycerol, methanol, and trace mineral feeds, but only simple ammonium (nitrogen) salts for optimal growth and expression. See, e.g., U.S. Patent No. 5,324,639; Elliott et al., J. PROTEIN CHE . (1990) 9:95; and Fieschko et al., BIOTECH. BIOENG. (1987) 29: 1 1 13, incorporated by reference herein.
- Such fermentation methods may have certain common features independent of the yeast host strain employed.
- a growth limiting nutrient typically carbon
- fermentation methods generally employ a fermentation medium designed to contain adequate amounts of carbon, nitrogen, basal salts, phosphorus, and other minor nutrients (vitamins, trace minerals and salts, etc.). Examples of fermentation media suitable for use with Pichia are described in U.S. Patent Nos. 5,324,639 and 5,231 ,178, which are incorporated by reference herein.
- insect host or "insect host cell” refers to a insect that can be, or has been, used as a recipient for recombinant vectors or other transfer DNA.
- the term includes the progeny of the original insect host cell that has been transfected. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement to the original parent, due to accidental or deliberate mutation. Progeny of the parental cell that are sufficiently similar to the parent to be characterized by the relevant property, such as the presence of a nucleotide sequence encoding PSMC, are included in the progeny intended by this definition.
- suitable insect cells for expression of PSMC is well known to those of ordinary skill in the art.
- Several insect species are well described in the art and are commercially available including Aedes aegypti, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni.
- suitable hosts may include those shown to have, inter alia, good secretion capacity, low proteolytic activity, and overall robustness.
- Insect are generally available from a variety of sources including, but not limited to, the Insect Genetic Stock Center, Department of Biophysics and Medical Physics, University of California (Berkeley, CA); and the American Type Culture Collection (“ATCC”) (Manassas, VA).
- ATCC American Type Culture Collection
- the components of a baculovirus-infected insect expression system include a transfer vector, usually a bacterial plasmid, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene to be expressed; a wild type baculovirus with sequences homologous to the baculovirus-specific fragment in the transfer vector (this allows for the homologous recombination of the heterologous gene in to the baculovirus genome); and appropriate insect host cells and growth media.
- the materials, methods and techniques used in constructing vectors, transfecting cells, picking plaques, growing cells in culture, and the like are known in the art and manuals are available describing these techniques.
- the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome recombine.
- the packaged recombinant virus is expressed and recombinant plaques are identified and purified.
- Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, for example, Invitrogen Corp. (Carlsbad, CA). These techniques are generally known to those skilled in the art and fully described in SUMMERS AND SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN No. 1555 (1987), herein incorporated by reference.
- Vectors that are useful in baculovirus/insect cell expression systems include, for example, insect expression and transfer vectors derived from the baculovirus Autographacalifornica nuclear polyhedrosis virus (AcNPV), which is a helper-independent, viral expression vector.
- AcNPV Autographacalifornica nuclear polyhedrosis virus
- Viral expression vectors derived from this system usually use the strong viral polyhedrin gene promoter to drive expression of heterologous genes. See generally, Reilly ET AL., BACULOVIRUS EXPRESSION VECTORS: A LABORATORY MANUAL (1992).
- the above- described components comprising a promoter, leader (if desired), coding sequence of interest, and transcription termination sequence, are typically assembled into an intermediate transplacement construct (transfer vector).
- Intermediate transplacement constructs are often maintained in a replicon, such as an extra chromosomal element (e.g., plasmids) capable of stable maintenance in a host, such as bacteria.
- the replicon will have a replication system, thus allowing it to be maintained in a suitable host for cloning and amplification.
- the plasmid may contain the polyhedrin polyadenylation signal (Miller et al., ANN. REV. MICROBIOL. (1988) 42: 177) and a prokaryotic ampicillin-resistance ⁇ amp) gene and origin of replication for selection and propagation in E. coli.
- One commonly used transfer vector for introducing foreign genes into AcNPV is pAc373.
- Many other vectors known to those of skill in the art, have also been designed including, for example, pVL985, which alters the polyhedrin start codon from ATG to ATT, and which introduces a BamHI cloning site 32 base pairs downstream from the ATT. See Luckow and Summers, 17 VIROLOGY 31 (1989).
- Other commercially available vectors include, for example, PBlueBac4.5/V5-His; pBlueBacHis2; pMelBac; pBlueBac4.5 (Invitrogen Corp., Carlsbad, CA).
- the transfer vector and wild type baculoviral genome are co-transfected into an insect cell host.
- Methods for introducing heterologous DNA into the desired site in the baculovirus virus are known in the art. See SUMMERS AND SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN NO. 1555 (1987); Smith et al., MOL. CELL. BIOL. (1983) 3:2156; Luckow and Summers, VIROLOGY (1989) 17:31.
- the insertion can be into a gene such as the polyhedrin gene, by homologous double crossover recombination; insertion can also be into a restriction enzyme site engineered into the desired baculovirus gene.
- Transfection may be accomplished by electroporation. See TROTTER AND WOOD, 39 METHODS IN MOLECULAR BIOLOGY (1995); Mann and King, J. GEN. VIROL. (1989) 70:3501.
- liposomes may be used to transfect the insect cells with the recombinant expression vector and the baculovirus.
- Baculovirus expression vectors usually contain a baculovirus promoter.
- a baculovirus promoter is any DNA sequence capable of binding a baculovirus R A polymerase and initiating the downstream (3') transcription of a coding sequence (e.g., structural gene) into mRNA.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region typically includes an RNA polymerase binding site and a transcription initiation site.
- a baculovirus promoter may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene. Moreover, expression may be either regulated or constitutive.
- Structural genes abundantly transcribed at late times in the infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein (FRIESEN ET AL., The Regulation of Baculovirus Gene Expression in THE MOLECULAR BIOLOGY OF BACULOVIRUSES (1986); EP 0 127 839 and 0 155 476) and the gene encoding the plO protein (Vlak et al., J. GEN. VIROL. (1988) 69:765).
- the newly formed baculovirus expression vector is packaged into an infectious recombinant baculovirus and subsequently grown plaques may be purified by techniques known to those skilled in the art. See Miller et al., BiOESSAYS (1989) 4:91 ; SUMMERS AND SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN NO. 1555 (1987).
- Recombinant baculovirus expression vectors have been developed for infection into several insect cells.
- recombinant baculoviruses have been developed for, inter alia, Aedes aegypti (ATCC No. CCL-125), Bombyx mori (ATCC No. CRL-8910), Drosophila melanogaster (ATCC No. 1963), Spodoptera frugiperda, and Trichoplusia ni.
- Aedes aegypti ATCC No. CCL-125
- Bombyx mori ATCC No. CRL-8910
- Drosophila melanogaster ATCC No. 1963
- Spodoptera frugiperda Spodoptera frugiperda
- Trichoplusia ni See WO 89/046,699; Wright, NATURE (1986) 321 :718; Carbonell et al., J. VIROL. (1985) 56: 153; Smith et al., MoL
- the cell lines used for baculovirus expression vector systems commonly include, but are not limited to, Sf9 ⁇ Spodoptera frugiperda) (ATCC No. CRL-171 1 ), Sf21 ⁇ Spodoptera frugiperda) (Invitrogen Corp., Cat. No. 1 1497-013 (Carlsbad, CA)), Tri-368 ⁇ Trichopulsia ni), and High-FiveTM BTI- TN-5B 1 -4 ⁇ Trichopulsia ni).
- Cells and culture media are commercially available for both direct and fusion expression of heterologous polypeptides in a baculovirus/expression, and cell culture technology is generally known to those skilled in the art.
- E. Coli E. Coli, Pseudomonas species, and other Prokaryotes Bacterial expression techniques are well known in the art.
- a wide variety of vectors are available for use in bacterial hosts.
- the vectors may be single copy or low or high multicopy vectors.
- Vectors may serve for cloning and/or expression.
- the vectors normally involve markers allowing for selection, which markers may provide for cytotoxic agent resistance, prototrophy or immunity. Frequently, a plurality of markers is present, which provide for different characteristics.
- a bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3') transcription of a coding sequence (e.g. structural gene) into mRNA.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region typically includes an RNA polymerase binding site and a transcription initiation site.
- a bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) transcription, as a gene repressor protein may bind the operator and thereby inhibit transcription of a specific gene.
- Constitutive expression may occur in the absence of negative regulatory elements, such as the operator.
- positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5') to the RNA polymerase binding sequence.
- An example of a gene activator protein is the catabolite activator protein (CAP), which helps initiate transcription of the lac operon in Escherichia coli (E. coli) [Raibaud et al., ANNU. REV. GENET. (1984) 18: 173].
- Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
- Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac) [Chang et al., NATURE (1977) 198: 1056], and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al., Nuc. ACIDS RES. (1980) 8:4057; Yelverton et al., NUCL. ACIDS RES. (1981) 9:731 ; U.S. Pat. No. 4,738,921 ; EP Pub. Nos.
- Such vectors are well known in the art and include the pET29 series from Novagen, and the pPOP vectors described in WO99/05297, which is incorporated by reference herein. Such expression systems produce high levels of PSMC in the host without compromising host cell viability or growth parameters.
- pET19 Novagen is another vector known in the art.
- synthetic promoters which do not occur in nature also function as bacterial promoters.
- transcription activation sequences of one bacterial or bacteriophage promoter may be joined with the operon sequences of another bacterial or bacteriophage promoter, creating a synthetic hybrid promoter [U.S. Pat. No. 4,551 ,433, which is incorporated by reference herein].
- the tac promoter is a hybrid trp-lac promoter comprised of both tip promoter and lac operon sequences that is regulated by the lac repressor [Amann et al., GENE (1983) 25: 167; de Boer et al., PROC. NATL. ACAD. SCI. (1983) 80:21].
- a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription.
- a naturally occurring promoter of non-bacterial origin can also be coupled with a compatible RNA polymerase to produce high levels of expression of some genes in prokaryotes.
- the bacteriophage T7 RNA polymerase/promoter system is an example of a coupled promoter system [Studier et al., J. MOL. BIOL. (1986) 189: 1 13; Tabor et al., Proc Natl. Acad. Sci. (1985) 82: 1074].
- a hybrid promoter can also be comprised of a bacteriophage promoter and an E. coli operator region (EP Pub. No. 267 851).
- an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes.
- the ribosome binding site is called the Shine-Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-1 1 nucleotides upstream of the initiation codon [Shine et al., NATURE (1975) 254:34].
- SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD sequence and the 3' and of E. coli 16S rRNA [Steitz et al.
- bacterial host or "bacterial host cell” refers to a bacterial that can be, or has been, used as a recipient for recombinant vectors or other transfer DNA.
- the term includes the progeny of the original bacterial host cell that has been transfected. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement to the original parent, due to accidental or deliberate mutation. Progeny of the parental cell that are sufficiently similar to the parent to be characterized by the relevant property, such as the presence of a nucleotide sequence encoding PSMC, are included in the progeny intended by this definition.
- suitable host bacteria for expression of PSMC is well known to those of ordinary skill in the art.
- suitable hosts may include those shown to have, inter alia, good inclusion body formation capacity, low proteolytic activity, and overall robustness.
- Bacterial hosts are generally available from a variety of sources including, but not limited to, the Bacterial Genetic Stock Center, Department of Biophysics and Medical Physics, University of California (Berkeley, CA); and the American Type Culture Collection ("ATCC”) (Manassas, VA).
- Industrial/pharmaceutical fermentation generally use bacterial derived from K strains (e.g. W31 10) or from bacteria derived from B strains (e.g. BL21).
- the E. coli host is a strain of BL21.
- the E. coli host is a protease minus strain including, but not limited to, OMP- and LON-.
- the host cell strain is a species of Pseudomonas, including but not limited to, Pseudomonas fluorescens, Pseudomonas aeruginosa, and Pseudomonas putida.
- Pseudomonas fluorescens biovar 1 designated strain MB101
- strain MB101 An example of a Pseudomonas expression system includes the system available from The Dow Chemical Company as a host strain (Midland, MI available on the World Wide Web at dow.com).
- U.S. Patent Nos. 4,755,465 and 4,859,600 which are incorporated by reference herein, describes the use of Pseudomonas strains as a host cell for human growth hormone production.
- the recombinant host cell strain is cultured under conditions appropriate for production of PSMC.
- the method of culture of the recombinant host cell strain will be dependent on the nature of the expression construct utilized and the identity of the host cell.
- Recombinant host strains are normally cultured using methods that are well known to the art.
- Recombinant host cells are typically cultured in liquid medium containing assimilatable sources of carbon, nitrogen, and inorganic salts and, optionally, containing vitamins, amino acids, growth factors, and other proteinaceous culture supplements well known to the art.
- Liquid media for culture of host cells may optionally contain antibiotics or anti-fungals to prevent the growth of undesirable microorganisms and/or compounds including, but not limited to, antibiotics to select for host cells containing the expression vector.
- Recombinant host cells may be cultured in batch or continuous formats, with either cell harvesting (in the case where the PSMC accumulates intracellularly) or harvesting of culture supernatant in either batch or continuous formats.
- cell harvesting in the case where the PSMC accumulates intracellularly
- harvesting of culture supernatant in either batch or continuous formats For production in prokaryotic host cells, batch culture and cell harvest are preferred.
- the antigen-binding polypeptides of the present invention are normally purified after expression in recombinant systems.
- the PSMC may be purified from host cells by a variety of methods known to the art. Normally, PSMC produced in bacterial host cells is poorly soluble or insoluble (in the form of inclusion bodies).
- amino acid substitutions may readily be made in the antigen-binding polypeptide that are selected for the purpose of increasing the solubility of the recombinantly produced protein utilizing the methods disclosed herein as well as those known in the art.
- the protein may be collected from host cell lysates by centrifugation and may further be followed by homogenization of the cells.
- soluble protein compounds including, but not limited to, polyethylene imine (PEI) may be added to induce the precipitation of partially soluble protein.
- the precipitated protein may then be conveniently collected by centrifugation.
- Recombinant host cells may be disrupted or homogenized to release the inclusion bodies from within the cells using a variety of methods well known to those of ordinary skill in the art. Host cell disruption or homogenization may be performed using well known techniques including, but not limited to, enzymatic cell disruption, sonication, dounce homogenization, or high pressure release disruption. In one embodiment of the method of the present invention, the high pressure release technique is used to disrupt the E. coli host cells to release the inclusion bodies of PSMC. When handling inclusion bodies of PSMC, it is advantageous to minimize the homogenization time on repetitions in order to maximize the yield of inclusion bodies without loss due to factors such as solubilization, mechanical shearing or proteolysis.
- PSMC insoluble or precipitated PSMC may then be solubilized using any of a number of suitable solubilization agents known to the art.
- PSMC is solubilized with urea or guanidine hydrochloride.
- the volume of the solubilized PSMC should be minimized so that large batches may be produced using conveniently manageable batch sizes. This factor may be significant in a large-scale commercial setting where the recombinant host may be grown in batches that are thousands of liters in volume.
- the avoidance of harsh chemicals that can damage the machinery and container, or the protein product itself should be avoided, if possible.
- the milder denaturing agent urea can be used to solubilize the PSMC inclusion bodies in place of the harsher denaturing agent guanidine hydrochloride.
- the use of urea significantly reduces the risk of damage to stainless steel equipment utilized in the manufacturing and purification process of PSMC while efficiently solubilizing the PSMC inclusion bodies.
- PSMC may be secreted into the periplasmic space or into the culture medium.
- soluble PSMC may be present in the cytoplasm of the host cells. It may be desired to concentrate soluble PSMC prior to performing purification steps. Standard techniques known to those skilled in the art may be used to concentrate soluble PSMC from, for example, cell lysates or culture medium. In addition, standard techniques known to those skilled in the art may be used to disrupt host cells and release soluble PSMC from the cytoplasm or periplasmic space of the host cells.
- the fusion sequence is preferably removed. Removal of a fusion sequence may be accomplished by enzymatic or chemical cleavage, preferably by enzymatic cleavage. Enzymatic removal of fusion sequences may be accomplished using methods well known to those in the art. The choice of enzyme for removal of the fusion sequence will be determined by the identity of the fusion, and the reaction conditions will be specified by the choice of enzyme as will be apparent to one skilled in the art.
- the cleaved PSMC is preferably purified from the cleaved fusion sequence by well known methods. Such methods will be determined by the identity and properties of the fusion sequence and the PSMC, as will be apparent to one skilled in the art. Methods for purification may include, but are not limited to, size-exclusion chromatography, hydrophobic interaction chromatography, ion-exchange chromatography or dialysis or any combination thereof.
- the PSMC is also preferably purified to remove DNA from the protein solution.
- DNA may be removed by any suitable method known to the art, such as precipitation or ion exchange chromatography, but is preferably removed by precipitation with a nucleic acid precipitating agent, such as, but not limited to, protamine sulfate.
- PSMC may be separated from the precipitated DNA using standard well known methods including, but not limited to, centrifugation or filtration. Removal of host nucleic acid molecules is an important factor in a setting where the PSMC is to be used to treat humans and the methods of the present invention reduce host cell DNA to pharmaceutically acceptable levels.
- Methods for small-scale or large-scale fermentation can also be used in protein expression, including but not limited to, fermentors, shake flasks, fluidized bed bioreactors, hollow fiber bioreactors, roller bottle culture systems, and stirred tank bioreactor systems. Each of these methods can be performed in a batch, fed-batch, or continuous mode process.
- Huma PSMC of the invention can generally be recovered using methods standard in the art. For example, culture medium or cell lysate can be centrifuged or filtered to remove cellular debris. The supernatant may be concentrated or diluted to a desired volume or diafiltered into a suitable buffer to condition the preparation for further purification. Further purification of the PSMC of the present invention include separating deamidated and clipped forms of the PSMC variant from the intact form.
- any of the following exemplary procedures can be employed for purification of antigen-binding polypeptides of the invention: affinity chromatography; anion- or cation- exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse phase HPLC; gel filtration (using, including but not limited to, SEPHADEX G-75); hydrophobic interaction chromatography; size-exclusion chromatography, metal-chelate chromatography; ultrafiltration/diafiltration; ethanol precipitation; ammonium sulfate precipitation; chromatofocusing; displacement chromatography; electrophoretic procedures (including but not limited to preparative isoelectric focusing), differential solubility (including but not limited to ammonium sulfate precipitation), SDS-PAGE, or extraction.
- affinity chromatography anion- or cation- exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse phase HPLC; gel filtration (using, including but
- Proteins of the present invention including but not limited to, proteins comprising unnatural amino acids, antibodies to proteins comprising unnatural amino acids, binding partners for proteins comprising unnatural amino acids, etc., can be purified, either partially or substantially to homogeneity, according to standard procedures known to and used by those of skill in the art.
- polypeptides of the invention can be recovered and purified by any of a number of methods well known in the art, including but not limited to, ammonium sulfate or ethanol precipitation, acid or base extraction, column chromatography, affinity column chromatography, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography, lectin chromatography, gel electrophoresis and the like. Protein refolding steps can be used, as desired, in making correctly folded mature proteins. High performance liquid chromatography (HPLC), affinity chromatography or other suitable methods can be employed in final purification steps where high purity is desired.
- HPLC high performance liquid chromatography
- affinity chromatography affinity chromatography or other suitable methods can be employed in final purification steps where high purity is desired.
- antibodies made against unnatural amino acids are used as purification reagents, including but not limited to, for affinity-based purification of proteins comprising one or more unnatural amino acid(s).
- the polypeptides are optionally used for a wide variety of utilities, including but not limited to, as assay components, therapeutics, prophylaxis, diagnostics, research reagents, and/or as immunogens for antibody production.
- One advantage of producing a protein or polypeptide of interest with an unnatural amino acid in a eukaryotic host cell or non-eukaryotic host cell is that typically the proteins or polypeptides will be folded in their native conformations.
- proteins can possess a conformation different from the desired conformations of the relevant polypeptides.
- the expressed protein is optionally denatured and then renatured.
- guanidine, urea, DTT, DTE, and/or a chaperonin can be added to a translation product of interest.
- Methods of reducing, denaturing and renaturing proteins are well known to those of skill in the art (see, the references above, and Debinski, et al. (1993) J. Biol. Chem.. 268: 14065-14070; reitman and Pastan (1993) Bioconiug. Chem., 4: 581-585; and Buchner, et al., (1992) Anal. Biochem..
- Debinski, et al. describe the denaturation and reduction of inclusion body proteins in guanidine-DTE.
- the proteins can be refolded in a redox buffer containing, including but not limited to, oxidized glutathione and L-arginine.
- Refolding reagents can be flowed or otherwise moved into contact with the one or more polypeptide or other expression product, or vice-versa.
- PSMC thus produced may be misfolded and thus lacks or has reduced biological activity.
- the bioactivity of the protein may be restored by "refolding".
- misfolded PSMC is refolded by solubilizing (where the PSMC is also insoluble), unfolding and reducing the polypeptide chain using, for example, one or more chaotropic agents (e.g. urea and/or guanidine) and a reducing agent capable of reducing disulfide bonds (e.g. dithiothreitol, DTT or 2-mercaptoethanol, 2-ME).
- chaotropic agents e.g. urea and/or guanidine
- a reducing agent capable of reducing disulfide bonds e.g. dithiothreitol, DTT or 2-mercaptoethanol, 2-ME
- PSMC may be refolded using standard methods known in the art, such as those described in U.S. Pat. Nos. 4,511,502, 4,51 1,503, and 4,512,922, which are incorporated by reference herein.
- the PSMC may also be cofolded with other proteins to form heterodimers or heteromultimers. After refolding or cofolding, the PSMC is preferably further purified.
- isolation steps may be performed on the cell lysate comprising PSMC or on any PSMC mixtures resulting from any isolation steps including, but not limited to, affinity chromatography, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, high performance liquid chromatography (“HPLC”), reversed phase-HPLC (“RP-HPLC”), expanded bed adsorption, or any combination and/or repetition thereof and in any appropriate order.
- HPLC high performance liquid chromatography
- RP-HPLC reversed phase-HPLC
- expanded bed adsorption or any combination and/or repetition thereof and in any appropriate order.
- Equipment and other necessary materials used in performing the techniques described herein are commercially available. Pumps, fraction collectors, monitors, recorders, and entire systems are available from, for example, Applied Biosystems (Foster City, CA), Bio-Rad Laboratories, Inc. (Hercules, CA), and Amersham Biosciences, Inc. (Piscataway, NJ). Chromatographic materials including, but not limited to, exchange matrix materials, media, and buffers are also available from such companies.
- fraction collectors examples include RediFrac Fraction Collector, FRAC- 100 and FRAC-200 Fraction Collectors, and SUPERFRAC® Fraction Collector (Amersham Biosciences, Piscataway, NJ). Mixers are also available to form pH and linear concentration gradients. Commercially available mixers include Gradient Mixer GM-1 and In-Line Mixers (Amersham Biosciences, Piscataway, NJ).
- the chromatographic process may be monitored using any commercially available monitor. Such monitors may be used to gather information like UV, pH, and conductivity. Examples of detectors include Monitor UV-1, UVICORD® S II, Monitor UV- M II, Monitor UV-900, Monitor UPC-900, Monitor pH/C-900, and Conductivity Monitor (Amersham Biosciences, Piscataway, NJ). Indeed, entire systems are commercially available including the various AKTA® systems from Amersham Biosciences (Piscataway, NJ).
- the PSMC may be reduced and denatured by first denaturing the resultant purified PSMC in urea, followed by dilution into TRIS buffer containing a reducing agent (such as DTT) at a suitable pH.
- a reducing agent such as DTT
- the PSMC is denatured in urea in a concentration range of between about 2 M to about 9 M, followed by dilution in TRIS buffer at a pH in the range of about 5.0 to about 8.0.
- the refolding mixture of this embodiment may then be incubated.
- the refolding mixture is incubated at room temperature for four to twenty-four hours.
- the reduced and denatured PSMC mixture may then be further isolated or purified.
- the pH of the first PSMC mixture may be adjusted prior to performing any subsequent isolation steps.
- the first PSMC mixture or any subsequent mixture thereof may be concentrated using techniques known in the art.
- the elution buffer comprising the first PSMC mixture or any subsequent mixture thereof may be exchanged for a buffer suitable for the next isolation step using techniques well known to those of ordinary skill in the art.
- Ion Exchange Chromatography may be performed on the first PSMC mixture. See generally ION EXCHANGE CHROMATOGRAPHY: PRINCIPLES AND METHODS (Cat. No. 18- 1 1 14-21, Amersham Biosciences (Piscataway, NJ)). Commercially available ion exchange columns include HITRAP ® , HIPREP ® , and HILOAD ® Columns (Amersham Biosciences, Piscataway, NJ).
- Such columns utilize strong anion exchangers such as Q SEPHAROSE Fast Flow, Q SEPHAROSE ® High Performance, and Q SEPHAROSE ® XL; strong cation exchangers such as SP SEPHAROSE ® High Performance, SP SEPHAROSE ® Fast Flow, and SP SEPHAROSE ® XL; weak anion exchangers such as DEAE SEPHAROSE ® Fast Flow; and weak cation exchangers such as CM SEPHAROSE ® Fast Flow (Amersham Biosciences, Piscataway, NJ).
- Anion or cation exchange column chromatography may be performed on the PSMC at any stage of the purification process to isolate substantially purified PSMC.
- the cation exchange chromatography step may be performed using any suitable cation exchange matrix.
- Useful cation exchange matrices include, but are not limited to, fibrous, porous, non-porous, microgranular, beaded, or cross-linked cation exchange matrix materials.
- Such cation exchange matrix materials include, but are not limited to, cellulose, agarose, dextran, polyacrylate, polyvinyl, polystyrene, silica, polyether, or composites of any of the foregoing.
- the cation exchange matrix may be any suitable cation exchanger including strong and weak cation exchangers. Strong cation exchangers may remain ionized over a wide pH range and thus, may be capable of binding PSMC over a wide pH range. Weak cation exchangers, however, may lose ionization as a function of pH. For example, a weak cation exchanger may lose charge when the pH drops below about pH 4 or pH 5. Suitable strong cation exchangers include, but are not limited to, charged functional groups such as sulfopropyl (SP), methyl sulfonate (S), or sulfoethyl (SE).
- SP sulfopropyl
- S methyl sulfonate
- SE sulfoethyl
- the cation exchange matrix may be a strong cation exchanger, preferably having a PSMC binding pH range of about 2.5 to about 6.0. Alternatively, the strong cation exchanger may have a PSMC binding pH range of about pH 2.5 to about pH 5.5.
- the cation exchange matrix may be a strong cation exchanger having a PSMC binding pH of about 3.0.
- the cation exchange matrix may be a strong cation exchanger, preferably having a PSMC binding pH range of about 6.0 to about 8.0.
- the cation exchange matrix may be a strong cation exchanger preferably having a PSMC binding pH range of about 8.0 to about 12.5. Alternatively, the strong cation exchanger may have an PSMC binding pH range of about pH 8.0 to about pH 12.0.
- the cation exchange matrix Prior to loading the PSMC, the cation exchange matrix may be equilibrated, for example, using several column volumes of a dilute, weak acid, e.g., four column volumes of 20 mM acetic acid, pH 3. Following equilibration, the PSMC may be added and the column may be washed one to several times, prior to elution of substantially purified PSMC, also using a weak acid solution such as a weak acetic acid or phosphoric acid solution. For example, approximately 2-4 column volumes of 20 mM acetic acid, pH 3, may be used to wash the column.
- a weak acid solution such as a weak acetic acid or phosphoric acid solution.
- substantially purified PSMC may be eluted by contacting the cation exchanger matrix with a buffer having a sufficiently low pH or ionic strength to displace the PSMC from the matrix.
- the pH of the elution buffer may range from about pH 2.5 to about pH 6.0. More specifically, the pH of the elution buffer may range from about pH 2.5 to about pH 5.5, about pH 2.5 to about pH 5.0.
- the elution buffer may have a pH of about 3.0.
- the quantity of elution buffer may vary widely and will generally be in the range of about 2 to about 10 column volumes.
- suitable buffers known to those of skill in the art may find use herein including, but not limited to, citrate, phosphate, formate, HEPES, and MES buffers ranging in concentration from at least about 5 mM to at least about 100 mM.
- substantially purified PSMC polypeptide may be eluted by contacting the matrix with a buffer having a sufficiently high pH or ionic strength to displace the PSMC from the matrix.
- Suitable buffers for use in high pH elution of substantially purified PSMC may include, but are not limited to, citrate, phosphate, formate, acetate, HEPES, and MES buffers ranging in concentration from at least about 5 mM to at least about 100 mM.
- Reverse-Phase Chromatography RP-HPLC may be performed to purify proteins following suitable protocols that are known to those of ordinary skill in the art. See, e.g., Pearson et al., ANAL BIOCHEM. (1982) 124:217-230 (1982); Rivier et al., J. CHROM. (1983) 268: 1 12-1 19; Kunitani et al., J. CHROM. (1986) 359:391-402. RP-HPLC may be performed on the PSMC to isolate substantially purified PSMC.
- silica derivatized resins with alkyl functionalities with a wide variety of lengths including, but not limited to, at least about C 3 to at least about C 30 , at least about C 3 to at least about C 20 , or at least about C 3 to at least about C 18 , resins may be used.
- a polymeric resin may be used.
- TosoHaas Amberchrome CGlOOOsd resin may be used, which is a styrene polymer resin.
- Cyano or polymeric resins with a wide variety of alkyl chain lengths may also be used.
- the RP-HPLC column may be washed with a solvent such as ethanol.
- the Source RP column is another example of a RP-HPLC column.
- a suitable elution buffer containing an ion pairing agent and an organic modifier such as methanol, isopropanol, tetrahydrofuran, acetonitrile or ethanol may be used to elute the PSMC from the RP-HPLC column.
- the most commonly used ion pairing agents include, but are not limited to, acetic acid, formic acid, perchloric acid, phosphoric acid, trifluoroacetic acid, heptafluorobutyric acid, triethylamine, tetramethylammonium, tetrabutylammonium, and triethylammonium acetate.
- Elution may be performed using one or more gradients or isocratic conditions, with gradient conditions preferred to reduce the separation time and to decrease peak width. Another method involves the use of two gradients with different solvent concentration ranges. Examples of suitable elution buffers for use herein may include, but are not limited to, ammonium acetate and acetonitrile solutions.
- Hydrophobic interaction chromatography may be performed on the PSMC. See generally HYDROPHOBIC INTERACTION CHROMATOGRAPHY HANDBOOK: PRINCIPLES AND METHODS (Cat. No. 18-1020-90, Amersham Biosciences (Piscataway, NJ) which is incorporated by reference herein.
- Suitable HIC matrices may include, but are not limited to, alkyl- or aryl-substituted matrices, such as butyl-, hexyl-, octyl- or phenyl-substituted matrices including agarose, cross-linked agarose, sepharose, cellulose, silica, dextran, polystyrene, poly(methacrylate) matrices, and mixed mode resins, including but not limited to, a polyethyleneamine resin or a butyl- or phenyl-substituted poly(methacrylate) matrix.
- Commercially available sources for hydrophobic interaction column chromatography include, but are not limited to, HITRAP ® , HIPREP ® , and HILOAD ® columns (Amersham Biosciences, Piscataway, NJ).
- the HIC column may be equilibrated using standard buffers known to those of ordinary skill in the art, such as an acetic acid/sodium chloride solution or HEPES containing ammonium sulfate. Ammonium sulfate may be used as the buffer for loading the HIC column. After loading the PSMC, the column may then washed using standard buffers and conditions to remove unwanted materials but retaining the PSMC on the HIC column.
- standard buffers known to those of ordinary skill in the art, such as an acetic acid/sodium chloride solution or HEPES containing ammonium sulfate. Ammonium sulfate may be used as the buffer for loading the HIC column.
- the column may then washed using standard buffers and conditions to remove unwanted materials but retaining the PSMC on the HIC column.
- PSMC may be eluted with about 3 to about 10 column volumes of a standard buffer, such as a HEPES buffer containing EDTA and lower ammonium sulfate concentration than the equilibrating buffer, or an acetic acid/sodium chloride buffer, among others.
- a standard buffer such as a HEPES buffer containing EDTA and lower ammonium sulfate concentration than the equilibrating buffer, or an acetic acid/sodium chloride buffer, among others.
- a decreasing linear salt gradient using, for example, a gradient of potassium phosphate, may also be used to elute the PSMC molecules.
- the eluant may then be concentrated, for example, by filtration such as diafiltration or ultrafiltration. Diafiltration may be utilized to remove the salt used to elute PSMC.
- the non-naturally encoded amino acid present in the PSMC may also be utilized to provide separation from other cellular proteins that do not contain the non- naturally encoded amino acid. Since the non-naturally encoded amino acid may comprise unique chemical functional groups, the coupling of the unique functional group to another molecule may provide a substantial purification step. For example, the non-naturally encoded amino acid may be coupled to another molecule that facilitates separation from other proteins. Such molecules for coupling to the non-natural amino acid include, but are not limited to, PEG and other polymers, beads, and other solid substances.
- the yield of PSMC may be monitored at each step described herein using techniques known to those of ordinary skill in the art. Such techniques may also be used to assess the yield of substantially purified PSMC following the last isolation step. For example, the yield of PSMC may be monitored using any of several reverse phase high pressure liquid chromatography columns, having a variety of alkyl chain lengths such as cyano RP-HPLC, CigRP-HPLC; as well as cation exchange HPLC and gel filtration HPLC.
- the yield of PSMC after each purification step may be at least about 30%, at least about 35%>, at least about 40%>, at least about 45%>, at least about 50%>, at least about 55%>, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%), at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 99.9%, or at least about 99.99%, of the PSMC in the starting material for each purification step.
- Purity may be determined using standard techniques, such as SDS-PAGE, or by measuring PSMC using Western blot and ELISA assays.
- polyclonal antibodies may be generated against proteins isolated from negative control yeast fermentation and the cation exchange recovery. The antibodies may also be used to probe for the presence of contaminating host cell proteins.
- RP-HPLC material Vydac C4 (Vydac) consists of silica gel particles, the surfaces of which carry C4-alkyl chains.
- the separation of PSMC from the proteinaceous impurities is based on differences in the strength of hydrophobic interactions. Elution is performed with an acetonitrile gradient in diluted trifluoroacetic acid.
- Preparative HPLC is performed using a stainless steel column (filled with 2.8 to 3.2 liter of Vydac C4 silicagel).
- the Hydroxyapatite Ultrogel eluate is acidified by adding trifluoroacetic acid and loaded onto the Vydac C4 column.
- an acetonitrile gradient in diluted trifluoroacetic acid is used. Fractions are collected and immediately neutralized with phosphate buffer.
- the PSMC fractions which are within the IPC limits are pooled.
- DEAE Sepharose (Pharmacia) material consists of diethylaminoethyl (DEAE)- groups which are covalently bound to the surface of Sepharose beads.
- the binding of PSMC to the DEAE groups is mediated by ionic interactions.
- Acetonitrile and trifluoroacetic acid pass through the column without being retained.
- trace impurities are removed by washing the column with acetate buffer at a low pH. Then the column is washed with neutral phosphate buffer and PSMC is eluted with a buffer with increased ionic strength.
- the column is packed with DEAE Sepharose fast flow.
- the column volume is adjusted to assure a PSMC load in the range of 3-10 mg PSMC polypeptide/ml gel.
- the column is washed with water and equilibration buffer (sodium/potassium phosphate).
- the pooled fractions of the HPLC eluate are loaded and the column is washed with equilibration buffer.
- the column is washed with washing buffer (sodium acetate buffer) followed by washing with equilibration buffer.
- PSMC is eluted from the column with elution buffer (sodium chloride, sodium/potassium phosphate) and collected in a single fraction in accordance with the master elution profile.
- Endotoxins are lipopoly-saccharides (LPSs) which are located on the outer membrane of Gram-negative host cells, such as, for example, Escherichia coli.
- Methods for reducing endotoxin levels include, but are not limited to, purification techniques using silica supports, glass powder or hydroxyapatite, reverse-phase, affinity, size-exclusion, anion-exchange chromatography, hydrophobic interaction chromatography, a combination of these methods, and the like. Modifications or additional methods may be required to remove contaminants such as co-migrating proteins from the polypeptide of interest
- a wide variety of methods and procedures can be used to assess the yield and purity of a PSMC protein one or more non-naturally encoded amino acids, including but not limited to, the Bradford assay, SDS-PAGE, silver stained SDS-PAGE, coomassie stained SDS-PAGE, mass spectrometry (including but not limited to, MALDI-TOF) and other methods for characterizing proteins known to one skilled in the art.
- Induction of expression of the recombinant protein results in the accumulation of a protein containing the unnatural analog.
- o, m and p-fluorophenylalanines have been incorporated into proteins, and exhibit two characteristic shoulders in the UV spectrum which can be easily identified, see, e.g., C. Minks, R. Huber, L. Moroder and N. Budisa, Anal. Biochem.. 284:29 (2000); trifluoromethionine has been used to replace methionine in bacteriophage T4 lysozyme to study its interaction with chitooligosaccharide ligands by 19 F NMR, see, e.g., H. Duewel, E. Daub, V.
- Patent Publication 2002/0042097 which are incorporated by reference herein.
- the success of this method depends on the recognition of the unnatural amino acid analogs by aminoacyl-tRNA synthetases, which, in general, require high selectivity to insure the fidelity of protein translation.
- One way to expand the scope of this method is to relax the substrate specificity of aminoacyl-tRNA synthetases, which has been achieved in a limited number of cases.
- PheRS phenylalanyl-tRNA synthetase
- ValRS can misaminoacylate tRNAVal with Cys, Thr, or aminobutyrate (Abu); these noncognate amino acids are subsequently hydrolyzed by the editing domain. After random mutagenesis of the Escherichia coli chromosome, a mutant Escherichia coli strain was selected that has a mutation in the editing site of ValRS. This edit-defective ValRS incorrectly charges tRNAVal with Cys.
- a suppressor tRNA was prepared that recognized the stop codon UAG and was chemically aminoacylated with an unnatural amino acid.
- Conventional site- directed mutagenesis was used to introduce the stop codon TAG, at the site of interest in the protein gene. See, e.g., Sayers, J.R., Schmidt, W. Eckstein, F. 5', 3' Exonuclease in phosphorothioate-based olignoucleotide-directed mutagensis, Nucleic Acids Res, 16(3):791 - 802 (1988).
- Microinjection techniques have also been use incorporate unnatural amino acids into proteins. See, e.g., M. W. Nowak, P. C. Kearney, J. R. Sampson, M. E. Saks, C. G. Labarca, S. K. Silverman, W. G. Zhong, J. Thorson, J. N. Abelson, N. Davidson, P. G. Schultz, D. A. Dougherty and H. A. Lester, Science, 268:439 (1995); and, D. A. Dougherty, Curr. Opin. Chem.
- a Xenopus oocyte was coinjected with two RNA species made in vitro: an mRNA encoding the target protein with a UAG stop codon at the amino acid position of interest and an amber suppressor tRNA aminoacylated with the desired unnatural amino acid.
- the translational machinery of the oocyte then inserts the unnatural amino acid at the position specified by UAG.
- This method has allowed in vivo structure-function studies of integral membrane proteins, which are generally not amenable to in vitro expression systems. Examples include the incorporation of a fluorescent amino acid into tachykinin neurokinin-2 receptor to measure distances by fluorescence resonance energy transfer, see, e.g., G. Turcatti, K. Nemeth, M.
- yeast amber suppressor tRNAPheCUA /phenylalanyl-tRNA synthetase pair was used in a p-F-Phe resistant, Phe auxotrophic Escherichia coli strain. See, e.g., R. Furter, Protein Sci., 7:419 (1998).
- a PSMC polynucleotide of the present invention may also be possible to obtain expression of a PSMC polynucleotide of the present invention using a cell-free (in-vitro) translational system.
- these systems which can include either mRNA as a template (in-vitro translation) or DNA as a template (combined in-vitro transcription and translation), the in vitro synthesis is directed by the ribosomes.
- Another approach that may be applied to the expression of antigen-binding polypeptides comprising a non-naturally encoded amino acid includes the mRNA-peptide fusion technique. See, e.g., R. Roberts and J. Szostak, Proc. Natl Acad. Sci. (USA) 94: 12297- 12302 (1997); A. Frankel, et al, Chemistry & Biology 10: 1043-1050 (2003). In this approach, an mRNA template linked to puromycin is translated into peptide on the ribosome. If one or more tRNA molecules has been modified, non-natural amino acids can be incorporated into the peptide as well.
- puromycin captures the C-terminus of the peptide. If the resulting mRNA-peptide conjugate is found to have interesting properties in an in vitro assay, its identity can be easily revealed from the mRNA sequence. In this way, one may screen libraries of antigen-binding polypeptides comprising one or more non-naturally encoded amino acids to identify polypeptides having desired properties. More recently, in vitro ribosome translations with purified components have been reported that permit the synthesis of peptides substituted with non-naturally encoded amino acids. See, e.g., A. Forster et al , Proc. Natl Acad. Sci. (USA) 100:6353 (2003).
- non-natural amino acid polypeptides described herein can be effected using the compositions, methods, techniques and strategies described herein. These modifications include the incorporation of further functionality onto the non- natural amino acid component of the polypeptide, including but not limited to, a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a radionuclide; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a water-soluble dendrimer; a cyclodextrin; an inhibitory ribonucleic acid; a bio
- a label including but not limited
- compositions, methods, techniques and strategies described herein will focus on adding macromolecular polymers to the non-natural amino acid polypeptide with the understanding that the compositions, methods, techniques and strategies described thereto are also applicable (with appropriate modifications, if necessary and for which one of skill in the art could make with the disclosures herein) to adding other functionalities, including but not limited to those listed above.
- a wide variety of macromolecular polymers and other molecules can be linked to antigen-binding polypeptides of the present invention to modulate biological properties of the PSMC, and/or provide new biological properties to the PSMC molecule.
- These macromolecular polymers can be linked to the PSMC via a naturally encoded amino acid, via a non-naturally encoded amino acid, or any functional substituent of a natural or non-natural amino acid, or any substituent or functional group added to a natural or non- natural amino acid.
- the molecular weight of the polymer may be of a wide range, including but not limited to, between about 100 Da and about 100,000 Da or more.
- the present invention provides substantially homogenous preparations of polymenprotein conjugates.
- substantially homogenous as used herein means that polymer:protein conjugate molecules are observed to be greater than half of the total protein.
- the polymenprotein conjugate has biological activity and the present "substantially homogenous" PEGylated PSMC preparations provided herein are those which are homogenous enough to display the advantages of a homogenous preparation, e.g., ease in clinical application in predictability of lot to lot pharmacokinetics.
- the polymer selected may be water soluble so that the protein to which it is attached does not precipitate in an aqueous environment, such as a physiological environment.
- the polymer may be branched or unbranched.
- the polymer will be pharmaceutically acceptable for therapeutic use of the end-product preparation.
- the proportion of polyethylene glycol molecules to protein molecules will vary, as will their concentrations in the reaction mixture.
- the optimum ratio in terms of efficiency of reaction in that there is minimal excess unreacted protein or polymer
- the molecular weight of the polyethylene glycol selected and on the number of available reactive groups available As relates to molecular weight, typically the higher the molecular weight of the polymer, the fewer number of polymer molecules which may be attached to the protein. Similarly, branching of the polymer should be taken into account when optimizing these parameters. Generally, the higher the molecular weight (or the more branches) the higher the polymenprotein ratio.
- the term "therapeutically effective amount” refers to an amount which gives the desired benefit to a patient. The amount will vary from one individual to another and will depend upon a number of factors, including the overall physical condition of the patient and the underlying cause of the condition to be treated. The amount of PSMC polypeptide used for therapy gives an acceptable rate of change and maintains desired response at a beneficial level. A therapeutically effective amount of the present compositions may be readily ascertained by one skilled in the art using publicly available materials and procedures.
- the water soluble polymer may be any structural form including but not limited to linear, forked or branched. Typically, the water soluble polymer is a poly(alkylene glycol), such as poly(ethylene glycol) (PEG), but other water soluble polymers can also be employed. By way of example, PEG is used to describe certain embodiments of this invention.
- PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
- the term "PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented as linked to the PSMC by the formula:
- n 2 to 10,000 and X is H or a terminal modification, including but not limited to, a C alkyl.
- a PEG used in the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH 3 ("methoxy PEG").
- the PEG can terminate with a reactive group, thereby forming a bifunctional polymer.
- Typical reactive groups can include those reactive groups that are commonly used to react with the functional groups found in the 20 common amino acids (including but not limited to, maleimide groups, activated carbonates (including but not limited to, p-nitrophenyl ester), activated esters (including but not limited to, N-hydroxysuccinimide, p-nitrophenyl ester) and aldehydes) as well as functional groups that are inert to the 20 common amino acids but that react specifically with complementary functional groups present in non-naturally encoded amino acids (including but not limited to, azide groups, alkyne groups).
- Y may be an amide, carbamate or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N-terminus) of the polypeptide.
- Y may be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine).
- Y may be a linkage to a residue not commonly accessible via the 20 common amino acids.
- an azide group on the PEG can be reacted with an alkyne group on the PSMC to form a Huisgen [3+2] cycloaddition product.
- an alkyne group on the PEG can be reacted with an azide group present in a non-naturally encoded amino acid to form a similar product.
- a strong nucleophile (including but not limited to, hydrazine, hydrazide, hydroxylamine, semicarbazide) can be reacted with an aldehyde or ketone group present in a non-naturally encoded amino acid to form a hydrazone, oxime or semicarbazone, as applicable, which in some cases can be further reduced by treatment with an appropriate reducing agent.
- the strong nucleophile can be incorporated into the PSMC via a non-naturally encoded amino acid and used to react preferentially with a ketone or aldehyde group present in the water soluble polymer.
- Any molecular mass for a PEG can be used as practically desired, including but not limited to, from about 100 Daltons (Da) to 100,000 Da or more as desired (including but not limited to, sometimes 0.1-50 kDa or 10-40 kDa).
- Branched chain PEGs including but not limited to, PEG molecules with each chain having a MW ranging from 1-100 kDa (including but not limited to, 1-50 kDa or 5-20 kDa) can also be used.
- a wide range of PEG molecules are described in, including but not limited to, the Shearwater Polymers, Inc. catalog, Nektar Therapeutics catalog, incorporated herein by reference.
- the PEG molecule is available for reaction with the non-naturally-encoded amino acid.
- PEG derivatives bearing alkyne and azide moieties for reaction with amino acid side chains can be used to attach PEG to non- naturally encoded amino acids as described herein.
- the non-naturally encoded amino acid comprises an azide
- the PEG will typically contain either an alkyne moiety to effect formation of the [3+2] cycloaddition product or an activated PEG species (i.e., ester, carbonate) containing a phosphine group to effect formation of the amide linkage.
- the PEG will typically contain an azide moiety to effect formation of the [3+2] Huisgen cycloaddition product.
- the PEG will typically comprise a potent nucleophile (including but not limited to, a hydrazide, hydrazine, hydroxylamine, or semicarbazide functionality) in order to effect formation of corresponding hydrazone, oxime, and semicarbazone linkages, respectively.
- the PSMC variant with a PEG derivative contains a chemical functionality that is reactive with the chemical functionality present on the side chain of the non-naturally encoded amino acid.
- the invention provides in some embodiments azide- and acetylene-containing polymer derivatives comprising a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da.
- the polymer backbone of the water-soluble polymer can be poly(ethylene glycol).
- water soluble polymers including but not limited to poly(ethylene)glycol and other related polymers, including poly(dextran) and poly(propylene glycol), are also suitable for use in the practice of this invention and that the use of the term PEG or poly(ethylene glycol) is intended to encompass and include all such molecules.
- PEG includes, but is not limited to, poly(ethylene glycol) in any of its forms, including bifunctional PEG, multiarmed PEG, derivatized PEG, forked PEG, branched PEG, pendent PEG (i.e. PEG or related polymers having one or more functional groups pendent to the polymer backbone), or PEG with degradable linkages therein.
- PEG is typically clear, colorless, odorless, soluble in water, stable to heat, inert to many chemical agents, does not hydrolyze or deteriorate, and is generally non-toxic.
- Poly(ethylene glycol) is considered to be biocompatible, which is to say that PEG is capable of coexistence with living tissues or organisms without causing harm. More specifically, PEG is substantially non-immunogenic, which is to say that PEG does not tend to produce an immune response in the body. When attached to a molecule having some desirable function in the body, such as a biologically active agent, the PEG tends to mask the agent and can reduce or eliminate any immune response so that an organism can tolerate the presence of the agent.
- PEG conjugates tend not to produce a substantial immune response or cause clotting or other undesirable effects.
- PEG having a molecular weight of from about 800 Da to about 100,000 Da are in some embodiments of the present invention particularly useful as the polymer backbone.
- the polymer backbone can be linear or branched.
- Branched polymer backbones are generally known in the art.
- a branched polymer has a central branch core moiety and a plurality of linear polymer chains linked to the central branch core.
- PEG is commonly used in branched forms that can be prepared by addition of ethylene oxide to various polyols, such as glycerol, glycerol oligomers, pentaerythritol and sorbitol.
- the central branch moiety can also be derived from several amino acids, such as lysine.
- the branched poly(ethylene glycol) can be represented in general form as R(-PEG-OH) m in which R is derived from a core moiety, such as glycerol, glycerol oligomers, or pentaerythritol, and m represents the number of arms.
- R is derived from a core moiety, such as glycerol, glycerol oligomers, or pentaerythritol
- m represents the number of arms.
- Multi-armed PEG molecules such as those described in U.S. Pat. Nos. 5,932,462 5,643,575; 5,229,490; 4,289,872; U.S. Pat. Appl. 2003/0143596; WO 96/21469; and WO 93/21259, each of which is incorporated by reference herein in its entirety, can also be used as the polymer backbone.
- Branched PEG can also be in the form of a forked PEG represented by PEG(— YCHZ 2 ) n , where Y is a linking group and Z is an activated terminal group linked to CH by a chain of atoms of defined length.
- the pendant PEG has reactive groups, such as carboxyl, along the PEG backbone rather than at the end of PEG chains.
- the polymer can also be prepared with weak or degradable linkages in the backbone.
- PEG can be prepared with ester linkages in the polymer backbone that are subject to hydrolysis. As shown below, this hydrolysis results in cleavage of the polymer into fragments of lower molecular weight:
- poly(ethylene glycol) or PEG represents or includes all the forms known in the art including but not limited to those disclosed herein.
- polymer backbones that are water-soluble, with from 2 to about 300 termini, are particularly useful in the invention.
- suitable polymers include, but are not limited to, other poly(alkylene glycols), such as poly(propylene glycol) ("PPG"), copolymers thereof (including but not limited to copolymers of ethylene glycol and propylene glycol), terpolymers thereof, mixtures thereof, and the like.
- PPG poly(propylene glycol)
- the molecular weight of each chain of the polymer backbone can vary, it is typically in the range of from about 800 Da to about 100,000 Da, often from about 6,000 Da to about 80,000 Da.
- Multi-functional meaning that the polymer backbone has at least two termini, and possibly as many as about 300 termini, functionalized or activated with a functional group.
- Multifunctional polymer derivatives include, but are not limited to, linear polymers having two termini, each terminus being bonded to a functional group which may be the same or different.
- the polymer derivative has the structure:
- B is a linking moiety, which may be present or absent;
- POLY is a water-soluble non-antigenic polymer
- A is a linking moiety, which may be present or absent and which may be the same as B or different;
- X is a second functional group.
- Examples of a linking moiety for A and B include, but are not limited to, a multiply- functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms.
- a heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain.
- the alkyl chain may also be branched at a heteroatom.
- Other examples of a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl group, containing up to 10 and more preferably 5-6 carbon atoms.
- the aryl group may be substituted with one more carbon atoms, nitrogen, oxygen or sulfur atoms.
- Other examples of suitable linking groups include those linking groups described in U.S. Pat. Nos.
- linking moieties are by no means exhaustive and is merely illustrative, and that all linking moieties having the qualities described above are contemplated to be suitable for use in the present invention.
- Examples of suitable functional groups for use as X include, but are not limited to, hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N- hydroxysuccinimidyl esters and 1 -benzotriazolyl esters, active carbonate, such as N- hydroxysuccinimidyl carbonates and 1 -benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates,
- the selected X moiety should be compatible with the azide group so that reaction with the azide group does not occur.
- the azide-containing polymer derivatives may be homobifunctional, meaning that the second functional group (i.e., X) is also an azide moiety, or heterobifunctional, meaning that the second functional group is a different functional group.
- the term "protected” refers to the presence of a protecting group or moiety that prevents reaction of the chemically reactive functional group under certain reaction conditions.
- the protecting group will vary depending on the type of chemically reactive group being protected. For example, if the chemically reactive group is an amine or a hydrazide, the protecting group can be selected from the group of tert-butyloxycarbonyl (t- Boc) and 9-fluorenylmethoxycarbonyl (Fmoc). If the chemically reactive group is a thiol, the protecting group can be orthopyridyldisulfide.
- the chemically reactive group is a carboxylic acid, such as butanoic or propionic acid, or a hydroxyl group
- the protecting group can be benzyl or an alkyl group such as methyl, ethyl, or tert-butyl.
- Other protecting groups known in the art may also be used in the present invention.
- terminal functional groups in the literature include, but are not limited to, N-succinimidyl carbonate (see e.g., U.S. Pat. Nos. 5,281 ,698, 5,468,478), amine (see, e.g., Buckmann et al. Makromol. Chem. 182: 1379 (1981), Zaplipsky et al. Eur. Polym. J. 19: 1 177 (1983)), hydrazide (See, e.g., Andresz et al. Makromol. Chem.
- succinimidyl propionate and succinimidyl butanoate see, e.g., Olson et al. in Poly(ethylene glycol) Chemistry & Biological Applications, pp 170-181 , Harris & Zaplipsky Eds., ACS, Washington, D.C., 1997; see also U.S. Pat. No. 5,672,662
- succinimidyl succinate See, e.g., Abuchowski et al. Cancer Biochem. Biophys. 7: 175 (1984) and Joppich et al. Macrolol. Chem. 180: 1381 (1979), succinimidyl ester (see, e.g., U.S. Pat. No.
- the polymer derivatives of the invention comprise a polymer backbone having the structure:
- X is a functional group as described above.
- n is about 20 to about 4000.
- polymer derivatives of the invention comprise a polymer backbone having the structure:
- W is an aliphatic or aromatic linker moiety comprising between 1-10 carbon atoms
- n is about 20 to about 4000
- X is a functional group as described above, m is between 1 and 10.
- the azide-containing PEG derivatives of the invention can be prepared by a variety of methods known in the art and/or disclosed herein.
- a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da is reacted with an azide anion (which may be paired with any of a number of suitable counter-ions, including sodium, potassium, tert-butylammonium and so forth).
- the leaving group undergoes a nucleophilic displacement and is replaced by the azide moiety, affording the desired azide-containing PEG polymer.
- a suitable polymer backbone for use in the present invention has the formula X-PEG-L, wherein PEG is poly(ethylene glycol) and X is a functional group which does not react with azide groups and L is a suitable leaving group.
- suitable functional groups include, but are not limited to, hydroxyl, protected hydroxyl, acetal, alkenyl, amine, aminooxy, protected amine, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, maleimide, dithiopyridine, and vinylpyridine, and ketone.
- suitable leaving groups include, but are not limited to, chloride, bromide, iodide, mesylate, tresylate, and tosylate.
- a linking agent bearing an azide functionality is contacted with a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, wherein the linking agent bears a chemical functionality that will react selectively with a chemical functionality on the PEG polymer, to form an azide-containing polymer derivative product wherein the azide is separated from the polymer backbone by a linking group.
- PEG is poly(ethylene glycol) and X is a capping group such as alkoxy or a functional group as described above;
- M is a functional group that is not reactive with the azide functionality but that will react efficiently and selectively with the N functional group.
- Suitable functional groups include, but are not limited to, M being a carboxylic acid, carbonate or active ester if N is an amine; M being a ketone if N is a hydrazide or aminooxy moiety; M being a leaving group if N is a nucleophile.
- Purification of the crude product may be accomplished by known methods including, but are not limited to, precipitation of the product followed by chromatography, if necessary.
- the amine group can be coupled to the carboxylic acid group using a variety of activating agents such as thionyl chloride or carbodiimide reagents and N- hydroxysuccinimide or N-hydroxybenzotriazole to create an amide bond between the monoamine PEG derivative and the azide-bearing linker moiety.
- activating agents such as thionyl chloride or carbodiimide reagents and N- hydroxysuccinimide or N-hydroxybenzotriazole.
- the resulting N-tert-butyl-Boc-protected azide-containing derivative can be used directly to modify bioactive molecules or it can be further elaborated to install other useful functional groups.
- the N-t-Boc group can be hydrolyzed by treatment with strong acid to generate an omega-amino-PEG-azide.
- the resulting amine can be used as a synthetic handle to install other useful functionality such as maleimide groups, activated disulfides, activated esters and so forth for the creation of valuable heterobifunctional reagents.
- Heterobifunctional derivatives are particularly useful when it is desired to attach different molecules to each terminus of the polymer.
- the omega-N- amino-N-azido PEG would allow the attachment of a molecule having an activated electrophilic group, such as an aldehyde, ketone, activated ester, activated carbonate and so forth, to one terminus of the PEG and a molecule having an acetylene group to the other terminus of the PEG.
- the polymer derivative has the structure:
- R can be either H or an alkyl, alkene, alkyoxy, or aryl or substituted aryl group
- B is a linking moiety, which may be present or absent;
- POLY is a water-soluble non-antigenic polymer
- A is a linking moiety, which may be present or absent and which may be the same as B or different;
- X is a second functional group.
- Examples of a linking moiety for A and B include, but are not limited to, a multiply-functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms.
- a heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain.
- the alkyl chain may also be branched at a heteroatom.
- Other examples of a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl group, containing up to 10 and more preferably 5-6 carbon atoms.
- the aryl group may be substituted with one more carbon atoms, nitrogen, oxygen, or sulfur atoms.
- Other examples of suitable linking groups include those linking groups described in U.S. Pat. Nos.
- linking moieties is by no means exhaustive and is intended to be merely illustrative, and that a wide variety of linking moieties having the qualities described above are contemplated to be useful in the present invention.
- Examples of suitable functional groups for use as X include hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N-hydroxysuccinimidyl esters and 1- benzotriazolyl esters, active carbonate, such as N-hydroxysuccinimidyl carbonates and 1- benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, and tresylate, alkene, ketone, ket
- the selected X moiety should be compatible with the acetylene group so that reaction with the acetylene group does not occur.
- the acetylene -containing polymer derivatives may be homobi unctional, meaning that the second functional group (i.e., X) is also an acetylene moiety, or heterobifunctional, meaning that the second functional group is a different functional group.
- the polymer derivatives comprise a polymer backbone having the structure:
- X is a functional group as described above;
- n is about 20 to about 4000
- n 1 and 10.
- the acetylene-containing PEG derivatives of the invention can be prepared using methods known to those skilled in the art and/or disclosed herein.
- a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da is reacted with a compound that bears both an acetylene functionality and a leaving group that is suitable for reaction with the nucleophilic group on the PEG.
- the leaving group undergoes a nucleophilic displacement and is replaced by the nucleophilic moiety, affording the desired acetylene-containing polymer.
- a preferred polymer backbone for use in the reaction has the formula X-PEG-Nu, wherein PEG is poly(ethylene glycol), Nu is a nucleophilic moiety and X is a functional group that does not react with Nu, L or the acetylene functionality.
- Nu examples include, but are not limited to, amine, alkoxy, aryloxy, sulfhydryl, imino, carboxylate, hydrazide, aminoxy groups that would react primarily via a SN2-type mechanism. Additional examples of Nu groups include those functional groups that would react primarily via an nucleophilic addition reaction. Examples of L groups include chloride, bromide, iodide, mesylate, tresylate, and tosylate and other groups expected to undergo nucleophilic displacement as well as ketones, aldehydes, thioesters, olefins, alpha- beta unsaturated carbonyl groups, carbonates and other electrophilic groups expected to undergo addition by nucleophiles.
- A is an aliphatic linker of between 1-10 carbon atoms or a substituted aryl ring of between 6-14 carbon atoms.
- X is a functional group which does not react with azide groups and L is a suitable leaving group
- a PEG polymer having an average molecular weight from about 800 Da to about 100,000 Da, bearing either a protected functional group or a capping agent at one terminus and a suitable leaving group at the other terminus is contacted by an acetylene anion.
- PEG is poly(ethylene glycol) and X is a capping group such as alkoxy or a functional group as described above; and R' is either H, an alkyl, alkoxy, aryl or aryloxy group or a substituted alkyl, alkoxyl, aryl or aryloxy group.
- the leaving group L should be sufficiently reactive to undergo SN2-type displacement when contacted with a sufficient concentration of the acetylene anion.
- the reaction conditions required to accomplish SN2 displacement of leaving groups by acetylene anions are well known in the art.
- Purification of the crude product can usually be accomplished by methods known in the art including, but are not limited to, precipitation of the product followed by chromatography, if necessary.
- Water soluble polymers can be linked to the antigen-binding polypeptides of the invention.
- the water soluble polymers may be linked via a non-naturally encoded amino acid incorporated in the antigen-binding polypeptide or any functional group or substituent of a non-naturally encoded or naturally encoded amino acid, or any functional group or substituent added to a non-naturally encoded or naturally encoded amino acid.
- the water soluble polymers are linked to an antigen-binding polypeptide incorporating a non- naturally encoded amino acid via a naturally-occurring amino acid (including but not limited to, cysteine, lysine or the amine group of the N-terminal residue).
- the PSMC of the invention comprise 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 non-natural amino acids, wherein one or more non-naturally-encoded amino acid(s) are linked to water soluble polymer(s) (including but not limited to, PEG and/or oligosaccharides).
- the PSMC of the invention further comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more naturally-encoded amino acid(s) linked to water soluble polymers.
- the PSMC of the invention comprise one or more non-naturally encoded amino acid(s) linked to water soluble polymers and one or more naturally-occurring amino acids linked to water soluble polymers.
- the water soluble polymers used in the present invention enhance the serum half-life of the PSMC relative to the unconjugated form.
- the number of water soluble polymers linked to an antigen-binding polypeptide (i.e., the extent of PEGylation or glycosylation) of the present invention can be adjusted to provide an altered (including but not limited to, increased or decreased) pharmacologic, pharmacokinetic or pharmacodynamic characteristic such as in vivo half-life.
- the half-life of PSMC is increased at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 percent, 2- fold, 5-fold, 10-fold, 50-fold, or at least about 100-fold over an unmodified polypeptide.
- PEG derivatives containing a strong nucleophilic group i.e., hydrazide, hydrazine, hydroxylamine or semicarbazide
- an antigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety that is linked directly to the PEG backbone.
- the hydroxylamine-terminal PEG derivative will have the structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
- the hydrazine- or hydrazide-containing PEG derivative will have the structure:
- the semicarbazide-containing PEG derivative will have the structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000.
- an antigen-binding polypeptide comprising a carbonyl-containing amino acid is modified with a PEG derivative that contains a terminal hydroxylamine, hydrazide, hydrazine, or semicarbazide moiety that is linked to the PEG backbone by means of an amide linkage.
- the hydroxylamine-terminal PEG derivatives have the structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
- the hydrazine- or hydrazide-containing PEG derivatives have the structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.)
- m is 2-10
- n is 100-1 ,000
- the semicarbazide-containing PEG derivatives have the structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1 ,000.
- a PSMC comprising a carbonyl- containing amino acid is modified with a branched PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
- a PSMC comprising a non-naturally encoded amino acid is modified with a PEG derivative having a branched structure.
- a PEG derivative having a branched structure for instance, in some embodiments, the hydrazine- or hydrazide-terminal PEG derivative will have the following structure:
- the PEG derivatives containing a semicarbazide group will have the structure:
- the PEG derivatives containing a hydroxylamine group will have the structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.)
- X is optionally NH, O, S, C(O) or not present
- m is 2-10 and n is 100-1 ,000.
- the degree and sites at which the water soluble polymer(s) are linked to the PSMC can modulate the binding of the PSMC to an antigen or receptor.
- PEGylation i.e., addition of any water soluble polymer
- antigen-binding polypeptides containing a non-naturally encoded amino acid such as -azido-L- phenylalanine
- PSMC is PEGylated with an alkyne-terminated mPEG derivative. Briefly, an excess of solid mPEG(5000)-O- CH 2 -C ⁇ CH is added, with stirring, to an aqueous solution of -azido-L-Phe-containing PSMC at room temperature.
- the aqueous solution is buffered with a buffer having a p a near the pH at which the reaction is to be carried out (generally about pH 4-10).
- a buffer having a p a near the pH at which the reaction is to be carried out generally about pH 4-10.
- suitable buffers for PEGylation at pH 7.5 include, but are not limited to, HEPES, phosphate, borate, TRIS-HCl, EPPS, and TES.
- the pH is continuously monitored and adjusted if necessary.
- the reaction is typically allowed to continue for between about 1-48 hours.
- the reaction products are subsequently subjected to hydrophobic interaction chromatography to separate the PEGylated PSMC variants from free mPEG(5000)-O-CH 2 - C ⁇ CH and any high-molecular weight complexes of the pegylated PSMC which may form when unblocked PEG is activated at both ends of the molecule, thereby crosslinking PSMC variant molecules.
- the conditions during hydrophobic interaction chromatography are such that free mPEG(5000)-O-CH 2 -C ⁇ CH flows through the column, while any crosslinked PEGylated PSMC variant complexes elute after the desired forms, which contain one PSMC variant molecule conjugated to one or more PEG groups. Suitable conditions vary depending on the relative sizes of the cross-linked complexes versus the desired conjugates and are readily determined by those skilled in the art.
- the eluent containing the desired conjugates is concentrated by ultrafiltration and desalted by diafiltration.
- the PEGylated PSMC obtained from the hydrophobic chromatography can be purified further by one or more procedures known to those skilled in the art including, but are not limited to, affinity chromatography; anion- or cation-exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse phase HPLC; gel filtration (using, including but not limited to, SEPHADEX G-75); hydrophobic interaction chromatography; size-exclusion chromatography, metal- chelate chromatography; ultrafiltration/diafiltration; ethanol precipitation; ammonium sulfate precipitation; chromatofocusing; displacement chromatography; electrophoretic procedures (including but not limited to preparative isoelectric focusing), differential solubility (including but not limited to ammonium sulfate precipitation), or extraction.
- affinity chromatography anion- or cation-exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse
- Apparent molecular weight may be estimated by GPC by comparison to globular protein standards (PROTEIN PURIFICATION METHODS, A PRACTICAL APPROACH (Harris & Angal, Eds.) IRL Press 1989, 293-306).
- the purity of the PSMC-PEG conjugate can be assessed by proteolytic degradation (including but not limited to, trypsin cleavage) followed by mass spectrometry analysis.
- proteolytic degradation including but not limited to, trypsin cleavage
- a water soluble polymer linked to an amino acid of a PSMC of the invention can be further derivatized or substituted without limitation.
- an antigen-binding polypeptide is modified with a PEG derivative that contains an azide moiety that will react with an alkyne moiety present on the side chain of the non-naturally encoded amino acid.
- the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
- the azide-terminal PEG derivative will have the structure: RO-(CH 2 CH 2 0) n -0-(CH 2 ) m -N 3
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1 ,000 (i.e., average molecular weight is between 5-40 kDa).
- the azide-terminal PEG derivative will have the structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10 and n is 100-1 ,000 (i.e., average molecular weight is between 5-40 kDa).
- a PSMC comprising a alkyne- containing amino acid is modified with a branched PEG derivative that contains a terminal azide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
- PEG derivative will have the following structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10, and n is 100-
- an antigen-binding polypeptide is modified with a PEG derivative that contains an alkyne moiety that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid.
- the alkyne-terminal PEG derivative will have the following structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1 ,000 (i.e., average molecular weight is between 5-40 kDa).
- an antigen-binding polypeptide comprising an alkyne-containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal azide or terminal alkyne moiety that is linked to the PEG backbone by means of an amide linkage.
- the alkyne-terminal PEG derivative will have the following structure:
- R is a simple alkyl (methyl, ethyl, propyl, etc.)
- m is 2-10
- p is 2-10
- n is 100-1,000.
- an antigen-binding polypeptide comprising an azide-containing amino acid is modified with a branched PEG derivative that contains a terminal alkyne moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
- the alkyne-terminal PEG derivative will have the following structure:
- an antigen-binding polypeptide is modified with a PEG derivative that contains an activated functional group (including but not limited to, ester, carbonate) further comprising an aryl phosphine group that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid.
- the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
- the PEG derivative will have the structure:
- the PEG derivative will have the structure:
- R can be H, alkyl, aryl, substituted alkyl and substituted aryl groups.
- R groups include but are not limited to -CH 2 , -C(CH 3 ) 3 , -OR', -NR'R", -SR', -halogen, -C(0)R', - CONR'R", -S(0) 2 R', -S(0) 2 NR'R", -CN and -N0 2 .
- R', R", R'" and R" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups.
- each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present.
- R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring.
- -NR'R is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl.
- alkyl is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF 3 and -CH 2 CF 3 ) and acyl (including but not limited to, - C(0)CH 3 , -C(0)CF 3 , -C(0)CH 2 OCH 3 , and the like).
- PEG molecules that may be linked to antigen-binding polypeptides, as well as PEGylation methods include those described in, e.g., U.S. Patent
- PEG molecules described herein may be used in any form, including but not limited to, single chain, branched chain, multiarm chain, single functional, bi-functional, multi-functional, or any combination thereof.
- Various molecules can also be fused to the antigen-binding polypeptides of the invention to modulate the half-life of PSMC in serum.
- molecules are linked or fused to antigen-binding polypeptides of the invention to enhance affinity for endogenous serum albumin in an animal.
- albumin binding sequences include, but are not limited to, the albumin binding domain from streptococcal protein G (see. e.g., Makrides et al, J. Pharmacol. Exp. Ther. 277:534-542 (1996) and Sjolander et al, J Immunol. Methods 201 : 1 15-123 (1997)), or albumin-binding peptides such as those described in, e.g., Dennis, et al. , J. Biol. Chem. 277:35035-35043 (2002).
- the antigen-binding polypeptides of the present invention are acylated with fatty acids.
- the fatty acids promote binding to serum albumin. See, e.g. , Kurtzhals, et al , Biochem. J. 312:725-731 (1995).
- the antigen-binding polypeptides of the invention are fused directly with serum albumin (including but not limited to, human serum albumin).
- serum albumin including but not limited to, human serum albumin.
- the invention includes antigen-binding polypeptides incorporating one or more non-naturally encoded amino acids bearing saccharide residues.
- the saccharide residues may be either natural (including but not limited to, N-acetylglucosamine) or non-natural (including but not limited to, 3-fluorogalactose).
- the saccharides may be linked to the non- naturally encoded amino acids either by an N- or O-linked glycosidic linkage (including but not limited to, N-acetylgalactose-L-serine) or a non-natural linkage (including but not limited to, an oxime or the corresponding C- or S-linked glycoside).
- the saccharide (including but not limited to, glycosyl) moieties can be added to antigen-binding polypeptides either in vivo or in vitro.
- a nantigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified with a saccharide derivatized with an aminooxy group to generate the corresponding glycosylated polypeptide linked via an oxime linkage.
- the saccharide may be further elaborated by treatment with glycosyltransferases and other enzymes to generate an oligosaccharide bound to the antigen-binding polypeptide. See, e.g., H.
- an antigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified directly with a glycan with defined structure prepared as an aminooxy derivative.
- a glycan with defined structure prepared as an aminooxy derivative One skilled in the art will recognize that other functionalities, including azide, alkyne, hydrazide, hydrazine, and semicarbazide, can be used to link the saccharide to the non-naturally encoded amino acid.
- an antigen-binding polypeptide comprising an azide or alkynyl-containing non-naturally encoded amino acid can then be modified by, including but not limited to, a Huisgen [3+2] cycloaddition reaction with, including but not limited to, alkynyl or azide derivatives, respectively.
- This method allows for proteins to be modified with extremely high selectivity.
- the present invention also provides for PSMC combinations including but not limited to PSMC homodimers, heterodimers, homomultimers, or heteromultimers (i.e., trimers, tetramers, etc.) where a PSMC polypeptide containing one or more non-naturally encoded amino acids is bound to another PSMC or variant thereof or any other polypeptide that is non-PSMC polypeptide or variant thereof, either directly to the polypeptide backbone or via a linker.
- PSMC homodimers i.e., heterodimers, homomultimers, or heteromultimers (i.e., trimers, tetramers, etc.) where a PSMC polypeptide containing one or more non-naturally encoded amino acids is bound to another PSMC or variant thereof or any other polypeptide that is non-PSMC polypeptide or variant thereof, either directly to the polypeptide backbone or via a linker.
- the PSMC dimer or multimer conjugates may exhibit new or desirable properties, including but not limited to different pharmacological, pharmacokinetic, pharmacodynamic, modulated therapeutic half-life, or modulated plasma half-life relative to the monomeric PSMC.
- the PSMC dimers of the invention will modulate the dimerization of the PSMC receptor.
- the PSMC dimers or multimers of the present invention will act as a PSMC receptor antagonist, agonist, or modulator.
- one or more of PSMC present in a PSMC containing dimer or multimer comprises a non-naturally encoded amino acid linked to a water soluble polymer.
- the PSMCs are linked directly, including but not limited to, via an Asn-Lys amide linkage or Cys-Cys disulfide linkage.
- the linked PSMCs, and/or the linked non-PSMC polypeptide will comprise different non- naturally encoded amino acids to facilitate dimerization, including but not limited to, an alkyne in one non-naturally encoded amino acid of a first PSMC and an azide in a second non-naturally encoded amino acid of a second PSMC will be conjugated via a Huisgen [3+2] cycloaddition.
- a first PSMC, and/or the linked non-PSMC polypeptide comprising a ketone-containing non-naturally encoded amino acid can be conjugated to a second PSMC polypeptide comprising a hydroxylamine-containing non-naturally encoded amino acid and the polypeptides are reacted via formation of the corresponding oxime.
- the two PSMCs, and/or the linked non- PSMC polypeptide are linked via a linker.
- Any hetero- or homo-bifunctional linker can be used to link the two PSMCs, and/or the linked non- PSMC polypeptides, which can have the same or different primary sequence.
- the linker used to tether the PSMC, and/or the linked non- PSMC polypeptides together can be a bifunctional PEG reagent.
- the linker may have a wide range of molecular weight or molecular length. Larger or smaller molecular weight linkers may be used to provide a desired spatial relationship or conformation between the PSMC and the linked entity.
- Linkers having longer or shorter molecular length may also be used to provide a desired space or flexibility between the PSMC and the linked entity.
- a linker having a particular shape or conformation may be utilized to impart a particular shape or conformation to the PSMC or the linked entity, either before or after the PSMC reaches its target.
- the functional groups present on each end of the linker may be selected to modulate the release of a PSMC or a non-PSMC polypeptide under desired conditions. This optimization of the spatial relationship between the PSMC and the linked entity may provide new, modulated, or desired properties to the molecule.
- the invention provides water-soluble bifunctional linkers that have a dumbbell structure that includes: a) an azide, an alkyne, a hydrazine, a hydrazide, a hydroxylamine, or a carbonyl-containing moiety on at least a first end of a polymer backbone; and b) at least a second functional group on a second end of the polymer backbone.
- the second functional group can be the same or different as the first functional group.
- the second functional group in some embodiments, is not reactive with the first functional group.
- the invention provides, in some embodiments, water-soluble compounds that comprise at least one arm of a branched molecular structure.
- the branched molecular structure can be dendritic.
- the invention provides multimers comprising one or more PSMC formed by reactions with water soluble activated polymers that have the structure:
- n is from about 5 to 3,000, m is 2-10, X can be an azide, an alkyne, a hydrazine, a hydrazide, an aminooxy group, a hydroxylamine, a acetyl, or carbonyl-containing moiety, and R is a capping group, a functional group, or a leaving group that can be the same or different as X.
- R can be, for example, a functional group selected from the group consisting of hydroxyl, protected hydroxyl, alkoxyl, N-hydroxysuccinimidyl ester, 1 -benzotriazolyl ester, N-hydroxysuccinimidyl carbonate, 1 -benzotriazolyl carbonate, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, and tresylate, alkene, and ketone.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Oncology (AREA)
- Virology (AREA)
- AIDS & HIV (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Abstract
Novel polypeptide small molecule conjugates (PSMC) and uses thereof are provided.
Description
NOVEL POLYPEPTIDE SMALL MOLECULE CONJUGATES
AND THEIR USES
FIELD OF THE INVENTION
[0001] This invention relates to novel polypeptide small molecule conjugates comprising at least one non-naturally-encoded amino acid. The present invention relates generally to the field of the production and selection of antigen-binding and bispecific polypeptides by the methods of molecular biology, using both chemistry and recombinant DNA. BACKGROUND OF THE INVENTION
[0002] A naturally produced antibody (Ab) is a tetrameric structure consisting of two identical immunoglobulin (Ig) heavy chains and two identical light chains. The heavy and light chains of an Ab consist of different domains. Each light chain has one variable domain (VL) and one constant domain (CL), while each heavy chain has one variable domain (VH) and three or four constant domains (CH). Each domain, consisting of about 1 10 amino acid residues, is folded into a characteristic β-sandwich structure formed from two β-sheets packed against each other, the immunoglobulin fold. The VL domains each have three complementarity determining regions (CDRl-3) and the VH domains each have up to four complimentarity determining regions (CDRl-4), that are loops, or turns, connecting β-strands at one end of the domains. The variable regions of both the light and heavy chains generally contribute to antigen specificity, although the contribution of the individual chains to specificity is not necessarily equal. Antibody molecules have evolved to bind to a large number of molecules by using randomized CDR loops.
[0003] Functional substructures of Abs can be prepared by proteolysis and by recombinant methods. They include the Fab fragment, which comprises the VH-CH1 domains of the heavy chain and the VL-CL1 domains of the light chain joined by a single interchain disulfide bond, and the Fv fragment, which comprises only the VH and VL domains, and the Fc portion which comprises the non-antigen binding region of the molecule. In some cases, a single VH domain retains significant affinity for antigen (Ward et al., 1989, Nature 341 , 554-546). It has also been shown that a certain monomeric κ light chain will specifically bind to its antigen. (L. Masat et al., 1994, PNAS 91 :893-896). Separated light or heavy chains have sometimes been found to retain some antigen-binding activity as well (Ward et al., 1989, Nature 341 , 554-546).
[0004] Another functional substructure is a single chain Fv (scFv), comprised of the variable regions of the immunoglobulin heavy and light chain, covalently connected by a peptide linker (S-z Hu et al., 1996, Cancer Research, 56, 3055-3061). These small (Mr 25,000) proteins generally retain specificity and affinity for antigen in a single polypeptide and can provide a convenient building block for larger, antigen-specific molecules. The short half-life of scFvs in the circulation limits their therapeutic utility in many cases.
[0005] A small protein scaffold called a "minibody" was designed using a part of the
Ig VH domain as the template (Pessi et al., 1993, Nature 362, 367-369). Minibodies with high affinity (dissociation constant (¾) about 10"7 M) to interleukin-6 were identified by randomizing loops corresponding to CDR1 and CDR2 of VH and then selecting mutants using the phage display method (Martin et al., 1994, EMBO J. 13, 5303-5309).
[0006] Camels often lack variable light chain domains when IgG-like material from their serum is analyzed, suggesting that sufficient antibody specificity and affinity can be derived from VH domains (three or four CDR loops) alone. "Camelized" VH domains with high affinity have been made, and high specificity can be generated by randomizing only the CDR3.
[0007] An alternative to the "minibody" is the "diabody." Diabodies are small bivalent and bispecific antibody fragments, having two antigen-binding sites. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) on the same polypeptide chain (VH -VL). Diabodies are similar in size to the Fab fragment. By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. These dimeric antibody fragments, or "diabodies," are bivalent and bispecific. See, P. Holliger et al., PNAS 90:6444-6448 (1993).
[0008] CDR peptides and organic CDR mimetics have been made (Dougall et al.,
1994, Trends Biotechnol. 12, 372-379). CDR peptides are short, typically cyclic, peptides which correspond to the amino acid sequences of CDR loops of antibodies. CDR loops are responsible for antibody-antigen interactions. CDR peptides and organic CDR mimetics have been shown to retain some binding affinity (Smyth & von Itzstein, 1994, J. Am. Chem. Soc. 1 16, 2725-2733). Mouse CDRs have been grafted onto the human Ig framework without the loss of affinity (Jones et al., 1986, Nature 321 , 522-525; Riechmann et al., 1988).
[0009] In the body, specific Abs are selected and amplified from a large library
(affinity maturation). The processes can be reproduced in vitro using combinatorial library
technologies. The successful display of Ab fragments on the surface of bacteriophage has made it possible to generate and screen a vast number of CDR mutations (McCafferty et al., 1990, Nature 348, 552-554; Barbas et al., 1991, Proc. Natl. Acad. Sci. USA 88,7978-7982; Winter et al., 1994, Annu. Rev. Immunol. 12, 433-455). An increasing number of Fabs and Fvs (and their derivatives) are produced by this technique. The combinatorial technique can be combined with Ab mimics.
[0010] A number of protein domains that could potentially serve as protein scaffolds have been expressed as fusions with phage capsid proteins. Review in Clackson & Wells, Trends Biotechnol. 12: 173-184 (1994). Several of these protein domains have already been used as scaffolds for displaying random peptide sequences, including bovine pancreatic trypsin inhibitor (Roberts et al., PNAS 89:2429-2433 (1992)), human growth hormone (Lowman et al., Biochemistry 30: 10832-10838 (1991)), Venturini et al., Protein Peptide Letters 1 :70-75 (1994)), and the IgG binding domain of Streptococcus (O'Neil et al., Techniques in Protein Chemistry V (Crabb, L,. ed.) pp. 517-524, Academic Press, San Diego (1994)). These scaffolds have displayed a single randomized loop or region. Tendamistat has been used as a presentation scaffold on the filamentous phage Ml 3 (McConnell and Hoess, 1995, J. Mol. Biol. 250:460-470).
[0011] Receptor tyrosine kinases of the ErbB family play pivotal roles in cell growth and differentiation. Aberrant activation of these receptors is associated with human cancers. Dimerization (the pairing of receptors) is essential to the signaling activity of all ErbB receptors. Blocking the dimerization activity of ErbB 2 has been shown to directly inhibit the ability of ErbB2 to dimerize with other ErbB receptor proteins. Inhibiting receptor dimerization prevents the activation of ErbB signaling pathways. An antagonistic molecule that down regulates ErbB signaling could function as an anti-tumor agent. The ErbB signaling network is currently a major target in the development of anti-tumor drugs. ErbB-1 is a specific receptor for EGF, while ErbB-2 has no known natural ligand. ErbB2 is able to form heterodimers with ErbB-1 upon addition of EGF. ErbB2 also functions as the preferred dimerization partner for the kinase-dead ErbB-3 and for ErbB-4, which are both receptors for the neuregulins. The ErbB signaling network can also be activated in an indirect manner during signaling by cytokines and ligands of G-coupled protein receptors, indicating that it plays a central role in the growth control of many different cell types.
[0012] The proto-oncogene c-erbB-1 encodes the epidermal growth factor receptor.
Its name originates from the viral homolog v-erbB which was isolated from an avian
erythroblastosis virus (AEV) where it was contained as a fragment of the chicken c-ErbB-1 gene lacking the amino-terminal ligand-binding domain. Over expression of erbB-1 genes occurs in a wide range of tumors, including squamous carcinomas of various sites and adenocarcinomas. The human c-erbB-1 gene is located in the chromosomal region 7pl4 and 7pl2.
[0013] The ErbB-2 proto-oncogene (also referred to as Neu, EGFR-2 or HER-2) is a member of the transmembrane receptor tyrosine kinase family, which also includes EGF receptor and EGFR-3 (HER-3 or ErbB-3). ErbB-2 encodes a transmembrane receptor-like glycoprotein of 185 kDa with intrinsic tyrosine kinase activity. Although, ErbB-2 does not have any known high-affinity ligands, its kinase activity can be activated without ligand by either over expression or hetero-association with other members of the ErbB family of receptors. Amplification of the ErbB-2 gene and over expression of its product has been detected in almost 40% of primary human breast tumors. ErbB-2 over expression is also observed in ovarian, gastric, salivary and non-small cell lung carcinomas. ErbB-2 is activated by the neuregulins in heterodimers with the neuregulin receptors ErbB- 3 and ErbB- 4. The humanized anti-ErbB-2 monoclonal antibody Herceptin (from monoclonal 4D5) has received FDA approval for treatment of cancers that over express ErbB-2. Another anti- ErbB2 antibody in development is Pertuzumab (from monoclonal 2C4). Specific inhibitors of the tyrosine kinase activity of ErbB-1 (EGF receptor) are also in clinical trials.
[0014] Anti-ErbB2 antibodies are known in the art, and include but are not limited to
US Patent No.'s: 4,753,894; 5,169,774; 5,677,171 ; 5,720,937; 5,720,954; 5,725,856; 5,770,195; 5,772,997; 5,783,186; 6,054,561 ; 6, 165,464; 6,333,169; 6,015,567; 6,387,371 ; 6,399,063; 6,441,143; 6,458,356; 6,627,196, each of which is incorporated by reference herein.
[0015] Folate Receptor 1 (FOLRl), also known as Folate Receptor-alpha, or Folate Binding Protein, is an N-glycosylated protein expressed on plasma membrane of cells. FOLRl has a high affinity for folic acid and for several reduced folic acid derivatives. FOLRl mediates delivery of the physiological folate, 5 -methyltetrahydro folate, to the interior of cells.
[0016] FOLRl is overexpressed in vast majority of ovarian cancers, as well as in many uterine, endometrial, pancreatic, renal, lung, and breast cancers, while the expression of FOLRl on normal tissues is restricted to the apical membrane of epithelial cells in the kidney proximal tubules, alveolar pneumocytes of the lung, bladder, testes, choroid plexus, and
thyroid (Weitman S D, et al., Cancer Res 52: 3396-3401 (1992); Antony A C, Annu Rev Nutr 16: 501-521 (1996); Kalli K R, et al. Gynecol Oncol 108: 619-626 (2008)). This expression pattern of FOLR1 makes it a desirable target for FOLR1 -directed cancer therapy.
[0017] Because ovarian cancer is typically asymptomatic until advanced stage, it is often diagnosed at a late stage and has poor prognosis when treated with currently available procedures, typically chemotherapeutic drugs after surgical de-bulking (von Gruenigen V et al., Cancer 1 12: 2221 -2227 (2008); Ayhan A et al., Am J Obstet Gynecol 196: 81e81-86 (2007); Harry V N et al., Obstet Gynecol Surv 64: 548-560 (2009)). Thus there is a clear unmet medical need for more effective therapeutics for ovarian cancers.
[0018] Covalent attachment of the hydrophilic polymer poly(ethylene glycol), abbreviated PEG, is a method of increasing water solubility, bioavailability, increasing serum half-life, increasing therapeutic half-life, modulating immunogenicity, modulating biological activity, or extending the circulation time of many biologically active molecules, including proteins, peptides, and particularly hydrophobic molecules. PEG has been used extensively in pharmaceuticals, on artificial implants, and in other applications where biocompatibility, lack of toxicity, and lack of immunogenicity are of importance. In order to maximize the desired properties of PEG, the total molecular weight and hydration state of the PEG polymer or polymers attached to the biologically active molecule must be sufficiently high to impart the advantageous characteristics typically associated with PEG polymer attachment, such as increased water solubility and circulating half life, while not adversely impacting the bioactivity of the parent molecule.
[0019] PEG derivatives are frequently linked to biologically active molecules through reactive chemical functionalities, such as lysine, cysteine and histidine residues, the N- terminus and carbohydrate moieties. Proteins and other molecules often have a limited number of reactive sites available for polymer attachment. Often, the sites most suitable for modification via polymer attachment play a significant role in receptor binding, and are necessary for retention of the biological activity of the molecule. As a result, indiscriminate attachment of polymer chains to such reactive sites on a biologically active molecule often leads to a significant reduction or even total loss of biological activity of the polymer- modified molecule. R. Clark et al., (1996), J. Biol. Chem.. 271 :21969-21977. To form conjugates having sufficient polymer molecular weight for imparting the desired advantages to a target molecule, prior art approaches have typically involved random attachment of
numerous polymer arms to the molecule, thereby increasing the risk of a reduction or even total loss in bioactivity of the parent molecule.
[0020] Reactive sites that form the loci for attachment of PEG derivatives to proteins are dictated by the protein's structure. Proteins, including enzymes, are composed of various sequences of alpha-amino acids, which have the general structure H2N— CHR--COOH. The alpha amino moiety (H2N~) of one amino acid joins to the carboxyl moiety (— COOH) of an adjacent amino acid to form amide linkages, which can be represented as— (NH— CHR~CO)n --, where the subscript "n" can equal hundreds or thousands. The fragment represented by R can contain reactive sites for protein biological activity and for attachment of PEG derivatives.
[0021] For example, in the case of the amino acid lysine, there exists an— NH2 moiety in the epsilon position as well as in the alpha position. The epsilon ~NH2 is free for reaction under conditions of basic pH. Much of the art in the field of protein derivatization with PEG has been directed to developing PEG derivatives for attachment to the epsilon— NH2 moiety of lysine residues present in proteins. "Polyethylene Glycol and Derivatives for Advanced PEGylation", Nektar Molecular Engineering Catalog, 2003, pp. 1-17. These PEG derivatives all have the common limitation, however, that they cannot be installed selectively among the often numerous lysine residues present on the surfaces of proteins. This can be a significant limitation in instances where a lysine residue is important to protein activity, existing in an enzyme active site for example, or in cases where a lysine residue plays a role in mediating the interaction of the protein with other biological molecules, as in the case of receptor binding sites.
[0022] A second and equally important complication of existing methods for protein
PEGylation is that the PEG derivatives can undergo undesired side reactions with residues other than those desired. Histidine contains a reactive imino moiety, represented structurally as ~N(H)— , but many chemically reactive species that react with epsilon— NH2 can also react with— N(H)— . Similarly, the side chain of the amino acid cysteine bears a free sulfhydryl group, represented structurally as -SH. In some instances, the PEG derivatives directed at the epsilon— NH2 group of lysine also react with cysteine, histidine or other residues. This can create complex, heterogeneous mixtures of PEG-derivatized bioactive molecules and risks destroying the activity of the bioactive molecule being targeted. It would be desirable to develop PEG derivatives that permit a chemical functional group to be introduced at a single site within the protein that would then enable the selective coupling of one or more PEG
polymers to the bioactive molecule at specific sites on the protein surface that are both well- defined and predictable.
[0023] In addition to lysine residues, considerable effort in the art has been directed toward the development of activated PEG reagents that target other amino acid side chains, including cysteine, histidine and the N-terminus. See, e.g., U.S. Pat. No. 6,610,281 which is incorporated by reference herein, and "Polyethylene Glycol and Derivatives for Advanced PEGylation", Nektar Molecular Engineering Catalog, 2003, pp. 1-17. A cysteine residue can be introduced site-selectively into the structure of proteins using site-directed mutagenesis and other techniques known in the art, and the resulting free sulfhydryl moiety can be reacted with PEG derivatives that bear thiol-reactive functional groups. This approach is complicated, however, in that the introduction of a free sulfhydryl group can complicate the expression, folding and stability of the resulting protein. Thus, it would be desirable to have a means to introduce a chemical functional group into bioactive molecules that enables the selective coupling of one or more PEG polymers to the protein while simultaneously being compatible with (i.e., not engaging in undesired side reactions with) sulfhydryls and other chemical functional groups typically found in proteins.
[0024] As can be seen from a sampling of the art, many of these derivatives that have been developed for attachment to the side chains of proteins, in particular, the— NH2 moiety on the lysine amino acid side chain and the -SH moiety on the cysteine side chain, have proven problematic in their synthesis and use. Some form unstable linkages with the protein that are subject to hydrolysis and therefore decompose, degrade, or are otherwise unstable in aqueous environments, such as in the bloodstream. Some form more stable linkages, but are subject to hydrolysis before the linkage is formed, which means that the reactive group on the PEG derivative may be inactivated before the protein can be attached. Some are somewhat toxic and are therefore less suitable for use in vivo. Some are too slow to react to be practically useful. Some result in a loss of protein activity by attaching to sites responsible for the protein's activity. Some are not specific in the sites to which they will attach, which can also result in a loss of desirable activity and in a lack of reproducibility of results. In order to overcome the challenges associated with modifying proteins with poly(ethylene glycol) moieties, PEG derivatives have been developed that are more stable (e.g., U.S. Patent 6,602,498, which is incorporated by reference herein) or that react selectively with thiol moieties on molecules and surfaces (e.g., U.S. Patent 6,610,281, which is incorporated by reference herein). There is clearly a need in the art for PEG derivatives that are chemically
inert in physiological environments until called upon to react selectively to form stable chemical bonds.
[0025] Recently, an entirely new technology in the protein sciences has been reported, which promises to overcome many of the limitations associated with site-specific modifications of proteins. Specifically, new components have been added to the protein biosynthetic machinery of the prokaryote Escherichia coli (E. coli) (e.g., L. Wang, et al., (2001), Science 292:498-500) and the eukaryote Sacchromyces cerevisiae (S. cerevisiae) (e.g., J. Chin et al., Science 301 :964-7 (2003)), which has enabled the incorporation of non- genetically encoded amino acids to proteins in vivo. A number of new amino acids with novel chemical, physical or biological properties, including photoaffinity labels and photoisomerizable amino acids, keto amino acids, and glycosylated amino acids have been incorporated efficiently and with high fidelity into proteins in E. coli and in yeast in response to the amber codon, TAG, using this methodology. See, e.g., J. W. Chin et al., (2002), Journal of the American Chemical Society 124:9026-9027; J. W. Chin, & P. G. Schultz, (2002), ChemBioChem 1 1 : 1 135-1 137; J. W. Chin, et al., (2002), PNAS United States of America 99: 1 1020-1 1024; and, L. Wang, & P. G. Schultz, (2002), Chem. Comm., 1 -10. These studies have demonstrated that it is possible to selectively and routinely introduce chemical functional groups, such as ketone groups, alkyne groups and azide moieties, that are not found in proteins, that are chemically inert to all of the functional groups found in the 20 common, genetically-encoded amino acids and that may be used to react efficiently and selectively to form stable covalent linkages.
[0026] The ability to incorporate non-genetically encoded amino acids into proteins permits the introduction of chemical functional groups that could provide valuable alternatives to the naturally-occurring functional groups, such as the epsilon -NH2 of lysine, the sulfhydryl -SH of cysteine, the imino group of histidine, etc. Certain chemical functional groups are known to be inert to the functional groups found in the 20 common, genetically- encoded amino acids but react cleanly and efficiently to form stable linkages. Azide and acetylene groups, for example, are known in the art to undergo a Huisgen [3+2] cycloaddition reaction in aqueous conditions in the presence of a catalytic amount of copper. See, e.g., Tornoe, et al., (2002) Org. Chem. 67:3057-3064; and, Rostovtsev, et al., (2002) Angew. Chem. Int. Ed. 41 :2596-2599. By introducing an azide moiety into a protein structure, for example, one is able to incorporate a functional group that is chemically inert to amines, sulfhydryls, carboxylic acids, hydroxyl groups found in proteins, but that also reacts
smoothly and efficiently with an acetylene moiety to form a cycloaddition product. Importantly, in the absence of the acetylene moiety, the azide remains chemically inert and unreactive in the presence of other protein side chains and under physiological conditions.
[0027] The present invention addresses, among other things, problems associated with the activity and production of antigen-binding polypeptides and fragments thereof, and in particular polypeptide small molecule conjugates, and also addresses the production of antigen-binding polypeptides and polypeptide small molecule conjugates with improved biological or pharmacological properties, such as improved therapeutic half-life.
BRIEF SUMMARY OF THE INVENTION
[0028] This invention provides polypeptide small molecule conjugates (PSMC) comprising one or more non-naturally encoded amino acids. In some embodiments, the PSMC comprises a complete antibody heavy chain. In some embodiments, the PSMC comprises a complete antibody light chain. In some embodiments, the PSMC comprises a variable region of an antibody light chain. In some embodiments, the PSMC comprises a variable region of an antibody heavy chain. In some embodiments, the PSMC comprises at least one CDR of an antibody light chain. In some embodiments, the PSMC comprises at least one CDR of a PSMCantibody heavy chain. In some embodiments, the PSMC comprises at least one CDR of a light chain and at least one CDR of a heavy chain. In some embodiments, the PSMC comprises a Fab. In some embodiments, the PSMC comprises two or more Fab's. In some embodiments, the PSMC comprises a scFv. In some embodiments, the PSMC comprises two or more scFv. In some embodiments, the PSMC comprises a minibody. In some embodiments, the PSMC comprises two or more minibodies. In some embodiments, the PSMC comprises a diabody. In some embodiments, the PSMC comprises two or more diabodies. In some embodiments, the PSMC comprises a variable region of a light chain and a variable region of a heavy chain. In some embodiments, the PSMC comprises a complete light chain and a complete heavy chain. In some embodiments, the PSMC comprises one or more Fc domain or portion thereof. In some embodiments, the PSMC comprises a combination of any of the above embodiments. In some embodiments, the PSMC comprises a homodimer, heterodimer, homomultimer or heteromultimer of any of the above embodiments. In some embodiments, the PSMC comprises a polypeptide that binds to a binding partner wherein the binding partner comprises an antigen, a polypeptide, a nucleic acid molecule, a polymer, or other molecule or substance. In some embodiments, the PSMC is associated with a non-antibody scaffold molecule or substance.
[0029] In some embodiments, the PSMC comprises one or more post-translational modifications. In some embodiments, the PSMC is linked to a linker, polymer, or biologically active molecule. In some embodiments, the PSMC is linked to a bifunctional polymer, bifunctional linker, or at least one additional PSMC. In some embodiments, the PSMC is linked to a polypeptide that is not a PSMC. In some embodiments, an antigen- binding polypeptide comprising a non-naturally encoded amino acid is linked to one or more additional antigen-binding polypeptides which may also comprise a non-naturally encoded amino acid. In some embodiments, an antigen-binding polypeptide comprising a non- naturally encoded amino acid is linked to one or more polypeptide small molecule conjugates which may also comprise a non-naturally encoded amino acid. In some embodiments, a PSMC comprising a non-naturally encoded amino acid is linked to one or more additional antigen-binding polypeptides which may also comprise a non-naturally encoded amino acid.
[0030] In some embodiments, the non-naturally encoded amino acid is linked to a water soluble polymer. In some embodiments, the water soluble polymer comprises a poly(ethylene glycol) moiety. In some embodiments, the poly(ethylene glycol) molecule is a bifunctional polymer. In some embodiments, the bifunctional polymer is linked to a second polypeptide. In some embodiments, the second polypeptide is an antigen-binding polypeptide. In some embodiments, the second polypeptide is a PSMC.
[0031] In some embodiments, the antigen-binding polypeptide comprises at least two amino acids linked to a water soluble polymer comprising a poly(ethylene glycol) moiety. In some embodiments, at least one amino acid is a non-naturally encoded amino acid.
[0032] In some embodiments, the antigen-binding polypeptide comprises a substitution, addition or deletion that modulates affinity of the antigen-binding polypeptide for an antigen when compared with the affinity of the corresponding antigen-binding polypeptide without the substitution, addition or deletion. In some embodiments, the antigen- binding polypeptide comprises a substitution, addition, or deletion that increases the stability of the antigen-binding polypeptide when compared with the stability of the corresponding antigen-binding polypeptide without the substitution, addition or deletion. In some embodiments, the antigen-binding polypeptide comprises a substitution, addition, or deletion that modulates the immunogenicity of the antigen-binding polypeptide when compared with the immunogenicity of the corresponding antigen-binding polypeptide without the substitution, addition or deletion. In some embodiments, the antigen-binding polypeptide comprises a substitution, addition, or deletion that modulates serum half-life or circulation
time of the antigen-binding polypeptide when compared with the serum half-life or circulation time of the corresponding antigen-binding polypeptide without the substitution, addition or deletion.
[0033] some embodiments, the antigen-binding polypeptide comprises substitution, addition, or deletion that increases the aqueous solubility of the corresponding antigen-binding polypeptide when compared to the aqueous solubility of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion. In some embodiments, the antigen-binding polypeptide comprises a substitution, addition, or deletion that increases the solubility of the antigen-binding polypeptide produced in a host cell when compared to the solubility of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion. In some embodiments, the antigen-binding polypeptide comprises a substitution, addition, or deletion that increases the expression of the antigen- binding polypeptide in a host cell or synthesized in vitro when compared to the expression of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion. In some embodiments, the antigen-binding polypeptide comprises a substitution, addition, or deletion that increases protease resistance of the antigen-binding polypeptide when compared to protease resistance of the corresponding antigen-binding polypeptide without the substitution, addition, or deletion.
[0034] In some embodiments the amino acid substitutions in the PSMC may be with naturally occurring or non-naturally occurring amino acids, provided that at least one substitution is with a non-naturally encoded amino acid.
[0035] In some embodiments, the non-naturally encoded amino acid comprises a carbonyl group, an acetyl group, an aminooxy group, a hydrazine group, a hydrazide group, a semicarbazide group, an azide group, or an alkyne group.
[0036] In some embodiments, the non-naturally encoded amino acid comprises a carbonyl group. In some embodiments, the non-naturally encoded amino acid has the structure:
wherein n is 0-10; R\ is an alkyl, aryl, substituted alkyl, or substituted aryl; R2 is H, an alkyl, aryl, substituted alkyl, and substituted aryl; and R3 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R4 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
[0037] In some embodiments, the non-naturally encoded amino acid comprises an aminooxy group. In some embodiments, the non-naturally encoded amino acid comprises a hydrazide group. In some embodiments, the non-naturally encoded amino acid comprises a hydrazine group. In some embodiments, the non-naturally encoded amino acid residue comprises a semicarbazide group.
[0038] In some embodiments, the non-naturally encoded amino acid residue comprises an azide group. In some embodiments, the non-naturally encoded amino acid has the structure:
wherein n is 0-10; R\ is an alkyl, aryl, substituted alkyl, substituted aryl or not present; X is O, N, S or not present; m is 0-10; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
[0039] In some embodiments, the non-naturally encoded amino acid comprises an alkyne group. In some embodiments, the non-naturally encoded amino acid has the structure:
wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl; X is O, N, S or not present; m is 0-10, R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
[0040] In some embodiments, the polypeptide is an agonist, partial agonist, antagonist, partial antagonist, or inverse agonist of at least one activity of the antigen. In some embodiments, the agonist, partial agonist, antagonist, partial antagonist, or inverse agonist comprises a non-naturally encoded amino acid linked to a water soluble polymer. In some embodiments, the water soluble polymer comprises a poly(ethylene glycol) moiety. In some embodiments, the agonist, partial agonist, antagonist, partial antagonist, or inverse agonist comprises a non-naturally encoded amino acid and one or more post-translational modification, linker, polymer, or biologically active molecule.
[0041] The present invention also provides isolated nucleic acids comprising a polynucleotide that encodes an antigen-binding polypeptide wherein the polynucleotide
comprises at least one selector codon including, but not limited to, SEQ ID NO: 19, 21 , or a fragment thereof. The present invention also provides isolated nucleic acids comprising a polynucleotide that encodes an antigen-binding polypeptide wherein the polynucleotide comprises at least one selector codon including, but not limited to, SEQ ID NO: 19, SEQ ID NO: 21. In some embodiments, the selector codon is selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, and a four-base codon.
[0042] For the purposes of the present invention, it should be appreciated that modified antibodies can comprise any type of variable region that provides for the association of the antibody with the polypeptides of a human FOLR1. In this regard, the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen. As such, the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g. cynomolgus monkeys, macaques, etc.) or lupine origin. In some embodiments both the variable and constant regions of the modified immunoglobulins are human. In other embodiments the variable regions of compatible antibodies (usually derived from a non-human source) can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule. In this respect, variable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
[0043] In certain embodiments, the variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing. Although the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and in certain embodiments from an antibody from a different species. It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the antigen binding site. Given the explanations set forth in U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, it will be well within the competence of those skilled in the art, either by carrying out routine experimentation or by trial and error testing to obtain a functional antibody with reduced immunogenicity.
[0044] Alterations to the variable region notwithstanding, those skilled in the art will appreciate that the modified antibodies of this invention will comprise antibodies (e.g., full- length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region. In some embodiments, the constant region of the modified antibodies will comprise a human constant region. Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains. That is, the modified antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL). In some embodiments, modified constant regions wherein one or more domains are partially or entirely deleted are contemplated. In some embodiments, the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs). In some embodiments, the omitted constant region domain will be replaced by a short amino acid spacer (e.g. 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
[0045] Besides their configuration, it is known in the art that the constant region mediates several effector functions. For example, binding of the CI component of complement to antibodies activates the complement system. Activation of complement is important in the opsonisation and lysis of cell pathogens. The activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity. Further, antibodies bind to cells via the Fc region, with a Fc receptor site on the antibody Fc region binding to a Fc receptor (FcR) on a cell. There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (eta receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of antibody to Fc receptors on cell surfaces triggers a number of important and diverse biological responses including engulfment and destruction of antibody-coated particles, clearance of immune complexes, lysis of antibody-coated target cells by killer cells (called antibody-dependent cell-mediated cytotoxicity, or ADCC), release of inflammatory mediators, placental transfer and control of immunoglobulin production.
[0046] The present invention also provides methods of making an antigen-binding polypeptide linked to a water soluble polymer. In some embodiments, the method comprises contacting an isolated antigen-binding polypeptide comprising a non-naturally encoded amino acid with a water soluble polymer comprising a moiety that reacts with the non- naturally encoded amino acid. In some embodiments, the non-naturally encoded amino acid incorporated into the antigen-binding polypeptide is reactive toward a water soluble polymer that is otherwise unreactive toward any of the 20 common amino acids. In some embodiments, the non-naturally encoded amino acid incorporated into the antigen-binding polypeptide is reactive toward a linker, polymer, or biologically active molecule that is otherwise unreactive toward any of the 20 common amino acids.
[0047] In some embodiments, the antigen-binding polypeptide linked to the water soluble polymer is made by reacting an antigen-binding polypeptide comprising a carbonyl- containing amino acid with a poly(ethylene glycol) molecule comprising an aminooxy, hydrazine, hydrazide or semicarbazide group. In some embodiments, the aminooxy, hydrazine, hydrazide or semicarbazide group is linked to the poly(ethylene glycol) molecule through an amide linkage.
[0048] In some embodiments, the antigen-binding polypeptide linked to the water soluble polymer is made by reacting a poly(ethylene glycol) molecule comprising a carbonyl group with a polypeptide comprising a non-naturally encoded amino acid that comprises an aminooxy, hydrazine, hydrazide or semicarbazide group.
[0049] In some embodiments, the antigen-binding polypeptide linked to the water soluble polymer is made by reacting an antigen-binding polypeptide comprising an alkyne- containing amino acid with a poly(ethylene glycol) molecule comprising an azide moiety. In some embodiments, the azide or alkyne group is linked to the poly(ethylene glycol) molecule through an amide linkage.
[0050] In some embodiments, the antigen-binding polypeptide linked to the water soluble polymer is made by reacting an antigen-binding polypeptide comprising an azide- containing amino acid with a poly(ethylene glycol) molecule comprising an alkyne moiety. In some embodiments, the azide or alkyne group is linked to the poly(ethylene glycol) molecule through an amide linkage.
[0051] In some embodiments, the poly(ethylene glycol) molecule has a molecular weight of between about 0.1 kDa and about 100 kDa. In some embodiments, the poly(ethylene glycol) molecule has a molecular weight of between 0.1 kDa and 50 kDa.
[0052] In some embodiments, the poly(ethylene glycol) molecule is a branched polymer. In some embodiments, each branch of the poly(ethylene glycol) branched polymer has a molecular weight of between 1 kDa and 100 kDa, or between 1 kDa and 50 kDa.
[0053] In some embodiments, the water soluble polymer linked to the antigen-binding polypeptide comprises a polyalkylene glycol moiety. In some embodiments, the non- naturally encoded amino acid residue incorporated into the antigen-binding polypeptide comprises a carbonyl group, an aminooxy group, a hydrazide group, a hydrazine, a semicarbazide group, an azide group, or an alkyne group. In some embodiments, the non- naturally encoded amino acid residue incorporated into the PSMC comprises a carbonyl moiety and the water soluble polymer comprises an aminooxy, hydrazide, hydrazine, or semicarbazide moiety. In some embodiments, the non-naturally encoded amino acid residue incorporated into the antigen-binding polypeptide comprises an alkyne moiety and the water soluble polymer comprises an azide moiety. In some embodiments, the non-naturally encoded amino acid residue incorporated into the antigen-binding polypeptide comprises an azide moiety and the water soluble polymer comprises an alkyne moiety.
[0054] The present invention also provides compositions comprising an antigen- binding polypeptide comprising a non-naturally-encoded amino acid and a pharmaceutically acceptable carrier. In some embodiments, the non-naturally encoded amino acid is linked to a water soluble polymer.
[0055] The present invention also provides cells comprising a polynucleotide encoding the antigen-binding polypeptide comprising a selector codon. In some embodiments, the cells comprise an orthogonal RNA synthetase and/or an orthogonal tRNA for substituting a non-naturally encoded amino acid into the antigen-binding polypeptide.
[0056] The present invention also provides methods of making an antigen-binding polypeptide comprising a non-naturally encoded amino acid. In some embodiments, the methods comprise culturing cells comprising a polynucleotide or polynucleotides encoding an antigen-binding polypeptide, an orthogonal RNA synthetase and/or an orthogonal tRNA under conditions to permit expression of the antigen-binding polypeptide; and purifying the antigen-binding polypeptide from the cells and/or culture medium.
[0057] The present invention also provides methods of increasing therapeutic half- life, serum half-life or circulation time of the antigen-binding polypeptides. The present invention also provides methods of modulating immunogenicity of the antigen-binding polypeptides. In some embodiments, the methods comprise substituting a non-naturally
encoded amino acid for any one or more amino acids in naturally occurring antigen-binding polypeptides and/or linking the antigen-binding polypeptide to a linker, a polymer, a water soluble polymer, or a biologically active molecule.
[0058] The present invention also provides methods of treating a patient in need of such treatment with an effective amount of an antigen-binding polypeptide of the present invention. In some embodiments, the methods comprise administering to the patient a therapeutically-effective amount of a pharmaceutical composition comprising an antigen- binding polypeptide comprising a non-naturally-encoded amino acid and a pharmaceutically acceptable carrier. In some embodiments, the non-naturally encoded amino acid is linked to a water soluble polymer.
[0059] The present invention also provides antigen-binding polypeptides comprising a sequence shown in SEQ ID NO: 18, 20, fragments thereof, or polynucleotides, in whole or in part, in SEQ ID NO: 19, 21 , and fragments thereof, or any other antigen-binding polypeptide sequence, except that at least one amino acid is substituted by a non-naturally encoded amino acid. In some embodiments, the non-naturally encoded amino acid is linked to a water soluble polymer. In some embodiments, the water soluble polymer comprises a poly(ethylene glycol) moiety. In some embodiments, the non-naturally encoded amino acid comprises a carbonyl group, an aminooxy group, a hydrazide group, a hydrazine group, a semicarbazide group, an azide group, or an alkyne group.
[0060] The present invention also provides pharmaceutical compositions comprising a pharmaceutically acceptable carrier and an antigen-binding polypeptide comprising the sequence shown in SEQ ID NO: 18, 20. The present invention also provides pharmaceutical compositions comprising a polypeptide encoded by the polynucleotides and a pharmaceutically acceptable carrier wherein the antigen-binding polypeptide is encoded by the sequence shown in SEQ ID NO: 19, 21. The present invention also provides for an antigen-binding polypeptide comprising the sequence of SP34 with a non-naturally encoded amino acid. The present invention also provides for an antigen-binding polypeptide comprising the sequence of Mabtech CD3-1 with a non-naturally encoded amino acid. The present invention also provides for an antigen-binding polypeptide comprising the sequence of SP34 with more than one non-naturally encoded amino acid. The present invention also provides for an antigen-binding polypeptide comprising the sequence of Mabtech CD3-1 with more than one non-naturally encoded amino acid. The present invention also provides pharmaceutical compositions comprising a pharmaceutically acceptable carrier and an
antigen-binding polypeptide comprising the sequence shown in SEQ ID NO: 18, 20, fragments thereof, or polynucleotides, in whole or in part, in SEQ ID NO: 19, 21 , and fragments thereof, or any other antigen-binding polypeptide sequence, wherein at least one amino acid is substituted by a non-naturally encoded amino acid. In some embodiments, the non-naturally encoded amino acid comprises a saccharide moiety. In some embodiments, the water soluble polymer is linked to the polypeptide via a saccharide moiety. In some embodiments, a linker, polymer, or biologically active molecule is linked to the antigen- binding polypeptide via a saccharide moiety.
[0061] The present invention also provides an antigen-binding polypeptide comprising a water soluble polymer linked by a covalent bond to the antigen-binding polypeptide at a single amino acid. In some embodiments, the water soluble polymer comprises a poly(ethylene glycol) moiety. In some embodiments, the amino acid covalently linked to the water soluble polymer is a non-naturally encoded amino acid present in the polypeptide.
[0062] The present invention provides an antigen-binding polypeptide comprising at least one linker, polymer, or biologically active molecule, wherein said linker, polymer, or biologically active molecule is attached to the polypeptide through a functional group of a non-naturally encoded amino acid ribosomally incorporated into the polypeptide. In some embodiments, the polypeptide is monoPEGylated. The present invention also provides a PSMC polypeptide comprising a linker, polymer, or biologically active molecule that is attached to one or more non-naturally encoded amino acid wherein said non-naturally encoded amino acid is ribosomally incorporated into the polypeptide at pre-selected sites.
[0063] In another embodiment, conjugation of the antigen-binding polypeptide comprising one or more non-naturally occurring amino acids to another molecule, including but not limited to PEG, provides substantially purified antigen-binding polypeptide due to the unique chemical reaction utilized for conjugation to the non-natural amino acid. Conjugation of the antigen-binding polypeptide comprising one or more non-naturally encoded amino acids to another molecule, such as PEG, may be performed with other purification techniques performed prior to or following the conjugation step to provide substantially pure antigen- binding polypeptide.
BRIEF DESCRIPTION OF THE DRAWINGS
[0064] Figure 1 - A diagram of the general structure of an antibody molecule (IgG) and its antigen-binding portions is shown. The CDR's are contained within the antigen recognition site.
[0065] Figure 2 - Constructs used for periplasmic (Figure 2, Panel A) and cytoplasmic (Figure 2, Panel B) expression/suppression of scFv-108 are shown. Locations of the amber stop codons are indicated. Bicistronic cassette used for expression/suppression of the Fab- 108 fragment (Figure 2, Panel C) is shown. Constructs used for periplasmic expression suppression of scFv-4D5 fragments are shown (Figure 2, Panel D and Panel E). A cistron for expression/suppression of Fab-4D5 fragment is shown (Figure 2, Panel F).
[0066] Figure 3 - Suppression (Figure 3, Panel A) of amber mutations in the second serine of the GlySer linker (S 131Am) and analysis of IMAC purification of the corresponding pAcF-containing scFv (Figure.3, Panel B) are shown.
[0067] Figure 4 - Suppression of an amber mutation in the VL chain (LI 56) during cytoplasmic expression of a scFv is shown.
[0068] Figure 5 - PEGylation and dimerization of pAcF-scFv-108 fragments is shown in Figure 5, Panel A. Position , of the mono-PEGylated scFv and the dimer are indicated by the single and double arrowheads respectively. Figure 5, Panel B shows PEGylation of pAcF-scFv-108 fragment-(S136). Figure 5, Panel C shows that no PEGylation of WT scFv fragments was observed.
[0069] Figure 6 - A gel showing fractions taken during purification of scFv-108 homodimers is shown.
[0070] Figure 7 - Binding of pAcF or pAcF-PEG-containing scFv proteins to A431 cells expressing EGF receptors are shown in Figure 7, Panels A-C.
[0071] Figure 8 - A gel showing pAcF and pAcF-PEG-containing Fab fragments of mAb 108 is shown as Figure 8, Panel A. Binding of Fab fragments of mAb 108 to A431 cells expressing EGF receptors are shown in Figure 8, Panels B-D.
[0072] Figure 9 - An example of a hetero-bifunctional PSMC of the present invention is shown.
[0073] Figure 10 - Gels showing the suppression of an amber mutation in the second serine of the GlySer linker of the C-terminal (Figure 10, Panel A) or N-terminal scFv-4D5 (Figure 10, Panel B) fragments are shown.
[0074] Figure 1 1 - SDS-PAGE analysis is shown of pAcF-Fab-4D5-(K139) and Fab-
4D5-cys under both reducing and non-reducing conditions (Figure 1 1 , Panel A). Figure 1 1 , Panel B shows a Western blot of the samples shown in Figure 1 1 , Panel A with an anti-His antibody.
[0075] Figure 12 - HIV-l neutralizing human Fab 4E10 linked to peptide T20 is shown.
[0076] Figure 13 - A diagram of a dimerization procedure is shown.
[0077] Figure 14 - Non-reducing (Figure 14, Panel A) and reducing (Figure 14, Panel
B) SDS-PAGE analysis of scFv dimer formation is shown.
[0078] Figure 15 - SDS-PAGE analysis of purified scFv dimer is shown.
[0079] Figure 16 - Shows the T cell engagement of target cells and dose-dependent toxicity by anti-CD3 Fab-folate. Figure 16 (A) is a graph of the dose-dependent T cell- mediated cytotoxicity with KB (FR+), OV-90 (FR+) and CAKI-1 (FR-) cells treated with anti-CD3 Fab-folate in the presence of activated human PBMCs (ratio 1 : 10 of target: effector cells). Increasing concentrations of anti-CD3 Fab-folate or unconjugated anti-CD3 Fab were incubated with target cells for 12-24h at 37°C and 5% C02. Cytotoxicity was quantitated by measuring LDH levels released from lysed cells according to manufacturer's protocol (Cytotox 96 nonradioactive cytotoxicity assay, Promega). Figure 16 (B) shows SKOV-3 cells maintained in folate-free RPMI-1640 medium supplemented with 10% FBS for at least three passages before being seeded in a 48-well cell culture plate and allowed to attach to plate, after which activated human PBMCs (ratio 1 : 10 of target: effector cells) were added. Anti-CD3 Fab or anti-CD3 Fab-folate were diluted in folate-free medium and added at the indicated concentration and the co-culture was incubated for 16 hours. Images were taken with a 25x objective microscope.
[0080] Figure 17 - The in vivo efficacy of the anti-CD3 Fab-folate bispecific agent was assessed in a xenograft model using female NOD-SCID mice. Animals were maintained on a low-folate diet to reduce circulating serum levels of folate that might compete with the bispecific agent. KB (FR+) or A549 (FR-) cells were able to form tumors when mixed with non-activated human PBMCs (ratio 1 : 100 of target: effector cells) or activated human PBMCs (ratio 1 : 10 of target: effector cells) and injected subcutaneously into mice. KB cells mixed with activated human PBMCs (ratio 1 : 10 of target: effector cells) were implanted into mice and then the mice were injected intravenously with 1.5mg/kg of anti-CD3 Fab-folate or PBS daily for 10 days starting on the same day as tumor cell implantation. Figure 17 (A)
shows tumor volumes from this experiment. The tumor volume showed a rapid increase in PBS treated mice with a doubling time of approximately 5 days. In contrast, tumors in mice treated with anti-CD3 Fab-folate were barely detectable throughout the duration of the study. In a parallel study, mice were implanted with KB cells mixed with unactivated human PBMCs (ratio 1 : 100 of target: effector cells) and treated intravenously with 1.5mg/kg of anti- CD3 Fab-folate or PBS daily for 10 days starting on the same day as tumor cell implantation. Figure 17 (B) shows tumor volumes from the 1 : 100 target: effector cell experiment. The rate of decrease of the tumors was higher in anti-CD3 Fab-folate treated mice. After day 35 of the study, the tumors in PBS treated mice steadily increased in volume while tumors in the anti- CD3 Fab-folate treated mice decreased to barely detectable levels indicating the engagement of cytotoxic T cells for the elimination of the tumors by the anti-CD3 Fab-folate conjugate even in the absence of activated T cells. Figure 17 (C) shows a graphical representation of the change in body weight in the mice from both treatment groups. Figure 17 (D) shows the serum concentration over time of rats in three test groups: those injected with 1 mg/kg anti- CD3Fab-folate; those injected with 5 mg/kg anti-CD3Fab-folate; and those injected with 1 mg/kg anti-CD3Fab. Serum was collected at regular intervals and analyzed by ELISA. The serum concentration decreased for both anti-CD3 Fab-folate and the corresponding unconjugated mutant anti-CD3 Fab at the same rate with a serum half-life of 60 mins.
[0081] Figure 18 - Shows the binding of folate conjugates to FR and CD3. Figure 18 (A) is a graphical representation of the binding of Folate-CF488 to KB cells (FR+) but not to A549 cells (FR-) analyzed by competition with free folate. Cells were incubated with media containing increasing concentrations of the conjugate and 100 nM folate for 30 mins at 4°C and cell bound fluorescence was analyzed by flow cytometry. Figure 18 (B) is a graphical representation of the binding of anti-CD3 Fab-CF488 to Jurkat cells (CD3+) but not to KB cells (CD3-). Cells were incubated with increasing concentrations of the conjugate for 30 mins at 4°C and binding was analyzed by flow cytometry.
[0082] Figure 19 - Shows the T cell mediated toxicity of the anti-CD3 Fab-folate conjugate by two independent cytotoxicity assays. Dose-dependent T cell-mediated cytotoxicity with KB cells (FR+) but not A549 cells (FR-) treated with anti-CD3 Fab-folate in the presence of non-activated human PBMCs (ratio 1 : 10 of target: effector cells). Increasing concentrations of anti-CD3 Fab-folate were incubated with target cells for 12-24h at 37°C and 5% C02. In Figure 19 (A) the cells were labeled with DIO (green plasma membrane stain) and Propidium iodide was added to a final concentration of 1 μg/mL.
Cytotoxicity was measured by flow cytometry. Figure 19 (B) shows a graphical representation of PBMCs that were washed off after 24hrs and ATP content of KB cells was measured using Cell Titer Glo (Promega).
[0083] Figure 20 - Shows a graphical representation of the in vivo efficacy of the anti-CD3 -folate conjugated ADC in an ovarian cancer model. Female NOD-SCID xenograft model mice were maintained on a low-folate diet to reduce circulating serum levels of folate that might compete with the bispecific agent. OV-90 (FR+) cells were able to form tumors when mixed with non-activated human PBMCs (ratio 1 : 100 of target: effector cells) or activated human PBMCs (ratio 1 : 10 of target: effector cells) and injected subcutaneously into mice. OV-90 (FR+) cells mixed with activated human PBMCs (ratio 1 : 10 of target: effector cells) were implanted into mice and then the mice were split into different treatment groups and intravenously injected daily for five days following cell implantation. Group 1 was a control group and was injected with vehicle (pbs); Group 2 was injected with 0.05 mg/kg Folate-anti-CD3; Group 3 was injected with 0.5 mg/kg Folate-anti-CD3; Group , 1.5mg/kg of anti-CD3 Fab-folate; Group 4 was injected with 5 mg/kg Folate-anti-CD3; Group 5 was injected with 5 mg/kg unconjugated anti-CD3. Figure 20 (A) shows tumor volumes from this experiment. Further, the tumor volume showed a dose dependent response to the folate conjugated anti-CD3 rapid increase in PBS and unconjugated anti-CD3 treated mice. Figure 20 (B) shows a graphical representation of the change in body weight in the mice from each of the treatment groups
[0084] Figure 21 - Shows a graphical representation of the percent survival in the
NOD-SCID xenograft model of combined tumor treatment, OV-90 + SKOV when treated with Group 1 vehicle (PBS); Group 2 three injections administered following day 17 of tumor implantation; and Group 3 three injections administered on the days immediately following tumor implantation.
[0085] Figure 22 - Shows a graphical representation of the percent cytotoxicity measured in NCI-H838 cells and KB cells as shown in Figures 22 and 23 when administered with an excess of folic acid.
[0086] Figure 23 - Shows a graphical representation of the percent cytotoxicity in each of theFOLR expressing cells groups (Group 1 : NCI-H1651 ; Group 2: NCI-H2405; Group 3: NCI-H838; Group 4: NCI-H2347; Group 5: KB). The cytotoxicity was measured at varying concentrations of conjugated UCHTl -folate (in this example comprising SEQ ID NO: 18 and/or 20) measured in ng/mL. The EC50 for each of the respective test groups is
shown. Group 1 : NCI-H1651 EC50 0.22 ng/mL; Group 2: NCI-H2405 EC50 1.48 ng/mL; Group 3: NCI-H838 EC50 0.36 ng/mL; Group 4: NCI-H2347 EC50 .30 ng/mL; Group 5: KB EC50 0.024 ng/mL
DEFINITIONS
[0087] It is to be understood that this invention is not limited to the particular methodology, protocols, cell lines, constructs, and reagents described herein and as such may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which will be limited only by the appended claims.
[0088] As used herein and in the appended claims, the singular forms "a," "an," and
"the" include plural reference unless the context clearly indicates otherwise. Thus, for example, reference to an "polypeptide small molecule conjugate" or "PSMC" is a reference to one or more such proteins and includes equivalents thereof known to those skilled in the art, and so forth.
[0089] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this invention belongs. Although any methods, devices, and materials similar or equivalent to those described herein can be used in the practice or testing of the invention, the preferred methods, devices and materials are now described.
[0090] All publications and patents mentioned herein are incorporated herein by reference for the purpose of describing and disclosing, for example, the constructs and methodologies that are described in the publications, which might be used in connection with the presently described invention. The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior invention or for any other reason.
[0091] The term "substantially purified" refers to a PSMC that may be substantially or essentially free of components that normally accompany or interact with the protein as found in its naturally occurring environment, i.e. a native cell, or host cell in the case of recombinantly produced PSMC. PSMC that may be substantially free of cellular material includes preparations of protein having less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than about 1% (by dry weight) of
contaminating protein. When the PSMC or variant thereof is recombinantly produced by the host cells, the protein may be present at about 30%, about 25%, about 20%, about 15%, about 10%, about 5%, about 4%, about 3%, about 2%, or about 1% or less of the dry weight of the cells. When the PSMC or variant thereof is recombinantly produced by the host cells,, the protein may be present in the culture medium at about 5g/L, about 4g/L, about 3g/L, about 2g/L, about lg/L, about 750mg/L, about 500mg/L, about 250mg/L, about lOOmg/L, about 50mg/L, about l Omg/L, or about lmg/L or less of the dry weight of the cells. Thus, "substantially purified" PSMC as produced by the methods of the present invention may have a purity level of at least about 30%, at least about 35%, at least about 40%o, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, specifically, a purity level of at least about 75%, 80%», 85%>, and more specifically, a purity level of at least about 90%, a purity level of at least about 95%, a purity level of at least about 99%) or greater as determined by appropriate methods such as SDS/PAGE analysis, RP-HPLC, SEC, and capillary electrophoresis.
[0092] A "recombinant host cell" or "host cell" refers to a cell that includes an exogenous polynucleotide, regardless of the method used for insertion, for example, direct uptake, transduction, f-mating, or other methods known in the art to create recombinant host cells. The exogenous polynucleotide may be maintained as a nonintegrated vector, for example, a plasmid, or alternatively, may be integrated into the host genome.
[0093] As used herein, the term "medium" or "media" includes any culture medium, solution, solid, semi-solid, or rigid support that may support or contain any host cell, including bacterial host cells, yeast host cells, insect host cells, plant host cells, eukaryotic host cells, mammalian host cells, CHO cells or E. coli, and cell contents. Thus, the term may encompass medium in which the host cell has been grown, e.g., medium into which the PSMC has been secreted, including medium either before or after a proliferation step. The term also may encompass buffers or reagents that contain host cell lysates, such as in the case where the PSMC is produced intracellularly and the host cells are lysed or disrupted to release the PSMC.
[0094] "Reducing agent," as used herein with respect to protein refolding, is defined as any compound or material which maintains sulfhydryl groups in the reduced state and reduces intra- or intermolecular disulfide bonds. Suitable reducing agents include, but are not limited to, dithiothreitol (DTT), 2-mercaptoethanol, dithioerythritol, cysteine, cysteamine (2- aminoethanethiol), and reduced glutathione. It is readily apparent to those of ordinary skill
in the art that a wide variety of reducing agents are suitable for use in the methods and compositions of the present invention.
[0095] The terms "human folate receptor 1" or "FOLRl", as used herein, refers to any native human FOLRl, unless otherwise indicated. The term "FOLRl" encompasses "full-length," unprocessed FOLRl as well as any form of FOLRl that results from processing within the cell. The term also encompasses naturally occurring variants of FOLRl , e.g., splice variants, allelic variants and isoforms. The FOLRl polypeptides described herein can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods. Examples of FOLRl sequences include, but are not limited to NCBI reference numbers P15328, NP_001092242.1, AAX29268.1 , AAX371 19.1 , NP_057937.1 , and NP_057936.1.
[0096] The term "anti-FOLRl antibody" or "an antibody that binds to FOLRl" refers to an antibody that is capable of binding FOLRl with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting FOLRl . The extent of binding of an anti-FOLRl antibody to an unrelated, non-FOLRl protein is less than about 10% of the binding of the antibody to FOLRl as measured, e.g., by a radioimmunoassay (RIA). In certain embodiments, an antibody that binds to FOLRl has a dissociation constant (Kd) of ≤1 μΜ,≤100 nM,≤10 nM,≤1 nM, or≤0.1 nM.
[0097] The term "antibody fragment" refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
[0098] A "monoclonal antibody" refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants. The term "monoclonal antibody" encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site. Furthermore, "monoclonal antibody" refers to such antibodies made in any number of manners including but not limited to by hybridoma, phage selection, recombinant expression, and transgenic animals.
[0099] The term "humanized antibody" refers to foams of non-human (e.g. murine) antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences. Typically, humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g. mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability (Jones et al., 1986, Nature, 321 :522-525; Riechmann et al., 1988, Nature, 332:323-327; Verhoeyen et al., 1988, Science, 239: 1534-1536). In some instances, the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, affinity, and capability. The humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability. In general, the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pat. No. 5,225,539 or 5,639,641.
[00100] A "variable region" of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination. The variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions. The CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies. There are at least two techniques for determining CDRs: (1) an approach based on cross-species sequence variability (i.e., Kabat et al. Sequences of Proteins of Immunological Interest, (5th ed., 1991 , National Institutes of Health, Bethesda Md.)); and (2) an approach based on crystallographic studies of antigen-antibody complexes (Al-lazikani et al (1997) J. Molec. Biol. 273:927-948)). In addition, combinations of these two approaches are sometimes used in the art to determine CDRs.
[00101] "Oxidizing agent," as used hereinwith respect to protein refolding, is defined as any compound or material which is capable of removing an electron from a compound being oxidized. Suitable oxidizing agents include, but are not limited to, oxidized glutathione, cystine, cystamine, oxidized dithiothreitol, oxidized erythreitol, and oxygen. It is readily apparent to those of ordinary skill in the art that a wide variety of oxidizing agents are suitable for use in the methods of the present invention.
[00102] "Denaturing agent" or "denaturant," as used herein, is defined as any compound or material which will cause a reversible unfolding of a protein. The strength of a denaturing agent or denaturant will be determined both by the properties and the concentration of the particular denaturing agent or denaturant. Suitable denaturing agents or denaturants may be chaotropes, detergents, organic solvents, water miscible solvents, phospholipids, or a combination of two or more such agents. Suitable chaotropes include, but are not limited to, urea, guanidine, and sodium thiocyanate. Useful detergents may include, but are not limited to, strong detergents such as sodium dodecyl sulfate, or polyoxyethylene ethers (e.g. Tween or Triton detergents), Sarkosyl, mild non-ionic detergents (e.g., digitonin), mild cationic detergents such as N->2,3-(Dioleyoxy)-propyl-N,N,N-trimethylammonium, mild ionic detergents (e.g. sodium cholate or sodium deoxycholate) or zwitterionic detergents including, but not limited to, sulfobetaines (Z witter gent), 3-(3- chlolamidopropyl)dimethylammonio-l -propane sulfate (CHAPS), and 3-(3- chlolamidopropyl)dimethylammonio-2-hydroxy- 1 -propane sulfonate (CHAPSO). Organic, water miscible solvents such as acetonitrile, lower alkanols (especially C2 - C4 alkanols such as ethanol or isopropanol), or lower alkandiols (especially C2 - C4 alkandiols such as ethylene-glycol) may be used as denaturants. Phospholipids useful in the present invention may be naturally occurring phospholipids such as phosphatidylethanolamine, phosphatidylcholine, phosphatidylserine, and phosphatidylinositol or synthetic phospholipid derivatives or variants such as dihexanoylphosphatidylcholine or diheptanoylphosphatidylcholine.
[00103] "Refolding," as used herein describes any process, reaction or method which transforms disulfide bond containing polypeptides from an improperly folded or unfolded state to a native or properly folded conformation with respect to disulfide bonds.
[00104] "Cofolding," as used herein, refers specifically to refolding processes, reactions, or methods which employ at least two polypeptides which interact with each other
and result in the transformation of unfolded or improperly folded polypeptides to native, properly folded polypeptides.
[00105] Antibodies are proteins, which exhibit binding specificity to a specific antigen. Native antibodies are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains. Each light chain has a variable domain at one end (VL) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy,chain. Particular amino acid residues are believed to form an interface between the light and heavy chain variable domains.
[00106] The term "variable" refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are responsible for the binding specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed through the variable domains of antibodies. It is concentrated in three segments called Complementarity Determining Regions (CDRs) both in the light chain and the heavy chain variable domains. The more highly conserved portions of the variable domains are called the framework regions (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a β-sheet configuration, connected by three or four CDRs, which form loops connecting, and in some cases forming part of, the β-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
[00107] . The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions. Depending on the amino acid sequence of the constant region of their heavy chains, antibodies or immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGl , IgG2, IgG3, and IgG4; IgAl and IgA2. The heavy chain constant regions that correspond to the
different classes of immunoglobulins are called α, δ, ε, γ and μ, respectively. Of the various human immunoglobulin classes, only human IgGl , IgG2, IgG3 and IgM are known to activate complement.
[00108] In vivo, affinity maturation of antibodies is driven by antigen selection of higher affinity antibody variants which are made primarily by somatic hypermutagenesis. A "repertoire shift" also often occurs in which the predominant germline genes of the secondary or tertiary response are seen to differ from those of the primary or secondary response.
[00109] The affinity maturation process of the immune system may be replicated by introducing mutations into antibody genes in vitro and using affinity selection to isolate mutants with improved affinity. Such mutant antibodies can be displayed on the surface of filamentous bacteriophage or microorganisms such as yeast, and antibodies can be selected by their affinity for antigen or by their kinetics of dissociation (off-rate) from antigen. Hawkins et al. J. Mol. Biol. 226:889-896 (1992). CDR walking mutagenesis has been employed to affinity mature human antibodies which bind the human envelope glycoprotein gpl20 of human immunodeficiency virus type 1 (HIV-1) (Barbas III et al. PNAS (USA) 91 : 3809-3813 (1994); and Yang et al. J. Mol. Biol. 254:392-403 (1995)); and an anti-c-erbB-2 single chain Fv fragment (Schier et al. J. Mol. Biol. 263:551567 (1996)). Antibody chain shuffling and CDR mutagenesis were used to affinity mature a high-affinity human antibody directed against the third hypervariable loop of HIV (Thompson et al. J. Mol. Biol. 256:77-88 (1996)). Balint and Larrick Gene 137: 109-1 18 (1993) describe a computer-assisted oligodeoxyribonucleotide-directed scanning mutagenesis whereby all CDRs of a variable region gene are simultaneously and thoroughly searched for improved variants. An νβ3- specific humanized antibody was affinity matured using an initial limited mutagenesis strategy in which every position of all six CDRs was mutated followed by the expression and screening of a combinatorial library including the highest affinity mutants (Wu et al. PNAS (USA) 95: 6037-6-42 (1998)). Phage displayed antibodies are reviewed in Chiswell and McCafferty TIBTECH 10:80-84 (1992); and Rader and Barbas III Current Opinion in Biotech. 8:503-508 (1997). In each case where mutant antibodies with improved affinity compared to a parent antibody are reported in the above references, the mutant antibody has amino acid substitutions in a CDR.
[00110] By "affinity maturation" herein is meant the process of enhancing the affinity of an antibody for its antigen. Methods for affinity maturation include but are not limited to computational screening methods and experimental methods.
[00111] By "antibody" herein is meant a protein consisting of one or more polypeptides substantially encoded by all or part of the antibody genes. The immunoglobulin genes include, but are not limited to, the kappa, lambda, alpha, gamma (IgGl , IgG2, IgG3, and IgG4), delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Antibody herein is meant to include full-length antibodies and antibody fragments, and include antibodies that exist naturally in any organism or are engineered (e.g. are variants).
[00112] By "antibody fragment" is meant any form of an antibody other than the full- length form. Antibody fragments herein include antibodies that are smaller components that exist within full-length antibodies, and antibodies that have been engineered. Antibody fragments include but are not limited to Fv, Fc, Fab, and (Fab') 2, single chain Fv (scFv), diabodies, triabodies, tetrabodies, bifunctional hybrid antibodies, CDR1 , CDR2, CDR3, combinations of CDR's, variable regions, framework regions, constant regions, and the like (Maynard & Georgiou, 2000, Annu. Rev. Biomed. Eng. 2:339-76; Hudson, 1998, Curr. Opin. Biotechnol. 9:395-402).
[00113] By "computational screening method" herein is meant any method for designing one or more mutations in a protein, wherein said method utilizes a computer to evaluate the energies of the interactions of potential amino acid side chain substitutions with each other and/or with the rest of the protein.
[00114] By "Fc" herein is meant the portions of an antibody that are comprised of immunoglobulin domains Cy2 and Cy3 (Cy2 and Cy3). Fc may also include any residues which exist in the N-terminal hinge between Cy2 and Cyl (Cyl). Fc may refer to this region in isolation, or this region in the context of an antibody or antibody fragment. Fc also includes any modified forms of Fc, including but not limited to the native monomer, the native dimer (disulfide bond linked), modified dimers (disulfide and/or non-covalently linked), and modified monomers (i.e., derivatives).
[00115] By "full-length antibody" herein is meant the structure that constitutes the natural biological form of an antibody H and/or L chain. In most mammals, including humans and mice, this form is a tetramer and consists of two identical pairs of two immunoglobulin chains, each pair having one light and one heavy chain, each light chain comprising immunoglobulin domains VL and C L, and each heavy chain comprising immunoglobulin domains VH, Cyl , Cy2, and Cy3. In each pair, the light and heavy chain variable regions (VL and VH) are together responsible for binding to an antigen, and the constant regions (CL, Cyl ,
Cy2, and Cy3, particularly Cy2, and Cy3) are responsible for antibody effector functions. In some mammals, for example in camels and llamas, full-length antibodies may consist of only two heavy chains, each heavy chain comprising immunoglobulin domains VH, Cy2, and Cy3.
[00116] By "immunoglobulin (Ig)" herein is meant a protein consisting of one or more polypeptides substantially encoded by immunoglobulin genes. Immunoglobulins include but are not limited to antibodies. Immunoglobulins may have a number of structural forms, including but not limited to full-length antibodies, antibody fragments, and individual immunoglobulin domains including but not limited to VH, Cyl, Cy2, Cy3, VL, and CL.
[00117] By "immunoglobulin (Ig) domain" herein is meant a protein domain consisting of a polypeptide substantially encoded by an immunoglobulin gene. Ig domains include but are not limited to VH, Cyl, Cy2, Cy3, VL, and CL as is shown in FIG. 1.
[00118] By "variant protein sequence" as used herein is meant a protein sequence that has one or more residues that differ in amino acid identity from another similar protein sequence. Said similar protein sequence may be the natural wild type protein sequence, or another variant of the wild type sequence. In general, a starting sequence is referred to as a "parent" sequence, and may either be a wild type or variant sequence. For example, preferred embodiments of the present invention may utilize humanized parent sequences upon which computational analyses are done to make variants.
[00119] By "variable region" of an antibody herein is meant a polypeptide or polypeptides composed of the VH immunoglobulin domain, the VL immunoglobulin domains, or the VH and VL immunoglobulin domains as is shown in FIG. 1 (including variants). Variable region may refer to this or these polypeptides in isolation, as an Fv fragment, as a scFv fragment, as this region in the context of a larger antibody fragment, or as this region in the context of a full-length antibody or an alternative, non-antibody scaffold molecule.
[00120] The present invention may be applied to antibodies obtained from a wide range of sources. The antibody may be substantially encoded by an antibody gene or antibody genes from any organism, including but not limited to humans, mice, rats, rabbits, camels, llamas, dromedaries, monkeys, particularly mammals and particularly human and particularly mice and rats. In one embodiment, the antibody may be fully human, obtained for example from a patient or subject, by using transgenic mice or other animals (Bruggemann & Taussig, 1997, Curr. Opin. Biotechnol. 8:455-458) or human antibody libraries coupled with selection methods (Griffiths & Duncan, 1998, Curr. Opin. Biotechnol. 9: 102-108). The antibody may be from any source, including artificial or naturally occurring. For example the present
invention may utilize an engineered antibody, including but not limited to chimeric antibodies and humanized antibodies (Clark, 2000, Immunol. Today 21 :397-402) or derived from a combinatorial library. In addition, the antibody being optimized may be an engineered variant of an antibody that is substantially encoded by one or more natural antibody genes. For example, in one embodiment the antibody being optimized is an antibody that has been identified by affinity maturation.
[00121] With respect to PSMC's of the invention, the term "antigenically specific" or
"specifically binds" refers to PSMC's that bind to one or more epitopes of an antigen or binding partner of interest, but which do not substantially recognize and bind other molecules in a sample containing a mixed population of antigens.
[00122] The term "bispecific PSMC" or 'multispecific PSMC" as used herein refers to a PSMC comprising two or more antigen-binding sites or binding partner binding sites, a first binding site having affinity for a first antigen or epitope and a second binding site having binding affinity for a second antigen or epitope distinct from the first.
[00123] The term "epitope" as used herein refers to a site on an antigen or binding partner that is recognized by a PSMC. An epitope may be a linear or conformationally formed sequence or shape of amino acids, if the antigen comprises a polypeptide. An epitope may also be any location on any type of antigen where a PSMC binds to the antigen.
[00124] As used herein, "antigen-binding polypeptide" or "PSMC" shall include those polypeptides and proteins that have at least the biological activity of specific binding to a particular binding partner such as antigen, as well as PSMC analogs, PSMC isoforms, PSMC mimetics, PSMC fragments, hybrid PSMC proteins, fusion proteins, oligomers and multimers, homologues, glycosylation pattern variants, and muteins, thereof, regardless of the biological activity of same, and further regardless of the method of synthesis or manufacture thereof including, but not limited to, recombinant (whether produced from cDNA, genomic DNA, synthetic DNA or other form of nucleic acid), in vitro, in vivo, by microinjection of nucleic acid molecules, synthetic, transgenic, and gene activated methods. Specific examples of PSMC include, but are not limited to, antibody molecules, heavy chain, light chain, variable region, CDR, Fab, scFv, alternative scaffold non-antibody molecules, ligands, receptors, peptides, or any amino acid sequence that binds to an antigen.
[00125] The term "PSMC" or "antigen-binding polypeptide" refers to a PSMC as described above, as well as a polypeptide that retains at least one biological activity of a naturally-occurring antibody, including but not limited to, activities other than antigen
binding. Activities other than antigen binding include, but are not limited to, any one or more of the activities associated with the Fc.
[00126] Antigen-binding polypeptides include the pharmaceutically acceptable salts and prodrugs, and prodrugs of the salts, polymorphs, hydrates, solvates, biologically-active fragments, biologically-active variants and stereoisomers of the naturally-occurring huma PSMC as well as agonist, mimetic, and antagonist variants of the naturally-occurring huma PSMC and polypeptide fusions thereof. Fusions comprising additional amino acids at the amino terminus, carboxyl terminus, or both, are encompassed by the term "antigen-binding polypeptide." Exemplary fusions include, but are not limited to, e.g., methionyl PSMC in which a methionine is linked to the N-terminus of PSMC resulting from the recombinant expression, fusions for the purpose of purification (including but not limited to, to poly- histidine or affinity epitopes), fusions for the purpose of linking PSMC's to other biologically active molecules, fusions with serum albumin binding peptides, and fusions with serum proteins such as serum albumin.
[00127] The term "antigen" or "binding partner" refers to a substance that is the target for the binding activity exhibited by the PSMC. Virtually any substance may be an antigen or binding partner for a PSMC. Examples of antigens or binding partners include, but are not limited to, Alpha- 1 antitrypsin, Angiostatin, Antihemolytic factor, antibodies, Apolipoprotein, Apoprotein, Atrial natriuretic factor, Atrial natriuretic polypeptide, Atrial peptides, C-X-C chemokines (e.g., T39765, NAP-2, ENA-78, Gro-a, Gro-b, Gro-c, IP-10, GCP-2, NAP-4, SDF- 1 , PF4, MIG), Calcitonin, CC chemokines (e.g., Monocyte chemoattractant protein- 1 , Monocyte chemoattractant protein-2, Monocyte chemoattractant protein-3, Monocyte inflammatory protein- 1 alpha, Monocyte inflammatory protein- 1 beta, RANTES, 1309, R83915, R91733, HCCl , T58847, D31065, T64262), CD40 ligand, C-kit Ligand, Collagen, Colony stimulating factor (CSF), Complement factor 5a, Complement inhibitor, Complement receptor 1, cytokines, (e.g., epithelial Neutrophil Activating Peptide- 78, GROD/MGSA, GRO, GRO, MIP-1, MIP-1 , MCP-1), Epidermal Growth Factor (EGF), Erythropoietin ("EPO"), Exfoliating toxins A and B, Factor IX, Factor VII, Factor VIII, Factor X, Fibroblast Growth Factor (FGF), Fibrinogen, Fibronectin, G-CSF, GM-CSF, Glucocerebrosidase, Gonadotropin, growth factors, Hedgehog proteins (e.g., Sonic, Indian, Desert), Hemoglobin, Hepatocyte Growth Factor (HGF), Hirudin, Human serum albumin, Insulin, Insulin-like Growth Factor (IGF), interferons (e.g., IFN- , IFN-β, IFN-γ), interleukins (e.g., IL-1 , IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-1 1 , IL-12,
etc.), Keratinocyte Growth Factor (KGF), Lactoferrin, leukemia inhibitory factor, Luciferase, Neurturin, Neutrophil inhibitory factor (NIF), oncostatin M, Osteogenic protein, Parathyroid hormone, PD-ECSF, PDGF, peptide hormones (e.g., Human Growth Hormone), Pleiotropin, Protein A, Protein G, Pyrogenic exotoxins A, B, and C, Relaxin, Renin, SCF, Soluble complement receptor I, Soluble I-CAM 1 , Soluble interleukin receptors (IL- 1 , 2, 3, 4, 5, 6, 7, 9, 10, 1 1 , 12, 13, 14, 15), Soluble TNF receptor, Somatomedin, Somatostatin, Somatotropin, Streptokinase, Superantigens, i.e., Staphylococcal enterotoxins (SEA, SEB, SEC 1 , SEC2, SEC3, SED, SEE), Superoxide dismutase, Toxic shock syndrome toxin (TSST-1), Thymosin alpha 1 , Tissue plasminogen activator, Tumor necrosis factor beta (TNF beta), Tumor necrosis factor receptor (TNFR), Tumor necrosis factor-alpha (TNF alpha), Vascular Endothelial Growth Factor (VEGEF), Urokinase and many others.
[00128] Many of these proteins are commercially available (See, e.g., the Sigma Biosciences 2002 catalogue and price list), and the corresponding protein sequences and genes and, typically, many variants thereof, are well-known (see, e.g., Genbank).
[00129] Additional antigens or binding partners include, but are not limited to, transcriptional and expression activators. Example transcriptional and expression activators include genes and proteins that modulate cell growth, differentiation, regulation, or the like. Expression and transcriptional activators are found in prokaryotes, viruses, and eukaryotes, including fungi, plants, and animals, including mammals, providing a wide range of therapeutic targets. It will be appreciated that expression and transcriptional activators regulate transcription by many mechanisms, e.g., by binding to receptors, stimulating a signal transduction cascade, regulating expression of transcription factors, binding to promoters and enhancers, binding to proteins that bind to promoters and enhancers, unwinding DNA, splicing pre-mRNA, polyadenylating RNA, and degrading RNA. Antigens or binding partners include, but are not limited to, expression activators such as cytokines, inflammatory molecules, growth factors, their receptors, and oncogene products, e.g., interleukins (e.g., IL- 1 , IL-2, IL-8, etc.), interferons, FGF, IGF-I, IGF-II, FGF, PDGF, TNF, TGF-a, TGF-β, EGF, KGF, SCF/c-Kit, CD40L/CD40, VL A-4/VC AM- 1 , ICAM-l/LFA-1 , and hyalurin/CD44; signal transduction molecules and corresponding oncogene products, e.g., Mos, Ras, Raf, and Met; and transcriptional activators and suppressors, e.g., p53, Tat, Fos, Myc, Jun, Myb, Rel, and steroid hormone receptors such as those for estrogen, progesterone, testosterone, aldosterone, the LDL receptor ligand and corticosterone.
[00130] Vaccine proteins may be antigens or binding partners including, but not limited to, proteins from infectious fungi, e.g., Aspergillus, Candida species; bacteria, particularly E. coli, which serves a model for pathogenic bacteria, as well as medically important bacteria such as Staphylococci (e.g., aureus), or Streptococci (e.g., pneumoniae); protozoa such as sporozoa (e.g., Plasmodia), rhizopods (e.g., Entamoeba) and flagellates (Trypanosoma, Leishmania, Trichomonas, Giardia, etc.); viruses such as ( + ) RNA viruses (examples include Poxviruses e.g., vaccinia; Picornaviruses, e.g. polio; Togaviruses, e.g., rubella; Flaviviruses, e.g., HCV; and Coronaviruses), ( - ) RNA viruses (e.g., Rhabdoviruses, e.g., VSV; Paramyxoviruses, e.g., RSV; Orthomyxovimses, e.g., influenza; Bunyaviruses; and Arenaviruses), dsDNA viruses (Reoviruses, for example), RNA to DNA viruses, i.e., Retroviruses, e.g., HIV and HTLV, and certain DNA to RNA viruses such as Hepatitis B.
[00131] Antigens or binding partners may be enzymes including, but not limited to, amidases, amino acid racemases, acylases, dehalogenases, dioxygenases, diarylpropane peroxidases, epimerases, epoxide hydrolases, esterases, isomerases, kinases, glucose isomerases, glycosidases, glycosyl transferases, haloperoxidases, monooxygenases (e.g., p450s), lipases, lignin peroxidases, nitrile hydratases, nitrilases, proteases, phosphatases, subtilisins, transaminase, and nucleases.
[00132] Agriculturally related proteins such as insect resistance proteins (e.g., the Cry proteins), starch and lipid production enzymes, plant and insect toxins, toxin-resistance proteins, Mycotoxin detoxification proteins, plant growth enzymes (e.g., Ribulose 1 ,5- Bisphosphate Carboxylase/Oxygenase, "RUBISCO"), lipoxygenase (LOX), and Phosphoenolpyruvate (PEP) carboxylase may also be antigens or binding partners.
[00133] For example, the antigen or binding partner may be a disease-associated molecule, such as tumor surface antigen such as B-cell idiotypes, CD20 on malignant B cells, CD33 on leukemic blasts, and HER2/neu on breast cancer. Alternatively, the antigen or binding partner may be a growth factor receptor. Examples of the growth factors include, but are not limited to, epidermal growth factors (EGFs), transferrin, insulin-like growth factor, transforming growth factors (TGFs), interleukin- 1 , and interleukin-2. For example, a high expression of EGF receptors has been found in a wide variety of human epithelial primary tumors. TGF-a has been found to mediate an autocrine stimulation pathway in cancer cells. Several murine monoclonal antibodies have been demonstrated to be able to bind EGF receptors, block the binding of ligand to EGF receptors, and inhibit proliferation of a variety of human cancer cell lines in culture and in xenograft medels. Mendelsohn and Baselga
(1995) Antibodies to growth factors and receptors, in Biologic Therapy of Cancer, 2nd Ed., JB Lippincott, Philadelphia, pp 607-623. Thus, PSMCs of the invention may be used to treat a variety of cancers.
[00134] The antigen or binding partner may also be cell surface protein or receptor associated with coronary artery disease such as platelet glycoprotein Iib/IIIa receptor, autoimmune diseases such as CD4, CAMPATH-1 and lipid A region of the gram-negative bacterial lipopolysaccharide. Humanized antibodies against CD4 have been tested in clinical trials in the treatment of patients with mycosis fungoides, generalized postular psoriasis, severe psorisis, and rheumatoid arthritis. Antibodies against lipid A region of the gram- negative bacterial lipopolysaccharide have been tested clinically in the treatment of septic shock. Antibodies against CAMPATH-1 have also been tested clinically in the treatment of against refractory rheumatoid arthritis. Thus, PSMCs of the invention may be used to treat a variety of autoimmune diseases. Vaswani et al. (1998) "Humanized antibodies as potential therapeutic drugs" Annals of Allergy, Asthma and Immunology 81 : 105-1 15.
[00135] The antigen or binding partner may also be proteins or peptides associated with human allergic diseases, such as inflammatory mediator proteins, e.g. Interleukin-1 (IL- 1), tumor necrosis factor (TNF), leukotriene receptor and 5-lipoxygenase, and adhesion molecules such as V-CAM/VLA-4. In addition, IgE may also serve as the antigen or binding partner because IgE plays pivotal role in type I immediate hypersensitive allergic reactions such as asthma. Studies have shown that the level of total serum IgE tends to correlate with severity of diseases, especially in asthma. Burrows et al. (1989) "Association of asthma with serum IgE levels and skin-test reactivity to allergens" New Engl. L. Med. 320:271-277. Thus, PSMCs selected against IgE may be used to reduce the level of IgE or block the binding of IgE to mast cells and basophils in the treatment of allergic diseases without having substantial impact on normal immune functions.
[00136] The antigen or binding partner may also be a viral surface or core protein which may serve as an antigen to trigger immune response of the host. Examples of these viral proteins include, but are not limited to, glycoproteins (or surface antigens, e.g., GP120 and GP41) and capsid proteins (or structural proteins, e.g., P24 protein); surface antigens or core proteins of hepatitis A, B, C, D or E virus (e.g. small hepatitis B surface antigen (SHBsAg) of hepatitis B virus and the core proteins of hepatitis C virus, NS3, NS4 and NS5 antigens); glycoprotein (G-protein) or the fusion protein (F-protein) of respiratory syncytial
virus (RSV); surface and core proteins of herpes simplex virus HSV-1 and HSV-2 (e.g., glycoprotein D from HSV-2).
[00137] The antigen or binding partner may also be a mutated tumor suppressor gene product that has lost its tumor-suppressing function and may render the cells more susceptible to cancer. Tumor suppressor genes are genes that function to inhibit the cell growth and division cycles, thus preventing the development of neoplasia. Mutations in tumor suppressor genes cause the cell to ignore one or more of the components of the network of inhibitory signals, overcoming the cell cycle check points and resulting in a higher rate of controlled cell growth—cancer. Examples of the tumor suppressor genes include, but are not limited to, DPC-4, NF-1 , NF-2, RB, p53, WT1 , BRCA1 and BRCA2.
[00138] DPC-4 is involved in pancreatic cancer and participates in a cytoplasmic pathway that inhibits cell division. NF-1 codes for a protein that inhibits Ras, a cytoplasmic inhibitory protein. NF-1 is involved in neurofibroma and pheochromocytomas of the nervous system and myeloid leukemia. NF-2 encodes a nuclear protein that is involved in meningioma, schwanoma, and ependymoma of the nervous system. RB codes for the pRB protein, a nuclear protein that is a major inhibitor of cell cycle. RB is involved in retinoblastoma as well as bone, bladder, small cell lung and breast cancer. p53 codes for p53 protein that regulates cell division and can induce apoptosis. Mutation and/or inaction of p53 is found in a wide ranges of cancers. WT1 is involved in Wilms tumor of the kidneys. BRCA1 is involved in breast and ovarian cancer, and BRCA2 is involved in breast cancer. Thus, PSMCs may be used to block the interactions of the gene product with other proteins or biochemicals in the pathways of tumor onset and development.
[00139] The antigen or binding partner may be a CD molecule including but not limited to, CD la, CDlb, CDlc, CDld, CD2, CD3y, CD35, CD38, CD4, CD5, CD6, CD7, CD8cc, CD8 , CD9, CD10, CDl la, CDl lb, CD l lc, CDwl2, CD13, CD14, CD15, CD15s, CD 16a, CD 16b, CD 18, CD 19, CD20, CD21 , CD22, CD23, CD24, CD25, CD26, CD27, CD28, CD29, CD30, CD31 , CD32, CD33, CD34, CD35, CD36, CD37, CD38, CD39, CD40, CD41 , CD42a, CD42b, CD42c, CD42d, CD43, CD44, CD45, CD45R, CD46, CD47, CD48, CD49a, CD49b, CD49c, CD49d, CD49e, CD49f, CD50, CD51, CD52, CD53, CD54, CD55, CD56, CD57, CD58, CD59, CDw60, CD61 , CD62E, CD62L, CD62P, CD63, CD64, CD65, CD66a, CD66b, CD66c, CD66d, CD66e, CD66f, CD67, CD68, CD69, CDw70, CD71 , CD72, CD73, CD74, CDw75, CDw76, CD77, CD79 , CD79p, CD80, CD81 , CD82, CD83, CD84, CD85, CD86, CD87, CD88, CD89, CD90, CD91, CDw92, CD93, CD94, CD95,
CD96, CD97, CD98, CD99, CD100, CD101 , CD102, CD103, CD104, CD105, CD106, CD107a, CD107b, CDwl 08, CDwl09, CDl l O-1 13, CD1 14, CD1 15, CD1 16, CD1 17, CD1 18, CD1 19, CD120a, CD120b, CD121a, CD121b, CD122, CD123, CDwl24, CD125, CD126, CDwl 27, CDwl28a, CDwl28b, CD129, CDwl 30, CD131 , CD132, CD133, CD134, CD135, CD136, CDwl37, CD138, CD139, CD 140a, CD140b, CD141 , CD142, CD143, CD144, CDwl45, CD146, CD147, CD148, CDwl49, CD150, CD151, CD152, CD153, CD154, CD155, CD156, CD157, CD158a, CD158b, CD161, CD162, CD163, CD164, CD 165, CD 166, and
The antigen or binding partner may be VEGF, VEGF receptor, EGFR, Her2, TNFa, TNFRI receptor, GPIIb/IIIa, IL-2R alpha chain, IL-2R beta chain, RSV F protein, alpha4 integrin, IgE, IgE receptor, digoxin, carpet viper venom, complement C5, OPGL, CA-125 tumor antigen, Staphylococci proteins, Staphylococcus epidermidis proteins, Staphylococcus aureus proteins, proteins involved Staphylococcal infection (including but not limited to, Staphylococcus aureus and Staphylococcus epidermidis), IL-6 receptor, CTLA-4, RSV, Tac subunit of IL-2 receptor, IL-5, and EpCam. The antigen or binding partner may be a fragment of a molecule.
[00140] Examples of bispecific PSMCs include, but are not limited to, those with one PSMC directed against a tumor cell antigen and the other PSMC directed against a cytotoxic trigger molecule such as anti-FcyRI/anti-CD 15, anti-pl 85HER2/FcyRIII (CD16), anti- CD3/anti-malignant B-cell (ID 10), anti-CD3/anti-pl 85 HER2, anti-CD3/anti-p97, anti- CD3/anti-renal cell carcinoma, anti-CD3/anti-OVCAR-3, anti-CD3/L-Dl (anti-colon carcinoma), anti-CD3/anti-melanocyte stimulating hormone analog, anti-EGF receptor/anti- CD3, anti-CD3/anti-CAMAl , anti-CD3/anti-CD19, anti-CD3/MoV18, anti-neural cell adhesion molecule (NCAM)/anti-CD3, anti-folate binding protein (FBP)/anti-CD3, anti-pan carcinoma associated antigen (AMOC-31)/anti-CD3; bispecific PSMCs with one PSMC which binds specifically to a tumor antigen and another PSMC which binds to a toxin such as anti-saporin/anti-Id-1 , anti-CD22/anti-saporin, anti-CD7/anti-saporin, anti-CD38/anti- saporin, anti-CEA/anti-ricin A chain, anti-interferon-a (IFN- a)/anti-hybridoma idiotype, anti-CEA/anti-vinca alkaloid; bispecific PSMCs for converting enzyme activated prodrugs such as anti-CD30/anti-alkaline phosphatase (which catalyzes conversion of mitomycin phosphate prodrug to mitomycin alcohol); bispecific PSMCs which can be used as fibrinolytic agents such as anti-fibrin/anti-tissue plasminogen activator (tPA), anti-fibrin/anti- urokinase-type plasminogen activator (uPA); bispecific PSMCs for targeting immune complexes to cell surface receptors such as anti-low density lipoprotein (LDL)/anti-Fc
receptor (e.g. FcyRI, FcyRII or FcyRIII); bispecific PSMCs for use in therapy of infectious diseases such as anti-CD3/anti-herpes simplex virus (HSV), anti-T-cell receptor:CD3 complex/anti-infiuenza, anti-FcyR/anti-HIV; bispecific PSMCs for tumor detection in vitro or in vivo such as anti-CEA/anti-EOTUBE, anti-CEA/anti-DPTA, anti-pl 85 HER2 /anti-hapten; bispecific PSMCs as vaccine adjuvants (see Fanger, MW et al., Crit Rev Immunol. 1992; 12(3-4): 101 -24, which is incorporated by reference herein); and bispecific PSMCs as diagnostic tools such as anti-rabbit IgG/anti-ferritin, anti-horse radish peroxidase (HRP)/anti- hormone, anti-somatostatin/anti-substance P, anti-HRP/anti-FITC, anti-CEA/anti-β- galactosidase (see Nolan, O et R. O'Kennedy, Biochim Biophys Acta. 1990 Aug 1 ; 1040(1): 1- 1 1 , which is incorporated by reference herein). Examples of trispecific PSMCs include anti- CD3/anti-CD4/anti-CD37, anti-CD3/anti-CD5/anti-CD37 and anti-CD3/anti-CD8/anti-CD37.
[00141] Various references disclose modification of polypeptides by polymer conjugation or glycosylation. The term "PSMC" or "antigen-binding polypeptide" includes, but is not limited to, polypeptides conjugated to a polymer such as PEG and may be comprised of one or more additional derivitizations of cysteine, lysine, N or C-terminal amino acids, or other residues. In addition, the PSMC may comprise a linker, polymer or biologically active molecule, wherein the amino acid to which the linker, polymer, or biologically active molecule is conjugated may be a non-natural amino acid according to the present invention, or may be conjugated to a naturally encoded amino acid utilizing techniques known in the art such as coupling to lysine or cysteine. U.S. Pat. No. 4,904,584 discloses PEGylated lysine depleted polypeptides, wherein at least one lysine residue has been deleted or replaced with any other amino acid residue. WO 99/67291 discloses a process for conjugating a protein with PEG, wherein at least one amino acid residue on the protein is deleted and the protein is contacted with PEG under conditions sufficient to achieve conjugation to the protein. WO 99/03887 discloses PEGylated variants of polypeptides belonging to the growth hormone superfamily, wherein a cysteine residue has been substituted with a non-essential amino acid residue located in a specified region of the polypeptide. WO 00/26354 discloses a method of producing a glycosylated polypeptide variant with reduced allergenicity, which as compared to a corresponding parent polypeptide comprises at least one additional glycosylation site.
[00142] The term "antigen-binding polypeptide" also includes glycosylated PSMCs, such as but not limited to, polypeptides glycosylated at any amino acid position, N-linked or O-linked glycosylated forms of the polypeptide. Variants containing single nucleotide
changes are also considered as biologically active variants of PSMC. In addition, splice variants are also included. The term "antigen-binding polypeptide" also includes PSMC heterodimers, homodimers, heteromultimers, or homomultimers of any one or more PSMC or any other polypeptide, protein, carbohydrate, polymer, small molecule, linker, ligand, or other biologically active molecule of any type, linked by chemical means or expressed as a fusion protein, as well as polypeptide analogues containing, for example, specific deletions or other modifications yet maintain biological activity.
[00143] In some embodiments, the antigen-binding polypeptides further comprise an addition, substitution or deletion that modulates biological activity of the PSMC. For example, the additions, substitutions or deletions may modulate one or more properties or activities of the PSMC, including but not limited to, modulating affinity for the antigen, modulate (including but not limited to, increases or decreases) antigen conformational or other secondary, tertiary or quaternary structural changes, stabilize antigen conformational or other secondary, tertiary or quaternary structural changes, induce or cause antigen conformational or other secondary, tertiary or quaternary structural changes, modulate circulating half-life, modulate therapeutic half-life, modulate stability of the polypeptide, modulate dose, modulate release or bio-availability, facilitate purification, or improve or alter a particular route of administration. Similarly, antigen-binding polypeptides may comprise protease cleavage sequences, reactive groups, antibody-binding domains (including but not limited to, FLAG or poly-His) or other affinity based sequences (including but not limited to, FLAG, poly-His, GST, etc.) or linked molecules (including but not limited to, biotin) that improve detection (including but not limited to, GFP), purification or other traits of the polypeptide.
[00144] The term "antigen-binding polypeptide" also encompasses PSMC homodimers, heterodimers, homomultimers, and heteromultimers that are linked, including but not limited to those linked directly via non-naturally encoded amino acid side chains, either to the same or different non-naturally encoded amino acid side chains, to naturally- encoded amino acid side chains, as fusions, or indirectly via a linker. Exemplary linkers include but are not limited to, small organic compounds, water soluble polymers of a variety of lengths such as poly(ethylene glycol) or polydextran, or polypeptides of various lengths.
[00145] Those of skill in the art will appreciate that amino acid positions corresponding to positions in a particular antigen-binding polypeptide sequence can be readily identified in a fragment of the antigen-binding polypeptide or related antigen-binding
polypeptide, etc. For example, sequence alignment programs such as BLAST can be used to align and identify a particular position in a protein that corresponds with a position in a related sequence.
[00146] The term "antigen-binding polypeptide" encompasses antigen-binding polypeptides comprising one or more amino acid substitutions, additions or deletions. Antigen-binding polypeptides of the present invention may be comprised of modifications with one or more natural amino acids in conjunction with one or more non-natural amino acid modification. Exemplary substitutions in a wide variety of amino acid positions in naturally- occurring PSMC polypeptides have been described, including but not limited to substitutions that modulate one or more of the biological activities of the antigen-binding polypeptide, such as but not limited to, increase agonist activity, increase solubility of the polypeptide, convert the polypeptide into an antagonist, etc. and are encompassed by the term "PSMC."
[00147] A "non-naturally encoded amino acid" refers to an amino acid that is not one of the 20 common amino acids or pyrolysine or selenocysteine. Other terms that may be used synonymously with the term "non-naturally encoded amino acid" are "non-natural amino acid," "unnatural amino acid," "non-naturally-occurring amino acid," and variously hyphenated and non-hyphenated versions thereof. The term "non-naturally encoded amino acid" also includes, but is not limited to, amino acids that occur by modification (e.g. post- translational modifications) of a naturally encoded amino acid (including but not limited to, the 20 common amino acids or pyrolysine and selenocysteine) but are not themselves naturally incorporated into a growing polypeptide chain by the translation complex. Examples of such non-naturally-occurring amino acids include, but are not limited to, N- acetylglucosaminyl-L-serine, N-acetylglucosaminyl-L-threonine, and O-phosphotyrosine.
[00148] An "amino terminus modification group" refers to any molecule that can be attached to the amino terminus of a polypeptide. Similarly, a "carboxy terminus modification group" refers to any molecule that can be attached to the carboxy terminus of a polypeptide. Terminus modification groups include, but are not limited to, various water soluble polymers, peptides or proteins such as serum albumin, or other moieties that increase serum half-life of peptides.
[00149] The terms "functional group", "active moiety", "activating group", "leaving group", "reactive site", "chemically reactive group" and "chemically reactive moiety" are used in the art and herein to refer to distinct, definable portions or units of a molecule. The terms are somewhat synonymous in the chemical arts and are used herein to indicate the
portions of molecules that perform some function or activity and are reactive with other molecules.
[00150] The term "linkage" or "linker" is used herein to refer to groups or bonds that normally are formed as the result of a chemical reaction and typically are covalent linkages. Hydrolytically stable linkages means that the linkages are substantially stable in water and do not react with water at useful pH values, including but not limited to, under physiological conditions for an extended period of time, perhaps even indefinitely. Hydrolytically unstable or degradable linkages mean that the linkages are degradable in water or in aqueous solutions, including for example, blood. Enzymatically unstable or degradable linkages mean that the linkage can be degraded by one or more enzymes. As understood in the art, PEG and related polymers may include degradable linkages in the polymer backbone or in the linker group between the polymer backbone and one or more of the terminal functional groups of the polymer molecule. For example, ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent generally hydrolyze under physiological conditions to release the agent. Other hydrolytically degradable linkages include, but are not limited to, carbonate linkages; imine linkages resulted from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; hydrazone linkages which are reaction product of a hydrazide and an aldehyde; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; peptide linkages formed by an amine group, including but not limited to, at an end of a polymer such as PEG, and a carboxyl group of a peptide; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide. Branched linkers may be used in antigen-binding polypeptides of the invention.
[00151] The term "biologically active molecule", "biologically active moiety" or "biologically active agent" when used herein means any substance which can affect any physical or biochemical properties of a biological system, pathway, molecule, or interaction relating to an organism, including but not limited to, viruses, bacteria, bacteriophage, transposon, prion, insects, fungi, plants, animals, and humans. In particular, as used herein, biologically active molecules include, but are not limited to, any substance intended for diagnosis, cure, mitigation, treatment, or prevention of disease in humans or other animals, or to otherwise enhance physical or mental well-being of humans or animals. Examples of
biologically active molecules include, but are not limited to, peptides, proteins, enzymes, small molecule drugs, hard drugs, soft drugs, dyes, lipids, nucleosides, oligonucleotides, toxins, cells, viruses, liposomes, microparticles and micelles. Classes of biologically active agents that are suitable for use with the invention include, but are not limited to, drugs, prodrugs, radionuclides, imaging agents, polymers, antibiotics, fungicides, anti-viral agents, anti-inflammatory agents, anti-tumor agents, cardiovascular agents, anti-anxiety agents, hormones, growth factors, steroidal agents, microbially derived toxins, and the like.
[00152] In certain embodiments, the PSMC molecules of this invention can be used to direct biologically active molecules or detectable labels to a tumor site. This can facilitate -tumor killing, detection and/or localization or other effect. Diagnostic probes or imaging probes may also be linked to PSMC molecules of the invention. In certain particularly preferred embodiments, the biologically active molecule component of the PSMC is a "radiopaque" label, e.g. a label that can be easily visualized using for example x-rays. Radiopaque materials are well known to those of skill in the art. The most common radiopaque materials include iodide, bromide or barium salts. Other radiopaque materials are also known and include, but are not limited to organic bismuth derivatives (see, e.g., U.S. Pat. No. 5,939,045), radiopaque multiurethanes (see U.S. Pat. No. 5,346,981), organobismuth composites (see, e.g., U.S. Pat. No. 5,256,334), radiopaque barium multimer complexes (see, e.g., U.S. Pat. No. 4,866,132), and the like.
[00153] The PSMC's of this invention can be coupled directly to the radiopaque moiety or they can be attached to a "package" (e.g. a chelate, a liposome, a multimer microbead, etc.) carrying or containing the radiopaque material.
[00154] In addition to radioopaque labels, other labels are also suitable for use in this invention. Detectable labels suitable for use as the biologically active molecule component of the PSMC's of this invention include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means. Useful labels in the present invention include magnetic beads (e.g. Dynabeads™), fluorescent dyes (e.g., fluorescein isothiocyanate, texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., 3H, 125I, 35S, 14C, or 32P), enzymes (e.g., horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (e.g. multistyrene, multipropylene, latex, etc.) beads.
[00155] Various preferred radiolabels include, but are not limited to Tc, Pb, Ga,
68Ga, 72As, l nIn, , 13mln, 97Ru, 62Cu, 64ICu, 52Fe, 52mMn, 5 ,Cr, 186Re, 188Re, 77As, 90Y, 67Cu, 169Er, 12,Sn, 127Te, 142Pr, ,43Pr, 198Au, ,99Au, 16,Tb, 109 Pd, 165Dy, 149Pm, 15 ,Pm, ,53Sm, 157Gd, 159Gd, l 66Ho, 172Tm, 169Yb, 175Yb, ,75Yb, l 77Lu, , 05Rh, and mAg.
[00156] Means of detecting such labels are well known to those of skill in the art.
Thus, for example, radiolabels may be detected using photographic film, scintillation detectors, and the like. Fluorescent markers may be detected using a photodetector to detect emitted illumination. Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
[00157] In certain specific embodiments, this invention contemplates the use of immunoconjugates (chimeric moieties) for the detection of tumors and/or other cancer cells. Thus, for example, the bispecific antibodies of this invention can be conjugated to gamma- emitting radioisotopes (e.g., Na-22, Cr-51 , Co-60, Tc-99, 1-125, 1-131, Cs-137, Ga-67, Mo- 99) for detection with a gamma camera, to positron emitting isotopes (e.g. C-l 1 , N-13, 0-15, F-18, and the like) for detection on a Positron Emission Tomography (PET) instrument, and to metal contrast agents (e.g., Gd containing reagents, Eu containing reagents, and the like) for magnetic resonance imaging (MRI), In addition, the bispecific antibodies of this invention can be used in traditional immunohistochemistry (e.g. fluorescent labels, nanocrystal labels, enzymatic and colormetric labels etc.).
[00158] In another embodiment, the biologically active molecule can be a radiosensitizer that enhances the cytotoxic effect of ionizing radiation (e.g., such as might be produced by 60Co or an x-ray source) on a cell. Numerous radiosensitizing agents are known and include, but are not limited to benzoporphyrin derivative compounds (see, e.g., U.S. Pat. No. 5,945,439), 1 ,2,4-benzotriazine oxides (see, e.g., U.S. Pat. No. 5,849,738), compounds containing certain diamines (see, e.g., U.S. Pat. No. 5,700,825), BCNT (see, e.g., U.S. Pat. No. 5,872,107), radiosensitizing nitrobenzoic acid amide derivatives (see, e.g., U.S. Pat. No. 4,474,814), various heterocyclic derivatives (see, e.g., U.S. Pat. No. 5,064,849), platinum complexes (see, e.g., U.S. Pat. No. 4,921 ,963), and the like.
[00159] The biologically active molecule may also be a ligand, an epitope tag, a peptide, a protein, or another PSMC. Ligand and antibodies may be those that bind to surface markers on immune cells. Chimeric molecules utilizing such antibodies as biologically active molecules act as bifunctional linkers establishing an association between the immune cells
bearing binding partner for the ligand or PSMC and the tumor cells expressing the EGFR family member(s).
[00160] Many of the pharmaceuticals and/or radiolabels described herein may be provided as a chelate, particularly where a pre-targeting strategy is utilized. The chelating molecule is typically coupled to a molecule (e.g. biotin, avidin, streptavidin, etc.) that specifically binds an epitope tag attached to the bispecific and/or multispecific PSMC.
[00161] Chelating groups are well known to those of skill in the art. In certain embodiments, chelating groups are derived from ethylene diamine tetra-acetic acid (EDTA), diethylene triamine penta-acetic acid (DTP A), cyclohexyl 1 ,2-diamine tetra-acetic acid (CDTA), ethyleneglycol-0,0'-bis(- 2-aminoethyl)-N,N,N',N'-tetra-acetic acid (EGTA), N,N- bis(hydroxybenzyl)-ethylenediamine-N,N'-diacetic acid (HBED), triethylene tetramine hexa- acetic acid (TTHA), l,4,7,10-tetraazacyclododecane-N,N'-,N",N"'-tetra-acetic acid (DOTA), hydroxyethyldiamine triacetic acid (HEDTA), 1,4,8,1 1 -tetra-azacyclotetradecane- N,N',N",N"' -tetra-acetic acid (TETA), substituted DTPA, substituted EDTA, and the like.
[00162] Examples of certain preferred chelators include unsubstituted or, substituted 2- iminothiolanes and 2-iminothiacyclohexanes, in particular 2-imino-4- mercaptomethylthiolane, and SAPS (N-(4-[21 lAt] astatophenethyl) succinimate).
[00163] One chelating agent, l ,4,7,10-tetraazacyclododecane-N,N, N", N"'-tetraacetic acid (DOTA), is of particular interest because of its ability to chelate a number of diagnostically and therapeutically important metals, such as radionuclides and radiolabels.
[00164] Conjugates of DOTA and proteins such as antibodies have been described. For example, U.S. Pat. No. 5,428, 156 teaches a method for conjugating DOTA to antibodies and PSMC fragments. To make these conjugates, one carboxylic acid group of DOTA is converted to an active ester which can react with an amine or sulfhydryl group on the PSMC or PSMC fragment. Lewis et al. (1994) Bioconjugate Chem. 5: 565-576, describes a similar method wherein one carboxyl group of DOTA is converted to an active ester, and the activated DOTA is mixed with a PSMC, linking the PSMC to DOTA via the epsilon-amino group of a lysine residue of the PSMC, thereby converting one carboxyl group of DOTA to an amide moiety.
[00165] Alternatively the chelating agent can be coupled, directly or through a linker, to an epitope tag or to a moiety that binds an epitope tag. Conjugates of DOTA and biotin have been described (see, e.g., Su (1995) J. Nucl. Med., 36 (5 Suppl): 154P, which discloses the linkage of DOTA to biotin via available amino side chain biotin derivatives such as
DOTA-LC-biotin or DOTA-benzyl-4-(6-amino-caproamide)-biotin). Yau et al., WO 95/15335, disclose a method of producing nitro-benzyl-DOTA compounds that can be conjugated to biotin. The method comprises a cyclization reaction via transient projection of a hydroxy group; tosylation of an amine; deprotection of the transiently protected hydroxy group; tosylation of the deprotected hydroxy group; and intramolecular tosylate cyclization. Wu et al. (1992) Nucl. Med. Biol., 19(2): 239-244 discloses a synthesis of macrocylic chelating agents for radiolabeling proteins with mIN and 90Y. Wu et al. makes a labeled DOTA-biotin conjugate to study the stability and biodistribution of conjugates with avidin, a model protein for studies. This conjugate was made using a biotin hydrazide which contained a free amino group to react with an in situ generated activated DOTA derivative.
[00166] PSMC's of this invention may be fused to other biologically active molecules, including, but are not limited to, cytotoxic drugs, toxins, peptides, proteins, enzymes and viruses (Chester, (2000) Dis. Markers 16:53-62; Rippmann et al. Biochem J. (2000) Biochem J. 349 (Pt. 3):805-812, Kreitman, R.J. (2001) Curr. Pharm. Biotechnol. 2:313-325; Rybak, S.M. (2001) Expert Opin. Biol. Ther. 1 :995-1003; van Beusechem, V.W. et al. J. Virol. (2002) 76:2753-2762).
[00167] A potent cytotoxic agent, or payload, may be bound to PSMC's that target and bind to antigens that are found predominantly on target cells (including but not limited to, cancer cells). The payload agent is linked to the PSMC via a link that is stable in the bloodstream, or may be susceptible to cleavage under conditions present at, for example, the tumor site. Payload agents such as toxins are delivered to target cells and thus cell killing can be initiated via a mechanism dependent on the toxin.
[00168] Examples of such toxins include, but are not limited to, small molecules such as fungal derived calicheamicins (Hinman et al. (1993) Cancer Res. 53 : 3336-3342) and maytansinoids (Liu et al. (1996) PNAS USA 93:8618-8623, Smith, S. (2001) Curr. Opin. Mol. Ther. 3(2): 198-203), trichothene, and CC 1065, or proteins, e.g. ricin A chain (Messman, et al. (2000) Clin. Cancer Res. 6(4): 1302-1313), Pseudomonas exotoxin (Tur et al. (2001) Intl. J. Mol. Med. 8(5):579-584), diphtheria toxin (LeMaistre et al. (1998) Blood 91(2):399-405), and ribosome-inactivating proteins (Tazzari, et al. (2001), J. Immunol. 167:4222-4229). In a specific embodiment, one or more calicheamicin molecules may be used. Members of the calicheamicin family of antibiotics are capable of producing double- stranded DNA breaks at sub-picomolar concentrations. Structured analogues of calicheamicin are also known. See Hinman et al., Cancer Research 53: 3336-42 (1993); Lode et al. (1998)
Cancer Research 58:2925-28. An example of an immunotoxin that has gained FDA approval is Mylotarg® (Wyeth Ayerst), a calichaemicin-conjugated anti-CD33 for acute myelogenous leukemia (Sievers et al. (1999) Blood 93(1 1):3678-3684; Bernstein (2000) Leukemia 14:474- 475). In a similar fashion, PSMC's of this invention may be fused to toxins. Alternatively, PSMC's of the invention may be fused with botulinum A neurotoxin, a protein complex produced by the bacterium Clostridium botulinum.
[00169] In yet another embodiment, the PSMC's of the invention may comprise one or more enzymatically active toxins and/or fragments thereof. Examples of such toxins include non-binding active fragments of diphtheria toxin, diphtheria A chain, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, dianthin proteins, Phytolaca americana proteins (PAPI, PAP All, and PAP-S), momordica charantia inhibitor, curcin, crotin sapaonaria, officinalis inhibitor, gelonin, mitogellin, restrictoein, phenomycin, enomycin, and the tricothecenes. See e.g., WO 93/21232. Particularly preferred cytotoxins include Pseudomonas exotoxins (PE), Diphtheria toxins, ricin, and abrin. Pseudomonas exotoxin and Dipthteria toxin are well known. Like PE, diphtheria toxin (DT) kills cells by ADP-ribosylating elongation factor 2 thereby inhibiting protein synthesis. Additional citations regarding immunotoxins include Brinkmann, U.
(2000) In Vivo 14:21-28, Niv et al. (2001) Curr. Pharm. Biotechnol. 2: 19-46, Reiter et al.
(2001) Adv. Cancer Res. 81 :93-124, Kreitman, R. J. (1999) Curr. Opin. Immunol., 1 1 :570- 578; Hall (2001) Meth. Mol. Biol. 166: 139-154; Kreitman (2001) Curr. Opin. Investig. Drugs
2(9): 1282-1293. Methods of cloning genes encoding PE or DT fused to various ligands are well known to those of skill in the art (see, e.g., Siegall et al. (1989) FASEB J., 3: 2647-2652; and Chaudhary et al. (1987) Proc. Natl. Acad. Sci. USA, 84: 4538-4542). All citations are incorporated by reference herein.
[00170] Other suitable biologically active molecules include pharmacological agents or encapsulation systems containing various pharmacological agents. Thus, the targeting molecule of the chimeric molecule may be attached directly to a drug that is to be delivered directly to the tumor. Such drugs are well known to those of skill in the art and include, but are not limited to, doxirubicin, vinblastine, genistein, an antisense molecule, and the like.
[00171] Alternatively, the biologically active molecule may be an encapsulation system, such as a viral capsid, a liposome, or micelle that contains a therapeutic composition such as a drug, a nucleic acid (e.g. an antisense nucleic acid), or another therapeutic moiety that is preferably shielded from direct exposure to the circulatory system. Means of preparing
liposomes attached to antibodies are well known to those of skill in the art. See, for example, U.S. Pat. No. 4,957,735, Connor et al. (1985) Pharm. Ther., 28: 341 -365. Due to their antigen specificity, PSMC's of the invention may be used to direct drug-loaded liposomes to their target. See Park, J.W. et al. (2002) Clin. Cancer Res. 8, 1 172-1 181 and Shi, N. et al (2001) Pharm. Res. 18, 1091-1095.
[00172] PSMC's of the invention may be conjugated to molecules such as PEG to improve in vivo delivery and pharmacokinetic profiles. Leong et al. describe site-specific PEGylation of a Fab' fragment of an anti-IL-8 antibody with a decreased clearance rate over the non-PEGylated form and little or no loss of antigen binding activity (Leong, S.R. et al. (2001) Cytokine 16: 106-1 19).
[00173] The PSMC's of the present invention may be linked to a prodrug. The term "prodrug" as used herein means a pharmacologically inactive, or reduced activity, derivative of an active drug. Prodrugs may be designed to modulate the amount of a drug or biologically active molecule that reaches a desired site of action through the manipulation of the properties of a drug, such as physicochemical, biopharmaceutical, or pharmacokinetic properties. Prodrugs are converted into active drug within the body through enzymatic or non-enzymatic reactions. Prodrugs may provide improved physicochemical properties such as better solubility, enhanced delivery characteristics, such as specifically targeting a particular cell, tissue, organ or ligand, and improved therapeutic value of the drug. PSMC's of the invention may be fused to enzymes for prodrug activation (Kousparou, C.A., et al. (2002) Int. J. Cancer 99, 138-148). (2002) Recombinant molecules may comprise a PSMC and an enzyme that acts upon a prodrug to release a cytotoxin such as cyanide.
[00174] The therapeutic agents may be administered as a prodrug and subsequently activated by a prodrug-activating enzyme that converts a prodrug like peptidyl chemotherapeutic agent to an active anti-cancer drug. See, e.g., WO 88/07378; WO 81/01 145; U.S. Patent No. 4,975,278. In general, the enzyme component includes any enzyme capable of acting on a prodrug in such a way as to convert it into its more active, cytotoxic form.
[00175] Enzymes that may be useful include, but are not limited to, alkaline phosphatase useful for converting phosphate-containing prodrugs into free drugs, arylsulfatase useful for converting sulfate containing prodrugs into free drugs; cytosine deaminase useful for converting non-toxic 5-fluorocytosine into the anti-cancer drug, 5- fluorouracil; proteases, such as serratia protease, thermolysin, subtilisin, carboxypeptidases
and cathepsins (such as cathepsins B and L), that are useful for converting peptide-containing prodrugs into free drugs; D-alanylcarboxypeptidases, useful for converting prodrugs that contain D-amino acid substituents; carbohydrate cleaving enzymes such as β-galactosidase and neuraminidase useful for converting glycosylated prodrugs into free drugs; β-lactamase useful for converting drugs derivatized with β-lactams into free drugs; and penicillin amidases, such as penicillin V amidase or penicillin G amidase, useful for converting drugs derivatized at their amino nitrogens with phenoxyacetyl or phenylacetyl groups, respectively, into free drugs.
[00176] Alternatively, antibodies with enzymatic activity, also known in the art as "abzymes," may be used to convert the prodrugs of the invention into free active drugs. See e.g., Massey, (1987) 328:457-48.
[00177] One of skill will appreciate that the bispecific and/or multispecific PSMC of this invention and the biologically active molecule moieties can typically be joined together in any order. Thus, for example, where the targeting molecule is a single chain protein the biologically active molecule may be joined to either the amino or carboxy termini of the targeting molecule. The biologically active molecule can also be joined to an internal region of the bispecific and/or multispecific PSMC, or conversely. Similarly, the bispecific and/or multispecific PSMC can be joined to an internal location or a terminus of the biologically active molecule. In any case, attachment points are selected that do not interfere with the respective activities of the bispecific and/or multispecific PSMC or the biologically active molecule.
[00178] The bispecific and/or multispecific PSMC and the biologically active molecule can be attached by any of a number of means well known to those of skill in the art. Typically the biologically active molecule is conjugated, either directly or through a linker (spacer), to the bispecific PSMC. However, where both the biologically active molecule and the bispecific PSMC are both polypeptides it may be desired to recombinantly express the chimeric molecule as a single-chain fusion protein.
[00179] In one embodiment, the bispecific and/or multispecific PSMC is chemically conjugated to the biologically active molecule (e.g., a cytotoxin, a label, a ligand, a drug, a PSMC, a liposome, etc.). Means of chemically conjugating molecules are well known to those of skill in the art.
[00180] The procedure for attaching an agent to a PSMC or other polypeptide targeting molecule will vary according to the chemical structure of the agent. Polypeptides typically
contain variety of functional groups; e.g., carboxylic acid (COOH) or free amine (— NH2) groups, which are available for reaction with a suitable functional group on a biologically active molecule to bind the biologically active molecule thereto.
[00181] Alternatively, the bispecific PSMC and/or biologically active molecule can be derivatized to expose or attach additional reactive functional groups. The derivatization can involve attachment of any of a number of linker molecules such as those available from Pierce Chemical Company, Rockford, 111.
[00182] In some circumstances, it may be desirable to free the biologically active molecule from the bispecific and/or multispecific PSMC, or activate a prodrug, when the chimeric moiety has reached its target site. Therefore, chimeric conjugates comprising linkages that are cleavable in the vicinity of the target site can be used when the biologically active molecule is to be released at the target site. Cleaving of the linkage to release the agent from the PSMC may be prompted by enzymatic activity or conditions to which the immunoconjugate is subjected either inside the target cell or in the vicinity of the target site. When the target site is a tumor, a linker which is cleavable under conditions present at the tumor site (e.g. when exposed to tumor-associated enzymes or acidic pH) may be used.
[00183] A number of different cleavable linkers are known to those of skill in the art.
See U.S. Pat. Nos. 4,618,492; 4,542,225, and 4,625,014. The mechanisms for release of an agent from these linker groups include, for example, irradiation of a photolabile bond and acid-catalyzed hydrolysis. U.S. Pat. No. 4,671,958, for example, includes a description of immunoconjugates comprising linkers which are cleaved at the target site in vivo by the proteolytic enzymes of the patient's complement system. The length of the linker may be predetermined or selected depending upon a desired spatial relationship between the PSMC and the molecule linked to it. In view of the large number of methods that have been reported for attaching a variety of radiodiagnostic compounds, radiotherapeutic compounds, drugs, toxins, and other agents to antibodies one skilled in the art will be able to determine a suitable method for attaching a given agent to a PSMC or other polypeptide.
[00184] In certain embodiments, the biologically active molecule comprises a chelate that is attached to a PSMC or to an epitope tag. The bispecific and/or multispecific PSMC bears a corresponding epitope tag or PSMC so that simple contacting of the bispecific and/or multispecific PSMC to the chelate results in attachment of the PSMC to the biologically active molecule. The combining step can be performed after the moiety is used (pretargeting strategy) or the target tissue can be bound to the bispecific and/or multispecific PSMC before
the chelate is delivered. Methods of producing chelates suitable for coupling to various targeting moieties are well known to those of skill in the art (see, e.g., U.S. Pat. Nos. 6,190,923, 6,187,285, 6,183,721 , 6, 177,562, 6,159,445, 6,153,775, 6,149,890, 6,143,276, 6,143,274, 6, 139,819, 6, 132,764, 6,123,923, 6,123,921 , 6,120,768, 6, 120,751 , 6,1 17,412, 6,106,866, 6,096,290, 6,093,382, 6,090,800, 6,090,408, 6,088,613, 6,077,499, 6,075,010, 6,071 ,494, 6,071 ,490, 6,060,040, 6,056,939, 6,051 ,207, 6,048,979, 6,045,821 , 6,045,775, 6,030,840, 6,028,066, 6,022,966, 6,022,523, 6,022,522, 6,017,522, 6,015,897, 6,010,682, 6,010,681 , 6,004,533, and 6,001 ,329).
[00185] Where the bispecific and/or multispecific PSMC and/or the biologically active molecule are both single chain proteins and relatively short (i.e., less than about 50 amino acids) they can be synthesized using standard chemical peptide synthesis techniques. Where both components are relatively short, the chimeric moiety can be synthesized as a single contiguous polypeptide. Alternatively, a bispecific and/or multispecific PSMC and the biologically active molecule may be synthesized separately and then fused by condensation of the amino terminus of one molecule with the carboxyl terminus of the other molecule thereby forming a peptide bond. Alternatively, the bispecific and/or multispecific PSMC and biologically active molecules may each be condensed with one end of a peptide spacer molecule thereby forming a contiguous fusion protein.
[00186] Solid phase synthesis in which the C-terminal amino acid of the sequence is attached to an insoluble support followed by sequential addition of the remaining amino acids in the sequence is the preferred method for the chemical synthesis of the polypeptides of this invention. Techniques for solid phase synthesis are described by Barany and Merrifield, Solid-Phase Peptide Synthesis; pp. 3-284 in The Peptides: Analysis, Synthesis, Biology. Vol. 2: Special Methods in Peptide Synthesis, Part A., Merrifield, et al. J. Am. Chem. Soc, 85: 2149-2156 (1963), and Stewart et al., Solid Phase Peptide Synthesis, 2nd ed. Pierce Chem. Co., Rockford, 111. (1984).
[00187] A "bifunctional polymer" refers to a polymer comprising two discrete functional groups that are capable of reacting specifically with other moieties (including but not limited to, amino acid side groups) to form covalent or non-covalent linkages. A bifunctional linker having one functional group reactive with a group on a particular biologically active component, and another group reactive with a group on a second biological component, may be used to form a conjugate that includes the first biologically active component, the bifunctional linker and the second biologically active component.
Many procedures and linker molecules for attachment of various compounds to peptides are known. See, e.g., European Patent Application No. 188,256; U.S. Patent Nos. 4,671 ,958, 4,659,839, 4,414,148, 4,699,784; 4,680,338; 4,569,789; and 4,589,071 which are incorporated by reference herein. A "multi-functional polymer" refers to a polymer comprising two or more discrete functional groups that are capable of reacting specifically with other moieties (including but not limited to, amino acid side groups) to form covalent or non-covalent linkages. A bi-functional polymer or multi-functional polymer may be any desired molecular length or molecular weight, and may be selected to provide a particular desired spacing or conformation between one of molecules linked to the PSMC.
[00188] Where substituent groups are specified by their conventional chemical formulas, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, for example, the structure -CH20- is equivalent to the structure -OCH2-.
[00189] The term "substituents" includes but is not limited to "non-interfering substituents". "Non-interfering substituents" are those groups that yield stable compounds. Suitable non- interfering substituents or radicals include, but are not limited to, halo, C\ -C10 alkyl, C2-Ci0 alkenyl, C2-Ci0 alkynyl, Ci-Cio alkoxy, Ci-C12 aralkyl, C1-C12 alkaryl, C3-Ci2 cycloalkyl, C3-Ci2 cycloalkenyl, phenyl, substituted phenyl, toluoyl, xylenyl, biphenyl, C2- Ci2 alkoxyalkyl, C2-Ci2 alkoxyaryl, C7-C[2 aryloxyalkyl, C7-Ci2 oxyaryl, Ci-C6 alkylsulfinyl, C 1-C10 alkylsulfonyl, -(CH2)m -O-(Ci-Ci0 alkyl) wherein m is from 1 to 8, aryl, substituted aryl, substituted alkoxy, fluoroalkyl, heterocyclic radical, substituted heterocyclic radical, nitroalkyl, -N02, ~CN, ~NRC(O)-(C1-C,0 alkyl), -C(O)--(Ci-C,0 alkyl), C2-C10 alkyl thioalkyl, -C(0)0-( C,-C10 alkyl), -OH, -SO2, =S, -COOH, -NR2, carbonyl, ~C(O)-(C,- C,o alkyl)-CF3, --C(O)— CF3, -C(O)NR2, --(C,-C10 aryl)-S-(C6-C10 aryl), -C(O)-(C,-Ci0 aryl), -(CH2)m -O-(~(CH2)m~O-(Ci-Ci0 alkyl) wherein each m is from 1 to 8, -C(O)NR2, -C(S)NR2, - SO2NR2j --NRC(O) NR2, -NRC(S) NR2, salts thereof, and the like. Each R as used herein is H, alkyl or substituted alkyl, aryl or substituted aryl, aralkyl, or alkaryl.
[00190] The term "halogen" includes fluorine, chlorine, iodine, and bromine.
[00191] The term "alkyl," by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain, or cyclic hydrocarbon radical, or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e. CpCio means one to ten carbons). Examples of saturated hydrocarbon radicals include, but are not limited to,
groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, cyclohexyl, (cyclohexyl)methyl, cyclopropylmethyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3- (1 ,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers. The term "alkyl," unless otherwise noted, is also meant to include those derivatives of alkyl defined in more detail below, such as "heteroalkyl." Alkyl groups which are limited to hydrocarbon groups are termed "homoalkyl".
[00192] The term "alkylene" by itself or as part of another substituent means a divalent radical derived from an alkane, as exemplified, but not limited, by the structures -CH2CH2- and -CH2CH2CH2CH2-, and further includes those groups described below as "heteroalkylene." Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred in the present invention. A "lower alkyl" or "lower alkylene" is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms.
[00193] The terms "alkoxy," "alkylamino" and "alkylthio" (or thioalkoxy) are used in their conventional sense, and refer to those alkyl groups attached to the remainder of the molecule via an oxygen atom, an amino group, or a sulfur atom, respectively.
[00194] The term "heteroalkyl," by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or cyclic hydrocarbon radical, or combinations thereof, consisting of the stated number of carbon atoms and at least one heteroatom selected from the group consisting of O, N, Si and S, and wherein the nitrogen and sulfur atoms may optionally be oxidized and the nitrogen heteroatom may optionally be quaternized. The heteroatom(s) O, N and S and Si may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule. Examples include, but are not limited to, -CH2-CH2-0-CH3, -CH2-CH2-NH- CH3, -CH2-CH2-N(CH3)-CH3, -CH2-S-CH2-CH3, -CH2-CH2,-S(0)-CH3, -CH2-CH2-S(0)2- CH3, -CH=CH-0-CH3, -Si(CH3)3, -CH2-CH=N-OCH3, and -CH=CH-N(CH3)-CH3. Up to two heteroatoms may be consecutive, such as, for example, -CH2-NH-OCH3 and -CH2-0- Si(CH3)3. Similarly, the term "heteroalkylene" by itself or as part of another substituent means a divalent radical derived from heteroalkyl, as exemplified, but not limited by, -CH2- CH2-S-CH2-CH2- and -CH2-S-CH2-CH2-NH-CH2-. For heteroalkylene groups, the same or
different heteroatoms can also occupy either or both of the chain termini (including but not limited to, alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, aminooxyalkylene, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula -C(0)2R'- represents both -C(0)2R'- and -R'C(0)2-.
[00195] The terms "cycloalkyl" and "heterocycloalkyl", by themselves or in combination with other terms, represent, unless otherwise stated, cyclic versions of "alkyl" and "heteroalkyl", respectively. Thus, a cycloalkyl or heterocycloalkyl include saturated and unsaturated ring linkages. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3- cyclohexenyl, cycloheptyl, and the like. Examples of heterocycloalkyl include, but are not limited to, l-(l ,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4- morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1-piperazinyl, 2-piperazinyl, and the like. Additionally, the term encompasses bicyclic and tricyclic ring structures. Similarly, the term "heterocycloalkylene" by itself or as part of another substituent means a divalent radical derived from heterocycloalkyl, and the term "cycloalkylene" by itself or as part of another substituent means a divalent radical derived from cycloalkyl.
[00196] As used herein, the term "water soluble polymer" refers to any polymer that is soluble in aqueous solvents. Linkage of water soluble polymers to PSMC can result in changes including, but not limited to, increased or modulated serum half-life, or increased or modulated therapeutic half-life relative to the unmodified form, modulated immunogenicity, modulated physical association characteristics such as aggregation and multimer formation, altered receptor binding and altered receptor dimerization or multimerization. The water soluble polymer may or may not have its own biological activity, and may be utilized as a linker for attaching a PSMC to other substances, including but not limited to one or more PSMC's, or one or more biologically active molecules. Suitable polymers include, but are not limited to, polyethylene glycol, polyethylene glycol propionaldehyde, mono CI -CIO alkoxy or aryloxy derivatives thereof (described in U.S. Patent No. 5,252,714 which is incorporated by reference herein), monomethoxy-polyethylene glycol, polyvinyl pyrrolidone, polyvinyl alcohol, polyamino acids, divinylether maleic anhydride, N-(2-Hydroxypropyl)- methacrylamide, dextran, dextran derivatives including dextran sulfate, polypropylene glycol,
polypropylene oxide/ethylene oxide copolymer, polyoxyethylated polyol, heparin, heparin fragments, polysaccharides, oligosaccharides, glycans, cellulose and cellulose derivatives, including but not limited to methylcellulose and carboxymethyl cellulose, starch and starch derivatives, polypeptides, polyalkylene glycol and derivatives thereof, copolymers of polyalkylene glycols and derivatives thereof, polyvinyl ethyl ethers, and alpha-beta-poly[(2- hydroxyethyl)-DL-aspartamide, and the like, or mixtures thereof. Examples of such water soluble polymers include, but are not limited to, polyethylene glycol and serum albumin.
[00197] As used herein, the term "polyalkylene glycol" or "poly(alkene glycol)" refers to polyethylene glycol (poly(ethylene glycol)), polypropylene glycol, polybutylene glycol, and derivatives thereof. The term "polyalkylene glycol" encompasses both linear and branched polymers and average molecular weights of between 0.1 kDa and 100 kDa. Other exemplary embodiments are listed, for example, in commercial supplier catalogs, such as Shearwater Corporation's catalog "Polyethylene Glycol and Derivatives for Biomedical Applications" (2001).
[00198] The term "aryl" means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent which can be a single ring or multiple rings (preferably from 1 to 3 rings) which are fused together or linked covalently. The term "heteroaryl" refers to aryl groups (or rings) that contain from one to four heteroatoms selected from N, O, and S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. A heteroaryl group can be attached to the remainder of the molecule through a heteroatom. Non-limiting examples of aryl and heteroaryl groups include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2- imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5- benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2- quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, and 6-quinolyl. Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below.
[00199] For brevity, the term "aryl" when used in combination with other terms
(including but not limited to, aryloxy, arylthioxy, arylalkyl) includes both aryl and heteroaryl rings as defined above. Thus, the term "arylalkyl" is meant to include those radicals in which an aryl group is attached to an alkyl group (including but not limited to, benzyl, phenethyl,
pyridylmethyl and the like) including those alkyl groups in which a carbon atom (including but not limited to, a methylene group) has been replaced by, for example, an oxygen atom (including but not limited to, phenoxymethyl, 2-pyridyloxymethyl, 3-(l -naphthyloxy)propyl, and the like).
[00200] Each of the above terms (including but not limited to, "alkyl," "heteroalkyl,"
"aryl" and "heteroaryl") are meant to include both substituted and unsubstituted forms of the indicated radical. Exemplary substituents for each type of radical are provided below.
[00201] Substituents for the alkyl and heteroalkyl radicals (including those groups often referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl, cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) can be one or more of a variety of groups selected from, but not limited to: -OR', =0, -NR', =N-OR', -NR'R", -SR\ -halogen, -SiR'R"R"', -OC(0)R', -C(0)R', -C02R', -CONR'R", -OC(0)NR'R", -NR"C(0)R', -NR'-C(0)NR"R"', -NR"C(0)2R', -NR-C(NR'R"R"')=NR"", -NR-C(NR'R")=NR'", - S(0)R', -S(0)2R\ -S(0)2NR'R", -NRS02R', -CN and -N02 in a number ranging from zero to (2m'+l), where m' is the total number of carbon atoms in such a radical. R', R", R'" and R"" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1 -3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present. When R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring. For example, - NR'R" is meant to include, but not be limited to, 1 -pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term "alkyl" is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF3 and -CH2CF3) and acyl (including but not limited to, -C(0)CH3, -C(0)CF3, -C(0)CH2OCH3, and the like).
[00202] Similar to the substituents described for the alkyl radical, substituents for the aryl and heteroaryl groups are varied and are selected from, but are not limited to: halogen, -OR', =0, =NR', =N-OR', -NR'R", -SR', -halogen, -SiR'R"R"', -OC(0)R', -C(0)R', -C02R', -CONR'R", -OC(0)NR'R", -NR"C(0)R\ -NR'-C(0)NR"R"', -NR"C(0)2R', -NR- C(NR'R"R"')=NR"", -NR-C(NR'R")=NR"', -S(0)R', -S(0)2R', -S(0)2NR'R", -NRS02R', - CN and -N02, -R', -N3, -CH(Ph)2, fluoro(d-C4)alkoxy, and fluoro(Ci-C4)alkyl, in a number
ranging from zero to the total number of open valences on the aromatic ring system; and where R', R", R'" and R"" are independently selected from hydrogen, alkyl, heteroalkyl, aryl and heteroaryl. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present.
[00203] As used herein, the term "modulated serum half-life" means the positive or negative change in circulating half-life of a modified PSMC relative to its non-modified form. Serum half-life is measured by taking blood samples at various time points after administration of PSMC, and determining the concentration of that molecule in each sample. Correlation of the serum concentration with time allows calculation of the serum half-life. Increased serum half-life desirably has at least about two-fold, but a smaller increase may be useful, for example where it enables a satisfactory dosing regimen or avoids a toxic effect. In some embodiments, the increase is at least about three-fold, at least about five-fold, or at least about ten-fold.
[00204] The term "modulated therapeutic half-life" as used herein means the positive or negative change in the half-life of the therapeutically effective amount of a PSMC or PSMC comprising a modified biologically active molecule, relative to its non-modified form. Therapeutic half-life is measured by measuring pharmacokinetic and/or pharmacodynamic properties of the molecule at various time points after administration. Increased therapeutic half-life desirably enables a particular beneficial dosing regimen, a particular beneficial total dose, or avoids an undesired effect. In some embodiments, the increased therapeutic half-life results from increased potency, increased or decreased binding of the modified molecule to its target, or an increase or decrease in another parameter or mechanism of action of the non- modified molecule.
[00205] The term "isolated," when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is substantially free of other cellular components with which it is associated in the natural state. It can be in a homogeneous state. Isolated substances can be in either a dry or semi-dry state, or in solution, including but not limited to, an aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein which is the predominant species present in a preparation is substantially purified. In particular, an isolated gene is separated from open reading frames which flank the gene and encode a protein other than the gene of interest. The term
"purified" denotes that a nucleic acid or protein gives rise to substantially one band in an electrophoretic gel. Particularly, it means that the nucleic acid or protein is at least 85% pure, at least 90% pure, at least 95% pure, at least 99% or greater pure.
[00206] The term "nucleic acid" refers to deoxyribonucleotides, deoxyribonucleosides, ribonucleosides, or ribonucleotides and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless specifically limited otherwise, the term also refers to oligonucleotide analogs incuding PNA (peptidonucleic acid), analogs of DNA used in antisense technology (phosphorothioates, phosphoroamidates, and the like). Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (including but not limited to, degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260.2605-2608 (1985); and Cassol et al. (1992); Rossolini et al, Mol. Cell. Probes 8:91-98 (1994)).
[00207] The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. That is, a description directed to a polypeptide applies equally to a description of a peptide and a description of a protein, and vice versa. The terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally encoded amino acid. As used herein, the terms encompass amino acid chains of any length, including full length proteins {i.e. , antigens), wherein the amino acid residues are linked by covalent peptide bonds.
[00208] The term "amino acid" refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and
selenocysteine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
[00209] Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
[00210] "Conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, "conservatively modified variants" refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein which encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence.
[00211] As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in
the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
[00212] The following eight groups each contain amino acids that are conservative substitutions for one another:
1) Alanine (A), Glycine (G);
2) Aspartic acid (D), Glutamic acid (E);
3) Asparagine (N), Glutamine (Q);
4) Arginine (R), Lysine (K);
5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V);
6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);
7) Serine (S), Threonine (T); and
8) Cysteine (C), Methionine (M)
(see, e.g., Creighton, Proteins: Structures and Molecular Properties (W H Freeman & Co.; 2nd edition (December 1993)
[00213] The terms "identical" or percent "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Sequences are "substantially identical" if they have a percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, optionally about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection. This definition also refers to the complement of a test sequence. The identity can exist over a region that is at least about 50 amino acids or nucleotides in length, or over a region that is 75-100 amino acids or nucleotides in length, or, where not specified, across the entire sequence or a polynucleotide or polypeptide.
[00214] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated. The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
[00215] A "comparison window", as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, including but not limited to, by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Nat 'l. Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Ausubel et al., Current Protocols in Molecular Biology (1995 supplement)).
[00216] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al. (1977) Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol. Biol. 215:403-410, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 1 1 , an expectation (E) or 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89: 10915) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands. The BLAST algorithm is typically performed with the "low complexity" filter turned off.
[00217] The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., arlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a
comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01 , and most preferably less than about 0.001.
[00218] The phrase "selectively (or specifically) hybridizes to" refers to the binding, duplexing, or hybridizing of a molecule only to a particular nucleotide sequence under stringent · hybridization conditions when that sequence is present in a complex mixture (including but not limited to, total cellular or library DNA or R A).
[00219] The phrase "stringent hybridization conditions" refers to conditions of low ionic strength and high temperature as is known in the art. Typically, under stringent conditions a probe will hybridize to its target subsequence in a complex mixture of nucleic acid (including but not limited to, total cellular or library DNA or RNA) but does not hybridize to other sequences in the complex mixture. Stringent conditions are sequence- dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher .temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Techniques in Biochemistry and Molecular Biology— Hybridization with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays" (1993). Generally, stringent conditions are selected to be about 5-10° C lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength pH. The Tm is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium). Stringent conditions may be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (including but not limited to, 10 to 50 nucleotides) and at least about 60° C for long probes (including but not limited to, greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal may be at least two times background, optionally 10 times background hybridization. Exemplary stringent hybridization conditions can be as following: 50% formamide, 5X SSC, and 1% SDS, incubating at 42°C, or 5X SSC, 1% SDS, incubating at 65°C, with wash in 0.2X SSC, and 0.1% SDS at 65°C. Such washes can be performed for 5, 15, 30, 60, 120, or more minutes.
[00220] As used herein, the term "eukaryote" refers to organisms belonging to the phylogenetic domain Eucarya such as animals (including but not limited to, mammals,
insects, reptiles, birds, etc.), ciliates, plants (including but not limited to, monocots, dicots, algae, etc.), fungi, yeasts, flagellates, microsporidia, protists, etc.
[00221] As used herein, the term "non-eukaryote" refers to non-eukaryotic organisms.
For example, a non-eukaryotic organism can belong to the Eubacteria (including but not limited to, Escherichia coli, Thermus thermophilus, Bacillus stearothermophilus, Pse domonas fluorescens, Pseudomonas aeruginosa, Pseudomonas putida, etc.) phylogenetic domain, or the Archaea (including but not limited to, Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium such as Haloferax volcanii and Halobacterium species NRC-1, Archaeoglobus fulgidus, Pyrococcus furiosus, Pyrococcus horikoshii, Aeuropyrum pernix, etc.) phylogenetic domain.
[00222] The term "subject" as used herein, refers to an animal, preferably a mammal, most preferably a human, who is the object of treatment, observation or experiment.
[00223] The term "effective amount" as used herein refers to that amount of the
(modified) non-natural amino acid polypeptide being administered which will relieve to some extent one or more of the symptoms of the disease, condition or disorder being treated. Compositions containing the (modified) non-natural amino acid polypeptide described herein can be administered for prophylactic, enhancing, and/or therapeutic treatments.
[00224] The terms "enhance" or "enhancing" means to increase or prolong either in potency or duration a desired effect. Thus, in regard to enhancing the effect of therapeutic agents, the term "enhancing" refers to the ability to increase or prolong, either in potency or duration, the effect of other therapeutic agents on a system. An "enhancing-effective amount," as used herein, refers to an amount adequate to enhance the effect of another therapeutic agent in a desired system. When used in a patient, amounts effective for this use will depend on the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician.
[00225] The term "modified," as used herein refers to the presence of a post- translational modification on a polypeptide. The form "(modified)" term means that the polypeptides being discussed are optionally modified, that is, the polypeptides under discussion can be modified or unmodified.
[00226] The term "post-translationally modified" and "modified" refers to any modification of a natural or non-natural amino acid that occurs to such an amino acid after it has been incorporated into a polypeptide chain. The term encompasses, by way of example
only, co-translational in vivo modifications, post-translational in vivo modifications, and post- translational in vitro modifications.
[00227] In prophylactic applications, compositions containing the (modified) non- natural amino acid polypeptide are administered to a patient susceptible to or otherwise at risk of a particular disease, disorder or condition. Such an amount is defined to be a "prophylactically effective amount." In this use, the precise amounts also depend on the patient's state of health, weight, and the like. It is considered well within the skill of the art for one to determine such prophylactically effective amounts by routine experimentation (e.g., a dose escalation clinical trial).
[00228] The term "protected" refers to the presence of a "protecting group" or moiety that prevents reaction of the chemically reactive functional group under certain reaction conditions. The protecting group will vary depending on the type of chemically reactive group being protected. For example, if the chemically reactive group is an amine or a hydrazide, the protecting group can be selected from the group of tert-butyloxycarbonyl (t- Boc) and 9-fluorenylmethoxycarbonyl (Fmoc). If the chemically reactive group is a thiol, the protecting group can be orthopyridyldi sulfide. If the chemically reactive group is a carboxylic acid, such as butanoic or propionic acid, or a hydroxyl group, the protecting group can be benzyl or an alkyl group such as methyl, ethyl, or tert-butyl. Other protecting groups-known in the art may also be used in or with the methods and compositions described herein.
Et t-butyl TBDMS
Fmoc
[00230] Other protecting groups are described in Greene and Wuts, Protective Groups in Organic Synthesis, 3rd Ed., John Wiley & Sons, New York, NY, 1999, which is incorporated herein by reference in its entirety.
[00231] In therapeutic applications, compositions containing the (modified) non- natural amino acid polypeptide are administered to a patient already suffering from a disease, condition or disorder, in an amount sufficient to cure or at least partially arrest the symptoms of the disease, disorder or condition. Such an amount is defined to be a "therapeutically effective amount," and will depend on the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician. It is considered well within the skill of the art for one to determine such therapeutically effective amounts by routine experimentation (e.g., a dose escalation clinical trial).
[00232] The term "treating" is used to refer to either prophylactic and/or therapeutic treatments.
[00233] Unless otherwise indicated, conventional methods of mass spectroscopy,
NMR, HPLC, protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art are employed.
DETAILED DESCRIPTION
/. Introduction
[00234] PSMC molecules comprising at least one unnatural amino acid are provided in the invention. In certain embodiments of the invention, PSMC with at least one unnatural amino acid includes at least one post-translational modification. In one embodiment, the at least one post-translational modification comprises attachment of a molecule including but not limited to, a label, a dye, a polymer, a water-soluble polymer, a derivative of polyethylene glycol, a photocrosslinker, a cytotoxic compound, a radionuclide, a drug, an affinity label, a photoaffinity label, a reactive compound, a resin, a second protein or polypeptide or polypeptide analog, an antibody or antibody fragment, a metal chelator, a cofactor, a fatty acid, a carbohydrate, a polynucleotide, a DNA, a RNA, an antisense polynucleotide, a water- soluble dendrimer, a cyclodextrin, an inhibitory ribonucleic acid, a biomaterial, a nanoparticle, a spin label, a fluorophore, a metal-containing moiety, a radioactive moiety, a novel functional group, a group that covalently or noncovalently interacts with other molecules, a photocaged moiety, a photoisomerizable moiety, biotin, a derivative of biotin, a biotin analogue, a moiety incorporating a heavy atom, a chemically cleavable group, a
photocleavable group, an elongated side chain, a carbon-linked sugar, a redox-active agent, an amino thioacid, a toxic moiety, an isotopically labeled moiety, a biophysical probe, a phosphorescent group, a chemiluminescent group, an electron dense group, a magnetic group, an intercalating group, a chromophore, an energy transfer agent, a biologically active agent, a detectable label, a small molecule, or any combination of the above or any other desirable compound or substance, comprising a second reactive group to at least one unnatural amino acid comprising a first reactive group utilizing chemistry methodology that is known to one of ordinary skill in the art to be suitable for the particular reactive groups. For example, the first reactive group is an alkynyl moiety (including but not limited to, in the unnatural amino acid -propargyloxyphenylalanine, where the propargyl group is also sometimes referred to as an acetylene moiety) and the second reactive group is an azido moiety, and [3+2] cycloaddition chemistry methodologies are utilized. In another example, the first reactive group is the azido moiety (including but not limited to, in the unnatural amino acid >-azido- L-phenylalanine) and the second reactive group is the alkynyl moiety. In certain embodiments of the modified PSMC polypeptide of the present invention, at least one unnatural amino acid (including but not limited to, unnatural amino acid containing a keto functional group) comprising at least one post-translational modification, is used where the at least one post-translational modification comprises a saccharide moiety. In certain embodiments, the post-translational modification is made in vivo in a eukaryotic cell or in a non-eukaryotic cell.
[00235] In certain embodiments, the protein includes at least one post-translational modification that is made in vivo by one host cell, where the post-translational modification is not normally made by another host cell type. In certain embodiments, the protein includes at least one post-translational modification that is made in vivo by a eukaryotic cell, where the post-translational modification is not normally made by a non-eukaryotic cell. Examples of post-translational modifications include, but are not limited to, acetylation, acylation, lipid- modification, palmitoylation, palmitate addition, phosphorylation, glycolipid-linkage modification, and the like. In one embodiment, the post-translational modification comprises attachment of an oligosaccharide to an asparagine by a GlcNAc-asparagine linkage (including but not limited to, where the oligosaccharide comprises (GlcNAc-Man)2-Man- GlcNAc-GlcNAc, and the like). In another embodiment, the post-translational modification comprises attachment of an oligosaccharide (including but not limited to, Gal-GalNAc, Gal- GlcNAc, etc.) to a serine or threonine by a GalNAc-serine, a GalNAc-threonine, a GlcNAc-
serine, or a GlcNAc-threonine linkage. In certain embodiments, a protein or polypeptide of the invention can comprise a secretion or localization sequence, an epitope tag, a FLAG tag, a polyhistidine tag, a GST fusion, and/or the like. Examples of secretion signal sequences include, but are not limited to, a prokaryotic secretion signal sequence, an eukaryotic secretion signal sequence, an eukaryotic secretion signal sequence 5 '-optimized for bacterial expression, a novel secretion signal sequence, pectate lyase secretion signal sequence, Omp A secretion signal sequence, and a phage secretion signal sequence. Examples of secretion signal sequences, include, but are not limited to, STII (prokaryotic), Fd GUI and Ml 3 (phage), Bgl2 (yeast), and the signal sequence bla derived from a transposon.
[00236] An antigen-binding polypeptide comprising a non-natural amino acid may be used to modulate the therapeutic half-life, serum half-life, or circulation time of biologically active molecules, including but not limited to, small molecules, peptides, and oligonucleotides. Such small molecules, peptides, and oligonucleotides may have biological activities that include, but are not limited to, binding and/or recognition of a target molecule or cell type, anti-tumor, anti-angiogenic, anti-viral, and apoptotic activities. In addition, the antigen-binding polypeptide comprising a non-natural amino acid may provide a desired activity, including, but not limited to, effector function such as ADCC, phagocytosis, or complement-dependent cytotoxicity, activation of prodrugs, enzymatic activity, catalytic activity, blocking of protein-protein interactions, binding to a desired antigen, and targeting of the small molecule to a desired site. The blocking of protein-protein interactions of a PSMC may modulate one or more activities of the attached biologically active molecule. Small molecules may be used as antagonists to interfere with the binding activities of other proteins or molecules.
[00237] The antigen-binding polypeptide and the small molecule may be joined by a linker, polymer or covalent bond. The linker, polymer, or small molecule itself may comprise a functional group that is unreactive toward the 20 common amino acids. The linker or polymer may be bifunctional. One or more bonds involved in joining the antigen- binding polypeptide via the linker, polymer, or covalent bond to the biologically active molecule may be irreversible, reversible or labile under desired conditions. One or more bonds involved in joining the antigen-binding polypeptide via the linker, polymer, or covalent bond to a molecule may allow modulated release of the antigen-binding polypeptide or other molecule. A diversity of small molecules may be generated by one skilled in the art by chemical means, isolation as natural products, or other means.
[00238] Rader et al. in Proc Natl Acad Sci U S A. 2003 Apr 29; 100(9):5396-400, which is incorporated by reference herein, describe a method to provide effector function and extended serum half-life to small synthetic molecules via reacting them with a generic antibody molecule. The complex described was created by a reversible covalent bond between mAb 38C2, a catalytic antibody that mimics natural aldolase enzymes, and a diketone derivative of an integrin targeting Arg-Gly-Asp peptidomimetic via a reactive lysine residue on the antibody. In addition to an increase in half life of the peptidomimetic, the complex showed selective retargeting of the antibody to the surface of integrin ανβ3 and ανβ5 expressing cells.
[00239] The protein or polypeptide of interest can contain at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or ten or more unnatural amino acids. The unnatural amino acids can be the same or different, for example, there can be 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 or more different sites in the protein that comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more different unnatural amino acids. In certain embodiments, at least one, but fewer than all, of a particular amino acid present in a naturally occurring version of the protein is substituted with an unnatural amino acid.
[00240] The present invention provides methods and compositions based on antigen- binding polypeptides, or PSMC, comprising at least one non-naturally encoded amino acid. Introduction of at least one non-naturally encoded amino acid into a PSMC can allow for the application of conjugation chemistries that involve specific chemical reactions, including, but not limited to, with one or more non-naturally encoded amino acids while not reacting with the commonly occurring 20 amino acids. In some embodiments, the PSMC comprising the non-naturally encoded amino acid is linked to a water soluble polymer, such as polyethylene glycol (PEG), via the side chain of the non-naturally encoded amino acid. This invention provides a highly efficient method for the selective modification of proteins with PEG derivatives, which involves the selective incorporation of non-genetically encoded amino acids, including but not limited to, those amino acids containing functional groups or substituents not found in the 20 naturally incorporated amino acids, including but not limited to a ketone, an azide or acetylene moiety, into proteins in response to a selector codon and the subsequent modification of those amino acids with a suitably reactive PEG derivative. Once incorporated, the amino acid side chains can then be modified by utilizing chemistry methodologies known to those of ordinary skill in the art to be suitable for the particular functional groups or substituents present in the naturally encoded amino acid. Known
chemistry methodologies of a wide variety are suitable for use in the present invention to incorporate a water soluble polymer into the protein. Such methodologies include but are not limited to a Huisgen [3+2] cycloaddition reaction {see, e.g., Padwa, A. in Comprehensive Organic Synthesis. Vol. 4. (1991) Ed. Trost, B. M., Pergamon, Oxford, p. 1069-1 109; and, Huisgen, R. in 1 ,3-Dipolar Cycloaddition Chemistry, (1984) Ed. Padwa, A., Wiley, New York, p. 1-176) with, including but not limited to, acetylene or azide derivatives, respectively.
[00241] Because the Huisgen [3+2] cycloaddition method involves a cycloaddition rather than a nucleophilic substitution reaction, proteins can be modified with extremely high selectivity. The reaction can be carried out at room temperature in aqueous conditions with excellent regioselectivity (1 ,4 > 1 ,5) by the addition of catalytic amounts of Cu(I) salts to the reaction mixture. See, e.g., Tornoe, et al., (2002) Org. Chem. 67:3057-3064; and, Rostovtsev, et al., (2002) Angew. Chem. Int. Ed. 41 :2596-2599; and WO 03/101972. A molecule that can be added to a protein of the invention through a [3+2] cycloaddition includes virtually any molecule with a suitable functional group or substituent including but not limited to an azido or acetylene derivative. These molecules can be added to an unnatural amino acid with an acetylene group, including but not limited to, p- propargyloxyphenylalanine, or azido group, including but not limited to p-azido- phenylalanine, respectively.
[00242] The five-membered ring that results from the Huisgen [3+2] cycloaddition is not generally reversible in reducing environments and is stable against hydrolysis for extended periods in aqueous environments. Consequently, the physical and chemical characteristics of a wide variety of substances can be modified under demanding aqueous conditions with the active PEG derivatives of the present invention. Even more important, because the azide and acetylene moieties are specific for one another (and do not, for example, react with any of the 20 common, genetically-encoded amino acids), proteins can be modified in one or more specific sites with extremely high selectivity.
[00243] The invention also provides water soluble and hydrolytically stable derivatives of PEG derivatives and related hydrophilic polymers having one or more acetylene or azide moieties. The PEG polymer derivatives that contain acetylene moieties are highly selective for coupling with azide moieties that have been introduced selectively into proteins in response to a selector codon. Similarly, PEG polymer derivatives that contain azide moieties are highly selective for coupling with acetylene moieties that have been introduced selectively into proteins in response to a selector codon.
[00244] More specifically, the azide moieties comprise, but are not limited to, alkyl azides, aryl azides and derivatives of these azides. The derivatives of the alkyl and aryl azides can include other substituents so long as the acetylene-specific reactivity is maintained. The acetylene moieties comprise alkyl and aryl acetylenes and derivatives of each. The derivatives of the alkyl and aryl acetylenes can include other substituents so long as the azide-specific reactivity is maintained.
[00245] PSMC comprising a non-naturally encoded amino acid may be used in assays that utilize the specificity of antibodies. For example, PSMC molecules of the invention may be used to screen a population of potential antigens.
[00246] The present invention provides conjugates of substances having a wide variety of functional groups, substituents or moieties, with other substances including but not limited to a label; a dye; a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a cytotoxic compound; a radionuclide; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a water- soluble dendrimer; a cyclodextrin; an inhibitory ribonucleic acid; a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal-containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a derivative of biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; a small molecule; or any combination of the above, or any other desirable compound or substance). The present invention also includes conjugates of substances having azide or acetylene moieties with PEG polymer derivatives having the corresponding acetylene or azide moieties. For example, a PEG polymer containing an azide moiety can be coupled to a biologically active molecule at a position in the protein that contains a non-genetically encoded amino acid bearing an acetylene functionality. The linkage by which the PEG and the biologically active molecule are coupled includes but is not limited to the Huisgen [3+2] cycloaddition product.
[00247] It is well established in the art that PEG can be used to modify the surfaces of biomaterials (see, e.g., U.S. Patent 6,610,281 ; Mehvar, R., J. Pharmaceut. Sci., 3(1): 125-136 (2000) which are incorporated by reference herein). The invention also includes biomaterials comprising a surface having one or more reactive azide or acetylene sites and one or more of the azide- or acetylene-containing polymers of the invention coupled to the surface via the Huisgen [3+2] cycloaddition linkage. Biomaterials and other substances can also be coupled to the azide- or acetylene-activated polymer derivatives through a linkage other than the azide or acetylene linkage, such as through a linkage comprising a carboxylic acid, amine, alcohol or thiol moiety, to leave the azide or acetylene moiety available for subsequent reactions.
[00248] The invention includes a method of synthesizing the azide- and acetylene- containing polymers of the invention. In the case of the azide-containing PEG derivative, the azide can be bonded directly to a carbon atom of the polymer. Alternatively, the azide- containing PEG derivative can be prepared by attaching a linking agent that has the azide moiety at one terminus to a conventional activated polymer so that the resulting polymer has the azide moiety at its terminus. In the case of the acetylene-containing PEG derivative, the acetylene can be bonded directly to a carbon atom of the polymer. Alternatively, the acetylene-containing PEG derivative can be prepared by attaching a linking agent that has the acetylene moiety at one terminus to a conventional activated polymer so that the resulting polymer has the acetylene moiety at its terminus.
[00249] More specifically, in the case of the azide-containing PEG derivative, a water soluble polymer having at least one active hydroxyl moiety undergoes a reaction to produce a substituted polymer having a more reactive moiety, such as a mesylate, tresylate, tosylate or halogen leaving group, thereon. The preparation and use of PEG derivatives containing sulfonyl acid halides, halogen atoms and other leaving groups are well known to the skilled artisan. The resulting substituted polymer then undergoes a reaction to substitute for the more reactive moiety an azide moiety at the terminus of the polymer. Alternatively, a water soluble polymer having at least one active nucleophilic or electrophilic moiety undergoes a reaction with a linking agent that has an azide at one terminus so that a covalent bond is formed between the PEG polymer and the linking agent and the azide moiety is positioned at the terminus of the polymer. Nucleophilic and electrophilic moieties, including amines, thiols, hydrazides, hydrazines, alcohols, carboxylates, aldehydes, ketones, thioesters and the like, are well known to the skilled artisan.
[00250] More specifically, in the case of the acetylene-containing PEG derivative, a water soluble polymer having at least one active hydroxyl moiety undergoes a reaction to displace a halogen or other activated leaving group from a precursor that contains an acetylene moiety. Alternatively, a water soluble polymer having at least one active nucleophilic or electrophilic moiety undergoes a reaction with a linking agent that has an acetylene at one terminus so that a covalent bond is formed between the PEG polymer and the linking agent and the acetylene moiety is positioned at the terminus of the polymer. The use of halogen moieties, activated leaving group, nucleophilic and electrophilic moieties in the context of organic synthesis and the preparation and use of PEG derivatives is well established to practitioners in the art.
[00251] The invention also provides a method for the selective modification of proteins to add other substances to the modified protein, including but not limited to water soluble polymers such as PEG and PEG derivatives containing an azide or acetylene moiety. The azide- and acetylene-containing PEG derivatives can be used to modify the properties of surfaces and molecules where biocompatibility, stability, solubility and lack of immunogenicity are important, while at the same time providing a more selective means of attaching the PEG derivatives to proteins than was previously known in the art.
//. A ntigen-Bin din g Polypeptides
[00252] There is a wide variety of PSMC's. PSMCs are themselves specific for a very wide variety of antigens. There is also a large number of a very wide variety of PSMC fragments that are antigen-specific. PSMC therefore is intended to include any polypeptide that demonstrates an ability to specifically bind to a target molecule or antigen. Any known antibody or antibody fragment is a PSMC.
[00253] PSMC's of the invention may comprise an Fc region or Fc-like region. The Fc domain provides the link to effector functions such as complement or phagocytic cells. The Fc portion of an immunoglobulin has a long plasma half-life, whereas the Fab is shortlived (Capon, et al. (1989), Nature, 337:525-531). When constructed together with a therapeutic protein, an Fc domain can provide longer half-life or incorporate such functions as Fc receptor binding, protein A binding, complement fixation and perhaps even placental transfer. For example, the Fc region of an IgGl antibody has been fused to the N-terminal end of CD30-L, a molecule which binds CD30 receptors expressed on Hodgkin's Disease tumor cells, anaplastic lymphoma cells, T-cell leukemia cells and other malignant cell types (U.S. Pat. No. 5,480,981). IL-10, an anti-inflammatory and antirejection agent has been fused
to murine Fcy2a in order to increase the cytokine's short circulating half-life. Zheng, X. et al. (1995), The Journal of Immunology, 154: 5590-5600. Studies have also evaluated the use of tumor necrosis factor receptor linked with the Fc protein of human IgGl to treat patients with septic shock. Fisher, C. et al., N. Engl. J. Med., 334: 1697-1702 (1996); Van Zee, K. et al., The Journal of Immunology, 156: 2221 -2230 (1996) and rheumatoid arthritis (Moreland, et al. (1997), N. Engl. J. Med., 337(3): 141 -147. Fc has also been fused with CD4 receptor to produce a therapeutic protein for treatment of AIDS (Capon et al. (1989), Nature, 337:525- 531). In addition, the N-terminus of interleukin 2 has also been fused to the Fc portion of IgGl or IgG3 to overcome the short half life of interleukin 2 and its systemic toxicity (Harvill et al. (1995), Immunotechnology, 1 : 95-105).
[00254] It is well known that Fc regions of antibodies are made up of monomeric polypeptide segments that may be linked into dimeric or multimeric forms by disulfide bonds or by non-covalent association. The number of intermolecular disulfide bonds between monomeric subunits of native Fc molecules ranges from 1 to 4 depending on the class (e.g., IgG, IgA, IgE) or subclass (e.g., IgGl , IgG2, IgG3, IgAl, IgGA2) of antibody involved. The term "Fc" as used herein is generic to the monomeric, dimeric, and multimeric forms of Fc molecules. It should be noted that Fc monomers will spontaneously dimerize when the appropriate Cys residues are present unless particular conditions are present that prevent dimerization through disulfide bond formation. Even if the Cys residues that normally form disulfide bonds in the Fc dimer are removed or replaced by other residues, the monomeric chains will generally dimerize through non-covalent interactions. The term "Fc" herein is used to mean any of these forms: the native monomer, the native dimer (disulfide bond linked), modified dimers (disulfide and/or non-covalently linked), and modified monomers (i.e., derivatives).
[00255] Variants, analogs or derivatives of the Fc portion may be constructed by, for example, making various substitutions of residues or sequences including non-naturally encoded amino acids. Variant (or analog) polypeptides include insertion variants, wherein one or more amino acid residues supplement an Fc amino acid sequence. Insertions may be located at either or both termini of the protein, or may be positioned within internal regions of the Fc amino acid sequence. Insertional variants with additional residues at either or both termini can include for example, fusion proteins and proteins including amino acid tags or labels. For example, the Fc molecule may optionally contain an N-terminal Met, especially when the molecule is expressed recombinantly in a bacterial cell such as E. coli. In Fc
deletion variants, one or more amino acid residues in an Fc polypeptide are removed. Deletions can be effected at one or both termini of the Fc polypeptide, or with removal of one or more residues within the Fc amino acid sequence. Deletion variants, therefore, include all fragments of an Fc polypeptide sequence. In Fc substitution variants, one or more amino acid residues of an Fc polypeptide are removed and replaced with alternative residues. In one aspect, the substitutions are conservative in nature, however, the invention embraces substitutions that are also non-conservative. For example, cysteine residues can be deleted or replaced with other amino acids to prevent formation of some or all disulfide crosslinks of the Fc sequences. A protein may have one or more cysteine residues, and one may remove each of these cysteine residues or substitute one or more such cysteine residues with other amino acids, such as Ala or Ser, or a non-naturally encoded amino acid. As another example, modifications may also be made to introduce amino acid substitutions to (1) ablate the Fc receptor binding site; (2) ablate the complement (Clq) binding site; and/or to (3) ablate the antibody dependent cell-mediated cytotoxicity (ADCC) site. Such sites are known in the art, and any known substitutions are within the scope of Fc as used herein. For example, see Molecular Immunology, Vol. 29, No. 5, 633-639 (1992) with regards to ADCC sites in IgGl . Likewise, one or more tyrosine residues can be replaced by phenylalanine residues as well. In addition, other variant amino acid insertions, deletions (e.g., from 1 -25 amino acids) and/or substitutions are also contemplated and are within the scope of the present invention. Conservative amino acid substitutions will generally be preferred. Furthermore, alterations may be in the form of altered amino acids, such as peptidomimetics or D-amino acids.
[00256] Fc sequences may also be derivatized, i.e., bearing modifications other than insertion, deletion, or substitution of amino acid residues. Preferably, the modifications are covalent in nature, and include for example, chemical bonding with polymers, lipids, other organic moieties, and inorganic moieties. Derivatives of the invention may be prepared to increase circulating half-life, or may be designed to improve targeting capacity for the polypeptide to desired cells, tissues, or organs. It is also possible to use the salvage receptor binding domain of the intact Fc molecule as the Fc part of the inventive compounds, such as described in WO 96/32478, entitled "Altered Polypeptides with Increased Half-Life". Additional members of the class of molecules designated as Fc herein are those that are described in WO 97/34631 , entitled "Immunoglobulin-Like Domains with Increased Half- Lives". Both of the published PCT applications cited in this paragraph are hereby incorporated by reference.
[00257] Additional PSMCs are likely to be discovered in the future. New PSMCs can be identified through computer-aided secondary and tertiary structure analyses of the predicted protein sequences, and by selection techniques designed to identify molecules that bind to a particular target. Such later discovered PSMCs also are included within this invention.
[00258] Thus, the description of PSMCs is provided for illustrative purposes and by way of example only and not as a limit on the scope of the methods, compositions, strategies and techniques described herein. Further, reference to PSMCs in this application is intended to use the generic term as an example of any PSMC. Thus, it is understood that the modifications and chemistries described herein with reference to a specific antigen-binding polypeptide or protein can be equally applied to any antigen-binding polypeptide, including those specifically listed herein.
///. General Recombinant Nucleic Acid Methods For Use With The Invention
[00259] In numerous embodiments of the present invention, nucleic acids encoding a PSMC of interest will be isolated, cloned and often altered using recombinant methods. Such embodiments are used, including but not limited to, for protein expression or during the generation of variants, derivatives, expression cassettes, or other sequences derived from an antigen-binding polypeptide. In some embodiments, the sequences encoding the polypeptides of the invention are operably linked to a heterologous promoter.
[00260] A nucleotide sequence encoding an antigen-binding polypeptide comprising a non-naturally encoded amino acid may be synthesized on the basis of the amino acid sequence of the parent polypeptide and then changing the nucleotide sequence so as to effect introduction (i.e., incorporation or substitution) or removal (i.e., deletion or substitution) of the relevant amino acid residue(s). The nucleotide sequence may be conveniently modified by site-directed mutagenesis in accordance with conventional methods. Alternatively, the nucleotide sequence may be prepared by chemical synthesis, including but not limited to, by using an oligonucleotide synthesizer, wherein oligonucleotides are designed based on the amino acid sequence of the desired polypeptide, and preferably selecting those codons that are favored in the host cell in which the recombinant polypeptide will be produced. For example, several small oligonucleotides coding for portions of the desired polypeptide may be synthesized and assembled by PCR, ligation or ligation chain reaction. See, e.g., Barany, et al, Proc. Natl. Acad. Sci. 88: 189-193 (1991); U.S. Patent 6,521 ,427 which are incorporated by reference herein.
[00261] This invention utilizes routine techniques in the field of recombinant genetics. Basic texts disclosing the general methods of use in this invention include Sambrook et ah, Molecular Cloning, A Laboratory Manual (3rd ed. 2001); Kriegler, Gene Transfer and Expression: A Laboratory Manual (1990); and Current Protocols in Molecular Biology (Ausubel et al, eds., 1994)).
[00262] General texts which describe molecular biological techniques include Berger and Kimmel, Guide to Molecular Cloning Techniques, Methods in Enzymology volume 152 Academic Press, Inc., San Diego, CA (Berger); Sambrook et al., Molecular Cloning - A Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 1989 ("Sambrook") and Current Protocols in Molecular Biology, F.M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (supplemented through 1999) ("Ausubel")). These texts describe mutagenesis, the use of vectors, promoters and many other relevant topics related to, including but not limited to, the generation of genes that include selector codons for production of proteins that include unnatural amino acids, orthogonal tRNAs, orthogonal synthetases, and pairs thereof.
[00263] Various types of mutagenesis are used in the invention for a variety of purposes, including but not limited to, to produce libraries of tRNAs, to produce libraries of synthetases, to produce selector codons, to insert selector codons that encode unnatural amino acids in a protein or polypeptide of interest. They include but are not limited to site-directed, random point mutagenesis, homologous recombination, DNA shuffling or other recursive , mutagenesis methods, chimeric construction, mutagenesis using uracil containing templates, oligonucleotide-directed mutagenesis, phosphorothioate-modified DNA mutagenesis, mutagenesis using gapped duplex DNA or the like, or any combination thereof. Additional suitable methods include point mismatch repair, mutagenesis using repair-deficient host strains, restriction-selection and restriction-purification, deletion mutagenesis, mutagenesis by total gene synthesis, double-strand break repair, and the like. Mutagenesis, including but not limited to, involving chimeric constructs, are also included in the present invention. In one embodiment, mutagenesis can be guided by known information of the naturally occurring molecule or altered or mutated naturally occurring molecule, including but not limited to, sequence, sequence comparisons, physical properties, secondary, tertiary, or quaternary structure, crystal structure or the like.
[00264] The texts and examples found herein describe these procedures. Additional information is found in the following publications and references cited within: Ling et al., Approaches to DNA mutagenesis: an overview, Anal Biochem. 254(2): 157-178 (1997); Dale et al., Oligonucleotide-directed random mutagenesis using the phosphorothioate method, Methods Mol. Biol. 57:369-374 (1996); Smith, In vitro mutagenesis, Ann. Rev. Genet. 19:423-462 (1985); Botstein & Shortle, Strategies and applications of in vitro mutagenesis, Science 229: 1 193-1201 (1985); Carter, Site-directed mutagenesis, Biochem. J. 237: 1 -7 (1986); Kunkel, The efficiency of oligonucleotide directed mutagenesis, in Nucleic Acids & Molecular Biology (Eckstein, F. and Lilley, D.M.J, eds., Springer Verlag, Berlin) (1987); Kunkel, Rapid and efficient site-specific mutagenesis without phenotypic selection, Proc. Natl. Acad. Sci. USA 82:488-492 (1985); Kunkel et al., Rapid and efficient site-specific mutagenesis without phenotypic selection, Methods in Enzymol. 154, 367-382 (1987); Bass et al., Mutant Trp repressors with new DNA-binding specificities, Science 242:240-245 (1988); Methods in Enzymol. 100: 468-500 (1983); Methods in Enzymol. 154: 329-350 (1987); Zoller & Smith, Oligonucleotide-directed mutagenesis using MI3-derived vectors: an efficient and general procedure for the production of point mutations in any DNA fragment, Nucleic Acids Res. 10:6487-6500 (1982); Zoller & Smith, Oligonucleotide-directed mutagenesis of DNA fragments cloned into Ml 3 vectors, Methods in Enzymol. 100:468-500 (1983); Zoller & Smith, Oligonucleotide-directed mutagenesis: a simple method using two oligonucleotide primers and a single-stranded DNA template, Methods in Enzymol. 154:329- 350 (1987); Taylor et al., The use of phosphorothioate-modified DNA in restriction enzyme reactions to prepare nicked DNA, Nucl. Acids Res. 13 : 8749-8764 (1985); Taylor et al., The rapid generation of oligonucleotide-directed mutations at high frequency using phosphorothioate-modified DNA, Nucl. Acids Res. 13: 8765-8787 (1985); Nakamaye & Eckstein, Inhibition of restriction endonuclease Nci I cleavage by phosphorothioate groups and its application to oligonucleotide-directed mutagenesis, Nucl. Acids Res. 14: 9679-9698 (1986); Sayers et al., 5 '-3 ' Exonucleases in phosphorothioate-based oligonucleotide-directed mutagenesis, Nucl. Acids Res. 16:791 -802 (1988); Sayers et al., Strand specific cleavage of phosphorothioate-containing DNA by reaction with restriction endonucleases in the presence of ethidium bromide, (1988) Nucl. Acids Res. 16: 803-814; Kramer et al., The gapped duplex DNA approach to oligonucleotide-directed mutation construction, Nucl. Acids Res. 12: 9441-9456 (1984); Kramer & Fritz Oligonucleotide-directed construction of mutations via gapped duplex DNA, Methods in Enzymol. 154:350-367 (1987); Kramer et al., Improved
enzymatic in vitro reactions in the gapped duplex DNA approach to oligonucleotide-directed construction of mutations, Nucl. Acids Res. 16: 7207 (1988); Fritz et al., Oligonucleotide- directed construction of mutations: a gapped duplex DNA procedure without enzymatic reactions in vitro, Nucl. Acids Res. 16: 6987-6999 (1988); Kramer et al., Different base/base mismatches are corrected with different efficiencies by the methyl-directed DNA mismatch- repair system of E. coli, Cell 38:879-887 (1984); Carter et al., Improved oligonucleotide site- directed mutagenesis using Ml 3 vectors, Nucl. Acids Res. 13: 4431-4443 (1985); Carter, Improved oligonucleotide-directed mutagenesis using MI 3 vectors, Methods in Enzvmol. 154: 382-403 (1987); Eghtedarzadeh & Henikoff, Use of oligonucleotides to generate large deletions, Nucl. Acids Res. 14: 51 15 (1986); Wells et al., Importance of hydrogen-bond formation in stabilizing the transition state of subtilisin, Phil. Trans. R. Soc. Lond. A 317: 415-423 (1986); Nambiar et al., Total synthesis and cloning of a gene coding for the ribonuclease S protein, Science 223: 1299-1301 (1984); Sakmar and Khorana, Total synthesis and expression of a gene for the alpha-subunit of bovine rod outer segment guanine nucleotide-binding protein (transducin), Nucl. Acids Res. 14: 6361-6372 (1988); Wells et al., Cassette mutagenesis: an efficient method for generation of multiple mutations at defined sites, Gene 34:315-323 (1985); Grundstrom et al., Oligonucleotide-directed mutagenesis by microscale 'shot-gun' gene synthesis, Nucl. Acids Res. 13: 3305-3316 (1985); Mandecki, Oligonucleotide-directed double-strand break repair in plasmids of Escherichia coli: a method for site-specific mutagenesis, Proc. Natl. Acad. Sci. USA, 83 :7177-7181 (1986); Arnold, Protein engineering for unusual environments, Current Opinion in Biotechnology 4:450-455 (1993); Sieber, et al., Nature Biotechnology, 19:456-460 (2001); W. P. C. Stemmer, Nature 370, 389-91 (1994); and, I. A. Lorimer, I. Pastan, Nucleic Acids Res. 23, 3067-8 (1995). Additional details on many of the above methods can be found in Methods in Enzvmology Volume 154, which also describes useful controls for trouble-shooting problems with various mutagenesis methods.
[00265] The invention also relates to eukaryotic host cells, non-eukaryotic host cells, and organisms for the in vivo incorporation of an unnatural amino acid via orthogonal tRNA/RS pairs. Host cells are genetically engineered (including but not limited to, transformed, transduced or transfected) with the polynucleotides of the invention or constructs which include a polynucleotide of the invention, including but not limited to, a vector of the invention, which can be, for example, a cloning vector or an expression vector. The vector can be, for example, in the form of a plasmid, a bacterium, a virus, a naked
polynucleotide, or a conjugated polynucleotide. The vectors are introduced into cells and/or microorganisms by standard methods including electroporation (From et al., Proc. Natl. Acad. Sci. USA 82, 5824 (1985), infection by viral vectors, high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface (Klein et al., Nature 327. 70-73 (1987)).
[00266] The engineered host cells can be cultured in conventional nutrient media modified as appropriate for such activities as, for example, screening steps, activating promoters or selecting transformants. These cells can optionally be cultured into transgenic organisms. Other useful references, including but not limited to for cell isolation and culture (e.g., for subsequent nucleic acid isolation) include Freshney (1994) Culture of Animal Cells, a Manual of Basic Technique, third edition, Wiley- Liss, New York and the references cited therein; Payne et al. (1992) Plant Cell and Tissue Culture in Liquid Systems John Wiley & Sons, Inc. New York, NY; Gamborg and Phillips (eds.) (1995) Plant Cell, Tissue and Organ Culture; Fundamental Methods Springer Lab Manual, Springer- Verlag (Berlin Heidelberg New York) and Atlas and Parks (eds.) The Handbook of Microbiological Media (1993) CRC Press, Boca Raton, FL.
[00267] Several well-known methods of introducing target nucleic acids into cells are available, any of which can be used in the invention. These include: fusion of the recipient cells with bacterial protoplasts containing the DNA, electroporation, projectile bombardment, and infection with viral vectors (discussed further, below), etc. Bacterial cells can be used to amplify the number of plasmids containing DNA constructs of this invention. The bacteria are grown to log phase and the plasmids within the bacteria can be isolated by a variety of methods known in the art {see, for instance, Sambrook). In addition, a plethora of kits are commercially available for the purification of plasmids from bacteria, (see, e.g., EasyPrep™, FlexiPrep™, both from Pharmacia Biotech; StrataClean™ from Stratagene; and, QIAprep™ from Qiagen). The isolated and purified plasmids are then further manipulated to produce other plasmids, used to transfect cells or incorporated into related vectors to infect organisms. Typical vectors contain transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular target nucleic acid. The vectors optionally comprise generic expression cassettes containing at least one independent terminator sequence, sequences permitting replication of the cassette in eukaryotes, or prokaryotes, or both, (including but not limited to, shuttle vectors) and selection markers for both prokaryotic and eukaryotic systems. Vectors are suitable for
replication and integration in prokaryotes, eukaryotes, or preferably both. See, Giliman & Smith, Gene 8:81 (1979); Roberts, et al, Nature, 328:731 (1987); Schneider, B., et al , Protein Expr. Purif. 6435: 10 (1995); Ausubel, Sambrook, Berger (all supra). A catalogue of bacteria and bacteriophages useful for cloning is provided, e.g., by the ATCC, e.g., The ATCC Catalogue of Bacteria and Bacteriophage (1992) Gherna et al (eds) published by the ATCC. Additional basic procedures for sequencing, cloning and other aspects of molecular biology and underlying theoretical considerations are also found in Watson et al. (1992) Recombinant DNA Second Edition Scientific American Books, NY. In addition, essentially any nucleic acid (and virtually any labeled nucleic acid, whether standard or non-standard) can be custom or standard ordered from any of a variety of commercial sources, such as the Midland Certified Reagent Company (Midland, TX available on the World Wide Web at mcrc.com), The Great American Gene Company (Ramona, CA available on the World Wide Web at genco.com), ExpressGen Inc. (Chicago, IL available on the World Wide Web at expressgen.com), Operon Technologies Inc. (Alameda, CA) and many others.
SELECTOR CODONS
[00268] Selector codons of the invention expand the genetic codon framework of protein biosynthetic machinery. For example, a selector codon includes, but is not limited to, a unique three base codon, a nonsense codon, such as a stop codon, including but not limited to, an amber codon (UAG), or an opal codon (UGA), an unnatural codon, a four or more base codon, a rare codon, or the like. It is readily apparent to those of ordinary skill in the art that there is a wide range in the number of selector codons that can be introduced into a desired gene, including but not limited to, one or more, two or more, more than three, 4, 5, 6, 7, 8, 9, 10 or more in a single polynucleotide encoding at least a portion of PSMC.
[00269] In one embodiment, the methods involve the use of a selector codon that is a stop codon for the incorporation of unnatural amino acids in vivo in a eukaryotic cell. For example, an O-tRNA is produced that recognizes the stop codon, including but not limited to, UAG, and is aminoacylated by an O-RS with a desired unnatural amino acid. This O-tRNA is not recognized by the naturally occurring host's aminoacyl-tRNA synthetases. Conventional site-directed mutagenesis can be used to introduce the stop codon, including but not limited to, TAG, at the site of interest in a polypeptide of interest. See, e.g., Sayers, J.R., et al. (1988), 5', 3' Exonuclease in phosphorothioate-based oligonucleotide-directed mutagenesis. Nucleic Acids Res. 791-802. When the O-RS, O-tRNA and the nucleic acid that encodes the polypeptide of interest are combined in vivo, the unnatural amino acid is
incorporated in response to the UAG codon to give a polypeptide containing the unnatural amino acid at the specified position.
[00270] The incorporation of unnatural amino acids in vivo can be done without significant perturbation of the eukaryotic host cell. For example, because the suppression efficiency for the UAG codon depends upon the competition between the O-tRNA, including but not limited to, the amber suppressor tR A, and a eukaryotic release factor (including but not limited to, eRF) (which binds to a stop codon and initiates release of the growing peptide from the ribosome), the suppression efficiency can be modulated by, including but not limited to, increasing the expression level of O-tRNA, and/or the suppressor tRNA.
[00271] Selector codons also comprise extended codons, including but not limited to, four or more base codons, such as, four, five, six or more base codons. Examples of four base codons include, including but not limited to, AGGA, CUAG, UAGA, CCCU and the like. Examples of five base codons include, but are not limited to, AGGAC, CCCCU, CCCUC, CUAGA, CUACU, UAGGC and the like. A feature of the invention includes using extended codons based on frameshift suppression. Four or more base codons can insert, including but not limited to, one or multiple unnatural amino acids into the same protein. For example, in the presence of mutated O-tRNAs, including but not limited to, a special frameshift suppressor tRNAs, with anticodon loops, for example, with at least 8-10 nt anticodon loops, the four or more base codon is read as single amino acid. In other embodiments, the anticodon loops can decode, including but not limited to, at least a four- base codon, at least a five-base codon, or at least a six-base codon or more. Since there are 256 possible four-base codons, multiple unnatural amino acids can be encoded in the same cell using a four or more base codon. See, Anderson et al., (2002) Exploring the Limits of Codon and Anticodon Size, Chemistry and Biology, 9:237-244; Magliery, (2001) Expanding the Genetic Code: Selection of Efficient Suppressors of Four-base Codons and Identification of "Shifty " Four-base Codons with a Library Approach in Escherichia coli, J. Mol. Biol. 307: 755-769.
[00272] For example, four-base codons have been used to incorporate unnatural amino acids into proteins using in vitro biosynthetic methods. See, e.g., Ma et al., (1993) Biochemistry. 32:7939; and Hohsaka et al., (1999) J. Am. Chem. Soc, 121 :34. CGGG and AGGU were used to simultaneously incorporate 2-naphthylalanine and an NBD derivative of lysine into streptavidin in vitro with two chemically acylated frameshift suppressor tRNAs. See, e.g., Hohsaka et al., (1999) J. Am. Chem. Soc, 121 : 12194. In an in vivo study, Moore
et al. examined the ability of tRNALeu derivatives with NCUA anticodons to suppress UAGN codons (N can be U, A, G, or C), and found that the quadruplet UAGA can be decoded by a tRNALeu with a UCUA anticodon with an efficiency of 13 to 26% with little decoding in the 0 or -1 frame. See, Moore et al., (2000) J. Mol. Biol., 298: 195. In one embodiment, extended codons based on rare codons or nonsense codons can be used in the present invention, which can reduce missense readthrough and frameshift suppression at other unwanted sites.
[00273] For a given system, a selector codon can also include one of the natural three base codons, where the endogenous system does not use (or rarely uses) the natural base codon. For example, this includes a system that is lacking a tRNA that recognizes the natural three base codon, and/or a system where the three base codon is a rare codon.
[00274] Selector codons optionally include unnatural base pairs. These unnatural base pairs further expand the existing genetic alphabet. One extra base pair increases the number of triplet codons from 64 to 125. Properties of third base pairs include stable and selective base pairing, efficient enzymatic incorporation into DNA with high fidelity by a polymerase, and the efficient continued primer extension after synthesis of the nascent unnatural base pair. Descriptions of unnatural base pairs which can be adapted for methods and compositions include, e.g., Hirao, et al., (2002) An unnatural base pair for incorporating amino acid analogues into protein, Nature Biotechnology, 20: 177-182. Other relevant publications are listed below.
[00275] For in vivo usage, the unnatural nucleoside is membrane permeable and is phosphorylated to form the corresponding triphosphate. In addition, the increased genetic information is stable and not destroyed by cellular enzymes. Previous efforts by Benner and others took advantage of hydrogen bonding patterns that are different from those in canonical Watson-Crick pairs, the most noteworthy example of which is the iso-C:iso-G pair. See, e.g., Switzer et al., (1989) J. Am. Chem. Soc, 1 1 1 :8322; and Piccirilli et al., (1990) Nature, 343:33; Kool, (2000) Curr. Opin. Chem. Biol., 4:602. These bases in general mispair to some degree with natural bases and cannot be enzymatically replicated. Kool and co-workers demonstrated that hydrophobic packing interactions between bases can replace hydrogen bonding to drive the formation of base pair. See, Kool, (2000) Curr. Opin. Chem. Biol, 4:602; and Guckian and Kool, (1998) Angew. Chem. Int. Ed. Engl.. 36, 2825. In an effort to develop an unnatural base pair satisfying all the above requirements, Schultz, Romesberg and co-workers have systematically synthesized and studied a series of unnatural hydrophobic
bases. A PICS:PICS self-pair is found to be more stable than natural base pairs, and can be efficiently incorporated into DNA by Klenow fragment of Escherichia coli DNA polymerase I ( F). See, e.g., McMinn et al., (1999) J. Am. Chem. Soc. 121 : 1 1586; and Ogawa et al., (2000) J. Am. Chem. Soc. 122:3274. A 3MN:3MN self-pair can be synthesized by KF with efficiency and selectivity sufficient for biological function. See, e.g., Ogawa et al., (2000) L Am. Chem. Soc, 122:8803. However, both bases act as a chain terminator for further replication. A mutant DNA polymerase has been recently evolved that can be used to replicate the PICS self pair. In addition, a 7AI self pair can be replicated. See, e.g., Tae et al., (2001) J. Am. Chem. Soc , 123:7439. A novel metallobase pair, DipicPy, has also been developed, which forms a stable pair upon binding Cu(II). See, Meggers et al., (2000) J. Am. Chem. Soc. 122: 10714. Because extended codons and unnatural codons are intrinsically orthogonal to natural codons, the methods of the invention can take advantage of this property to generate orthogonal tRNAs for them.
[00276] A translational bypassing system can also be used to incorporate an unnatural amino acid in a desired polypeptide. In a translational bypassing system, a large sequence is incorporated into a gene but is not translated into protein. The sequence contains a structure that serves as a cue to induce the ribosome to hop over the sequence and resume translation downstream of the insertion.
[00277] In certain embodiments, the protein or polypeptide of interest (or portion thereof) in the methods and/or compositions of the invention is encoded by a nucleic acid. Typically, the nucleic acid comprises at least one selector codon, at least two selector codons, at least three selector codons, at least four selector codons, at least five selector codons, at least six selector codons, at least seven selector codons, at least eight selector codons, at least nine selector codons, ten or more selector codons.
[00278] Genes coding for proteins or polypeptides of interest can be mutagenized using methods well-known to one of skill in the art and described herein to include, for example, one or more selector codon for the incorporation of an unnatural amino acid. For example, a nucleic acid for a protein of interest is mutagenized to include one or more selector codon, providing for the incorporation of one or more unnatural amino acids. The invention includes any such variant, including but not limited to, mutant, versions of any protein, for example, including at least one unnatural amino acid. Similarly, the invention also includes corresponding nucleic acids, i.e., any nucleic acid with one or more selector codon that encodes one or more unnatural amino acid.
[00279] Nucleic acid molecules encoding a protein of .interest such as PSMC may be readily mutated to introduce a cysteine at any desired position of the polypeptide. Cysteine is widely used to introduce reactive molecules, water soluble polymers, proteins, or a wide variety of other molecules, onto a protein of interest. Methods suitable for the incorporation of cysteine into a desired position of the antigen-binding polypeptide are well known in the art, such as those described in U.S. Patent No. 6,608,183, which is incorporated by reference herein, and standard mutagenesis techniques.
IV. Non-Naturally Encoded Amino Acids
[00280] A very wide variety of non-naturally encoded amino acids are suitable for use in the present invention. Any number of non-naturally encoded amino acids can be introduced into PSMC. In general, the introduced non-naturally encoded amino acids are substantially chemically inert toward the 20 common, genetically-encoded amino acids (i.e., alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine). In some embodiments, the non-naturally encoded amino acids include side chain functional groups that react efficiently and selectively with functional groups not found in the 20 common amino acids (including but not limited to, azido, ketone, aldehyde and aminooxy groups) to form stable conjugates. For example, antigen-binding polypeptide that includes a non-naturally encoded amino acid containing an azido functional group can be reacted with a polymer (including but not limited to, poly(ethylene glycol) or, alternatively, a second polypeptide containing an alkyne moiety to form a stable conjugate resulting for the selective reaction of the azide and the alkyne functional groups to form a Huisgen [3+2] cycloaddition product.
[00281] The generic structure of an alpha-amino acid is illustrated as follows (Formula I):
[00282] A non-naturally encoded amino acid is typically any structure having the above-listed formula wherein the R group is any substituent other than one used in the twenty natural amino acids, and may be suitable for use in the present invention. Because the non- naturally encoded amino acids of the invention typically differ from the natural amino acids
only in the structure of the side chain, the non-naturally encoded amino acids form amide bonds with other amino acids, including but not limited to, natural or non-naturally encoded, in the same manner in which they are formed in naturally occurring polypeptides. However, the non-naturally encoded amino acids have side chain groups that distinguish them from the natural amino acids. For example, R optionally comprises an alkyl-, aryl-, acyl-, keto-, azido- , hydroxyl-, hydrazine, cyano-, halo-, hydrazide, alkenyl, alkynl, ether, thiol, seleno-, sulfonyl-, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, ester, thioacid, hydroxylamine, amino group, or the like or any combination thereof. Other non-naturally occurring amino acids of interest that may be suitable for use in the present invention include, but are not limited to, amino acids comprising a photoactivatable cross-linker, spin-labeled amino acids, fluorescent amino acids, metal binding amino acids, metal-containing amino acids, radioactive amino acids, amino acids with novel functional groups, amino acids that covalently or noncovalently interact with other molecules, photocaged and/or photoisomerizable amino acids, amino acids comprising biotin or a biotin analogue, glycosylated amino acids such as a sugar substituted serine, other carbohydrate modified amino acids, keto-containing amino acids, amino acids comprising polyethylene glycol or polyether, heavy atom substituted amino acids, chemically cleavable and/or photocleavable amino acids, amino acids with an elongated side chains as compared to natural amino acids, including but not limited to, polyethers or long chain hydrocarbons, including but not limited to, greater than about 5 or greater than about 10 carbons, carbon- linked sugar-containing amino acids, redox-active amino acids, amino thioacid containing amino acids, and amino acids comprising one or more toxic moiety.
[00283] Exemplary non-naturally encoded amino acids that may be suitable for use in the present invention and that are useful for reactions with water soluble polymers include, but are not limited to, those with carbonyl, aminooxy, hydrazine, hydrazide, semicarbazide, azide and alkyne reactive groups. In some embodiments, non-naturally encoded amino acids comprise a saccharide moiety. Examples of such amino acids include N-acetyl-L- glucosaminyl-L-serine, N-acetyl-L-galactosaminyl-L-serine, N-acetyl-L-glucosaminyl-L- threonine, N-acetyl-L-glucosaminyl-L-asparagine and O-mannosaminyl-L-serine. Examples of such amino acids also include examples where the naturally-occuring N- or O- linkage between the amino acid and the saccharide is replaced by a covalent linkage not commonly found in nature - including but not limited to, an alkene, an oxime, a thioether, an amide and
the like. Examples of such amino acids also include saccharides that are not commonly found in naturally-occuring proteins such as 2-deoxy-glucose, 2-deoxygalactose and the like.
[00284] Many of the non-naturally encoded amino acids provided herein are commercially available, e.g., from Sigma-Aldrich (St. Louis, MO, USA), Novabiochem (a division of EMD Biosciences, Darmstadt, Germany), or Peptech (Burlington, MA, USA). Those that are not commercially available are optionally synthesized as provided herein or using standard methods known to those of skill in the art. For organic synthesis techniques, see, e.g., Organic Chemistry by Fessendon and Fessendon, (1982, Second Edition, Willard Grant Press, Boston Mass.); Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York); and Advanced Organic Chemistry by Carey and Sundberg (Third Edition, Parts A and B, 1990, Plenum Press, New York). See, also, U.S. Patent Application Publications 2003/0082575 and 2003/0108885, which is incorporated by reference herein. In addition to unnatural amino acids that contain novel side chains, unnatural amino acids that may be suitable for use in the present invention also optionally comprise modified backbone structures, including but not limited to, as illustrated by the structures of Formula II and III:
III
wherein Z typically comprises OH, NH2, SH, NH-R', or S-R'; X and Y, which can be the same or different, typically comprise S or O, and R and R, which are optionally the same or different, are typically selected from the same list of constituents for the R group described above for the unnatural amino acids having Formula I as well as hydrogen. For example, unnatural amino acids of the invention optionally comprise substitutions in the amino or carboxyl group as illustrated by Formulas II and III. Unnatural amino acids of this type include, but are not limited to, a-hydroxy acids, a-thioacids, a-aminothiocarboxylates, including but not limited to, with side chains corresponding to the common twenty natural
amino acids or unnatural side chains. In addition, substitutions at the a-carbon optionally include, but are not limited to, L, D, or α-α-disubstituted amino acids such as D-glutamate, D-alanine, D-methyl-O-tyrosine, aminobutyric acid, and the like. Other structural alternatives include cyclic amino acids, such as proline analogues as well as 3, 4 , 6, 7, 8, and 9 membered ring proline analogues, β and γ amino acids such as substituted β-alanine and γ- amino butyric acid.
[00285] Many unnatural amino acids are based on natural amino acids, such as tyrosine, glutamine, phenylalanine, and the like, and are suitable for use in the present invention. Tyrosine analogs include, but are not limited to, para-substituted tyrosines, ortho- substituted tyrosines, and meta substituted tyrosines, where the substituted tyrosine comprises, including but not limited to, a keto group (including but not limited to, an acetyl group), a benzoyl group, an amino group, a hydrazine, an hydroxyamine, a thiol group, a carboxy group, an isopropyl group, a methyl group, a C6 - C20 straight chain or branched hydrocarbon, a saturated or unsaturated hydrocarbon, an O-methyl group, a polyether group, a nitro group, an alkynyl group or the like. In addition, multiply substituted aryl rings are also contemplated. Glutamine analogs that may be suitable for use in the present invention include, but are not limited to, a-hydroxy derivatives, γ-substituted derivatives, cyclic derivatives, and amide substituted glutamine derivatives. Example phenylalanine analogs that may be suitable for use in the present invention include, but are not limited to, para- substituted phenylalanines, ortho-substituted phenyalanines, and meta-substituted phenylalanines, where the substituent comprises, including but not limited to, a hydroxy group, a methoxy group, a methyl group, an allyl group, an aldehyde, an azido, an iodo, a bromo, a keto group (including but not limited to, an acetyl group), a benzoyl, an alkynyl group, or the like. Specific examples of unnatural amino acids that may be suitable for use in the present invention include, but are not limited to, a 7-acetyl-L- phenylalanine, an O- methyl-L-tyrosine, an L-3-(2-naphthyl)alanine, a 3-methyl-phenylalanine, an O-4-allyl-L- tyrosine, a 4-propyl-L-tyrosine, a tri-O-acetyl-GlcNAcP-serine, an L-Dopa, a fluorinated phenylalanine, an isopropyl-L-phenylalanine, a -azido-L-phenylalanine, a -acyl-L- phenylalanine, a p-benzoyl-L-phenylalanine, an L-phosphoserine, a phosphonoserine, a phosphonotyrosine, a /?-iodo-phenylalanine, a -bromophenylalanine, a /?-amino-L- phenylalanine, an isopropyl-L-phenylalanine, and a p-propargyloxy-phenylalanine, and the like. Examples of structures of a variety of unnatural amino acids that may be suitable for use in the present invention are provided in, for example, WO 2002/085923 entitled "In vivo
incorporation of unnatural amino acids." See also Kiick et al., (2002) Incorporation of azides into recombinant proteins for chemoselective modification by the Staudinger ligation, PNAS 99: 19-24, for additional methionine analogs.
[00286] In one embodiment, compositions of PSMC that include an unnatural amino acid (such as /?-(propargyloxy)-phenyalanine) are provided. Various compositions comprising /?-(propargyloxy)-phenyalanine and, including but not limited to, proteins and/or cells, are also provided. In one aspect, a composition that includes the /?-(propargyloxy)- phenyalanine unnatural amino acid, further includes an orthogonal tRNA. The unnatural amino acid can be bonded (including but not limited to, covalently) to the orthogonal tRNA, including but not limited to, covalently bonded to the orthogonal tRNA though an amino-acyl bond, covalently bonded to a 3ΌΗ or a 2ΌΗ of a terminal ribose sugar of the orthogonal tRNA, etc.
[00287] The chemical moieties via unnatural amino acids that can be incorporated into proteins offer a variety of advantages and manipulations of the protein. For example, the unique reactivity of a keto functional group allows selective modification of proteins with any of a number of hydrazine- or hydroxylamine-containing reagents in vitro and in vivo. A heavy atom unnatural amino acid, for example, can be useful for phasing X-ray structure data. The site-specific introduction of heavy atoms using unnatural amino acids also provides selectivity and flexibility in choosing positions for heavy atoms. Photoreactive unnatural amino acids (including but not limited to, amino acids with benzophenone and arylazides (including but not limited to, phenylazide) side chains), for example, allow for efficient in vivo and in vitro photocrosslinking of protein. Examples of photoreactive unnatural amino acids include, but are not limited to, p-azido-phenylalanine and p-benzoyl-phenylalanine. The protein with the photoreactive unnatural amino acids can then be crosslinked at will by excitation of the photoreactive group-providing temporal control. In one example, the methyl group of an unnatural amino can be substituted with an isotopically labeled, including but not limited to, methyl group, as a probe of local structure and dynamics, including but not limited to, with the use of nuclear magnetic resonance and vibrational spectroscopy. Alkynyl or azido functional groups, for example, allow the selective modification of proteins with molecules through a [3+2] cycloaddition reaction.
[00288] A non-natural amino acid incorporated into a polypeptide at the amino terminus can be composed of an R group that is any substituent other than one used in the twenty natural amino acids and a 2nd reactive group different from the NH2 group normally
present in a-amino acids (see Formula I). A similar non-natural amino acid can be incorporated at the carboxyl terminus with a 2nd reactive group different from the COOH group normally present in a-amino acids (see Formula I).
CHEMICAL SYNTHESIS OF UNNATURAL AMINO ACIDS
[00289] Many of the unnatural amino acids suitable for use in the present invention are commercially available, e.g., from Sigma (USA) or Aldrich (Milwaukee, WI, USA). Those that are not commercially available are optionally synthesized as provided herein or as provided in various publications or using standard methods known to those of skill in the art. For organic synthesis techniques, see, e.g., Organic Chemistry by Fessendon and Fessendon, (1982, Second Edition, Willard Grant Press, Boston Mass.); Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York); and Advanced Organic Chemistry by Carey and Sundberg (Third Edition, Parts A and B, 1990, Plenum Press, New York). Additional publications describing the synthesis of unnatural amino acids include, e.g., WO 2002/085923 entitled "In vivo incorporation of Unnatural Amino Acids;" Matsoukas et al., (1995) J. Med. Chem., 38, 4660-4669; King, F.E. & Kidd, D.A.A. (1949) A New Synthesis of Glutamine and of γ-Dipeptides of Glutamic Acid from Phthylated Intermediates. J. Chem. Soc. 3315-3319; Friedman, O.M. & Chatterrji, R. (1959) Synthesis of Derivatives of Glutamine as Model Substrates for Anti-Tumor Agents. J. Am. Chem. Soc. 81 , 3750-3752; Craig, J.C. et al. (1988) Absolute Configuration of the Enantiomers of 7-Chloro-4 [[4- (diethylamino)-l-methylbutyl] amino] quinoline (Chloroquine) . J. Org. Chem. 53, 1 167-1 170; Azoulay, M., Vilmont, M. & Frappier, F. (1991) Glutamine analogues as Potential Antimalarials,. Eur. J. Med. Chem. 26, 201-5; Koskinen, A.M.P. & Rapoport, H. (1989) Synthesis of 4-Substituted Prolines as
Constrained Amino Acid Analogues. J. Org. Chem. 54, 1859-1866; Christie, B.D. & Rapoport, H. (1985) Synthesis of Optically Pure Pipecolates from L-Asparagine. Application to the Total Synthesis of (+)- Apovincamine through Amino Acid Decarbonylation and Iminium Ion Cyclization. J. Org. Chem. 1989: 1859-1866; Barton et al., (1987) Synthesis of Novel a-Amino-Acids and Derivatives Using Radical Chemistry: Synthesis of L- and D-a-Amino-Adipic Acids, L-a- aminopimelic Acid and Appropriate Unsaturated Derivatives. Tetrahedron Lett. 43:4297- 4308; and, Subasinghe et al., (1992) Quisqualic acid analogues: synthesis of beta- heterocyclic 2-aminopropanoic acid derivatives and their activity at a novel quisqualate- sensitized site. J. Med. Chem. 35:4602-7. See also, patent applications entitled "Protein
Arrays," filed December 22, 2003, serial number 10/744,899 and serial number 60/435,821 filed on December 22, 2002.
A. Carbonyl reactive groups
[00290] Amino acids with a carbonyl reactive group allow for a variety of reactions to link molecules (including but not limited to, PEG or other water soluble molecules) via nucleophilic addition or aldol condensation reactions among others.
wherein n is 0-10; R\ is an alkyl, aryl, substituted alkyl, or substituted aryl; R2 is H, alkyl, aryl, substituted alkyl, and substituted aryl; and R3 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R4 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1, R\ is phenyl and R2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the para position relative to the alkyl side chain. In some embodiments, n is 1 , Ri is phenyl and R2 is a simple alkyl (i.e., methyl, ethyl, or propyl) and the ketone moiety is positioned in the meta position relative to the alkyl side chain.
[00292] The synthesis of ?-acetyl-(+/-)-phenylalanine and w-acetyl-(+/-)- phenylalanine is described in Zhang, Z., et al., Biochemistry 42: 6735-6746 (2003), which is incorporated by reference herein. Other carbonyl-containing amino acids can be similarly prepared by one skilled in the art.
[00293] In some embodiments, a polypeptide comprising a non-naturally encoded amino acid is chemically modified to generate a reactive carbonyl functional group. For instance, an aldehyde functionality useful for conjugation reactions can be generated from a functionality having adjacent amino and hydroxyl groups. Where the biologically active molecule is a polypeptide, for example, an N-terminal serine or threonine (which may be normally present or may be exposed via chemical or enzymatic digestion) can be used to generate an aldehyde functionality under mild oxidative cleavage conditions using periodate. See, e.g., Gaertner, et al, Bioconjug. Chem. 3 : 262-268 (1992); Geoghegan, K. & Stroh, J., Bioconjug. Chem. 3: 138-146 (1992); Gaertner et al, J. Biol Chem. 269:7224-7230 (1994). However, methods known in the art are restricted to the amino acid at the N-terminus of the peptide or protein.
[00294] In the present invention, a non-naturally encoded amino acid bearing adjacent hydroxyl and amino groups can be incorporated into the polypeptide as a "masked" aldehyde functionality. For example, 5-hydroxylysine bears a hydroxyl group adjacent to the epsilon amine. Reaction conditions for generating the aldehyde typically involve addition of molar excess of sodium metaperiodate under mild conditions to avoid oxidation at other sites within the polypeptide. The pH of the oxidation reaction is typically about 7.0. A typical reaction involves the addition of about 1.5 molar excess of sodium meta periodate to a buffered solution of the polypeptide, followed by incubation for about 10 minutes in the dark. See, e.g. U.S. Patent No. 6,423,685, which is incorporated by reference herein.
[00295] The carbonyl functionality can be reacted selectively with a hydrazine-, hydrazide-, hydroxylamine-, or semicarbazide-containing reagent under mild conditions in aqueous solution to form the corresponding hydrazone, oxime, or semicarbazone linkages, respectively, that are stable under physiological conditions. See, e.g., Jencks, W. P., J. Am. Chem. Soc. 81 , 475-481 (1959); Shao, J. and Tarn, J. P., J. Am. Chem. Soc. 1 17:3893-3899 (1995). Moreover, the unique reactivity of the carbonyl group allows for selective modification in the presence of the other amino acid side chains. See, e.g. , Cornish, V. W., et al, J. Am. Chem. Soc. 1 18:8150-8151 (1996); Geoghegan, K. F. & Stroh, J. G., Bioconjug. Chem. 3: 138-146 (1992); Mahal, L. K., et al , Science 276: 1 125-1 128 (1997).
B. Hydrazine, hydrazide or semicarbazide reactive groups
[00296] Non-naturally encoded amino acids containing a nucleophilic group, such as a hydrazine, hydrazide or semicarbazide, allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers).
[00297] Exemplary hydrazine, hydrazide or semicarbazide -containing amino acids can be represented as follows:
wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X, is O, N, or S or not present; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
[00298] In some embodiments, n is 4, Ri is not present, and X is N. In some embodiments, n is 2, R\ is not present, and X is not present. In some embodiments, n is 1 , R\ is phenyl, X is O, and the oxygen atom is positioned para to the alphatic group on the aryl ring.
[00299] Hydrazide-, hydrazine-, and semicarbazide-containing amino acids are available from commercial sources. For instance, L-glutamate-y-hydrazide is available from Sigma Chemical (St. Louis, MO). Other amino acids not available commercially can be prepared by one skilled in the art. See, e.g., U.S. Pat. No. 6,281 ,21 1, which is incorporated by reference herein.
[00300] Polypeptides containing non-naturally encoded amino acids that bear hydrazide, hydrazine or semicarbazide functionalities can be reacted efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 1 17:3893-3899 (1995). The unique reactivity of hydrazide, hydrazine and semicarbazide functional groups makes them significantly more reactive toward aldehydes, ketones and other electrophilic groups as compared to the nucleophilic groups present on the 20 common amino acids (including but not limited to, the hydroxyl group of serine or threonine or the amino groups of lysine and the N-terminus).
C. Aminooxy-containing amino acids
[00301] Non-naturally encoded amino acids containing an aminooxy (also called a hydroxylamine) group allow for reaction with a variety of electrophilic groups to form conjugates (including but not limited to, with PEG or other water soluble polymers). Like hydrazines, hydrazides and semicarbazides, the enhanced nucleophilicity of the aminooxy group permits it to react efficiently and selectively with a variety of molecules that contain aldehydes or other functional groups with similar chemical reactivity. See, e.g., Shao, J. and Tarn, J., J. Am. Chem. Soc. 1 17:3893-3899 (1995); H. Hang and C. Bertozzi, Acc. Chem. Res. 34: 727-736 (2001). Whereas the result of reaction with a hydrazine group is the corresponding hydrazone, however, an oxime results generally from the reaction of an aminooxy group with a carbonyl -containing group such as a ketone.
[00302] Exemplary amino acids containing aminooxy groups can be represented as follows:
wherein n is 0-10; R\ is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X is O, N, S or not present; m is 0-10; Y = C(O) or not present; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1 , Ri is phenyl, X is O, m is 1 , and Y is present. In some embodiments, n is 2, Ri and X are not present, m is 0, and Y is not present.
[00303] Aminooxy-containing amino acids can be prepared from readily available amino acid precursors (homoserine, serine and threonine). See, e.g., M. Carrasco and R. Brown, J. Org. Chem. 68: 8853-8858 (2003). Certain aminooxy-containing amino acids, such as L-2-amino-4-(aminooxy)butyric acid), have been isolated from natural sources (Rosenthal, G. et al., Life Sci. 60: 1635-1641 (1997). Other aminooxy-containing amino acids can be prepared by one skilled in the art.
D. Azide and alkyne reactive groups
[00304] The unique reactivity of azide and alkyne functional groups makes them extremely useful for the selective modification of polypeptides and other biological molecules. Organic azides, particularly alphatic azides, and alkynes are generally stable toward common reactive chemical conditions. In particular, both the azide and the alkyne functional groups are inert toward the side chains (i.e., R groups) of the 20 common amino acids found in naturally-occuring polypeptides. When brought into close proximity, however, the "spring-loaded" nature of the azide and alkyne groups is revealed and they react selectively and efficiently via Huisgen [3+2] cycloaddition reaction to generate the corresponding triazole. See, e.g., Chin J., et al, Science 301 :964-7 (2003); Wang, Q., et al, J. Am. Chem. Soc. 125, 3192-3193 (2003); Chin, J. W., et al, J. Am. Chem. Soc. 124:9026- 9027 (2002).
[00305] Because the Huisgen cycloaddition reaction involves a selective cycloaddition reaction {see, e.g., Padwa, A., in COMPREHENSIVE ORGANIC SYNTHESIS, Vol. 4, (ed. Trost, B. M., 1991), p. 1069-1 109; Huisgen, R. in 1 ,3-DIPOLAR CYCLOADDITION CHEMISTRY, (ed. Padwa, A., 1984) , p. 1-176 ) rather than a nucleophilic substitution, the incorporation of non- naturally encoded amino acids bearing azide and alkyne-containing side chains permits the resultant polypeptides to be modified selectively at the position of the non-naturally encoded amino acid. Cycloaddition reaction involving azide or alkyne-containing PSMC can be carried out at room temperature under aqueous conditions by the addition of Cu(II) (including but not limited to, in the form of a catalytic amount of CuS04) in the presence of a reducing
agent for reducing Cu(II) to Cu(I), in situ, in catalytic amount. See, e.g., Wang, Q., et al , J. Am. Chem. Soc. 125, 3192-3193 (2003); Tornoe, C. W., et al , J. Org. Chem. 67:3057-3064 (2002); Rostovtsev, et al, Angew. Chem. Int. Ed. 41 :2596-2599 (2002). Exemplary reducing agents include, including but not limited to, ascorbate, metallic copper, quinine, hydroquinone, vitamin K, glutathione, cysteine, Fe2+, Co2+, and an applied electric potential.
[00306] In some cases, where a Huisgen [3+2] cycloaddition reaction between an azide and an alkyne is desired, the antigen-binding polypeptide comprises a non-naturally encoded amino acid comprising an alkyne moiety and the water soluble polymer to be attached to the amino acid comprises an azide moiety. Alternatively, the converse reaction (i.e., with the azide moiety on the amino acid and the alkyne moiety present on the water soluble polymer) can also be performed.
[00307] The azide functional group can also be reacted selectively with a water soluble polymer containing an aryl ester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage. The aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with a proximal ester linkage to generate the corresponding amide. See, e.g., E. Saxon and C. Bertozzi, Science 287, 2007-2010 (2000). The azide-containing amino acid can be either an alkyl azide (including but not limited to, 2- amino-6-azido-l -hexanoic acid) or an aryl azide (p-azido-phenylalanine).
[00308] Exemplary water soluble polymers containing an aryl ester and a phosphine moiety can be represented as follows:
wherein X can be O, N, S or not present, Ph is phenyl, W is a water soluble polymer and R can be H, alkyl, aryl, substituted alkyl and substituted aryl groups. Exemplary R groups include but are not limited to -CH2, -C(CH3) 3, -OR', -NR'R", -SR\ -halogen, -C(0)R', - CONR'R", -S(0)2R', -S(0)2NR'R", -CN and -N02. R', R", R"' and R"" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present. When R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring. For example, -NR'R" is meant to include, but not
be limited to, 1 -pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term "alkyl" is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF3 and -CH2CF3) and acyl (including but not limited to, - C(0)CH3, -C(0)CF3, -C(0)CH2OCH3, and the like).
[00309] The azide functional group can also be reacted selectively with a water soluble polymer containing a thioester and appropriately functionalized with an aryl phosphine moiety to generate an amide linkage. The aryl phosphine group reduces the azide in situ and the resulting amine then reacts efficiently with the thioester linkage to generate the corresponding amide. Exemplary water soluble polymers containing a thioester and a phosphine moiety can be represented as follows:
wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, or substituted aryl or not present; X is O, N, S or not present; m is 0-10, R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1 , Rj is phenyl, X is not present, m is 0 and the acetylene moiety is positioned in the para position relative to the alkyl side chain. In some embodiments, n is 1, Rj is phenyl, X is O, m is 1 and the propargyloxy group is positioned in the para position relative to the alkyl side chain (i.e., O-propargyl-tyrosine). In some embodiments, n is 1 , Ri and X are not present and m is 0 (i.e., proparylglycine).
[00311] Alkyne-containing amino acids are commercially available. For example, propargylglycine is commercially available from Peptech (Burlington, MA). Alternatively, alkyne-containing amino acids can be prepared according to standard methods. For instance, -propargyloxyphenylalanine can be synthesized, for example, as described in Deiters, A., et al, J. Am. Chem. Soc. 125: 1 1782-1 1783 (2003), and 4-alkynyl-L-phenylalanine can be synthesized as described in Kayser, B., et al, Tetrahedron 53(7): 2475-2484 (1997). Other alkyne-containing amino acids can be prepared by one skilled in the art.
[00312] Exemplary azide-containing amino acids can be represented as follows:
wherein n is 0-10; Ri is an alkyl, aryl, substituted alkyl, substituted aryl or not present; X is O, N, S or not present; m is 0-10; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group. In some embodiments, n is 1 , Ri is phenyl, X is not present, m is 0 and the azide moiety is positioned para to the alkyl side chain. In some embodiments, n is 0-4 and i and X are not present, and m=0. In some embodiments, n is 1 , Rj is phenyl, X is O, m is 2 and the β-azidoethoxy moiety is positioned in the para position relative to the alkyl side chain.
[00313] Azide-containing amino acids are available from commercial sources. For instance, 4-azidophenylalanine can be obtained from Chem-Impex International, Inc. (Wood Dale, IL). For those azide-containing amino acids that are not commercially available, the azide group can be prepared relatively readily using standard methods known to those of skill in the art, including but not limited to, via displacement of a suitable leaving group (including but not limited to, halide, mesylate, tosylate) or via opening of a suitably protected lactone. See, e.g., Advanced Organic Chemistry by March (Third Edition, 1985, Wiley and Sons, New York).
E. Aminothiol reactive groups
[00314] The unique reactivity of beta-substituted aminothiol functional groups makes them extremely useful for the selective modification of polypeptides and other biological molecules that contain aldehyde groups via formation of the thiazolidine. See, e.g., J. Shao and J. Tarn, J. Am. Chem. Soc. 1995, 1 17 (14) 3893-3899. In some embodiments, beta- substituted aminothiol amino acids can be incorporated into PSMC polypeptides and then reacted with water soluble polymers comprising an aldehyde functionality. In some embodiments, a water soluble polymer, drug conjugate or other payload can be coupled to a PSMC polypeptide comprising a beta- substituted aminothiol amino acid via formation of the thiazolidine.
CELLULAR UPTAKE OF UNNATURAL AMINO ACIDS
[00315] Unnatural amino acid uptake by a eukaryotic cell is one issue that is typically considered when designing and selecting unnatural amino acids, including but not limited to, for incorporation into a protein. For example, the high charge density of -amino acids
suggests that these compounds are unlikely to be cell permeable. Natural amino acids are taken up into the eukaryotic cell via a collection of protein-based transport systems. A rapid screen can be done which assesses which unnatural amino acids, if any, are taken up by cells. See, e.g., the toxicity assays in, e.g., the applications entitled "Protein Arrays," filed December 22, 2003, serial number 10/744,899 and serial number 60/435,821 filed on December 22, 2002; and Liu, D.R. & Schultz, P.G. (1999) Progress toward the evolution of an organism with an expanded genetic code. PNAS United States 96:4780-4785. Although uptake is easily analyzed with various assays, an alternative to designing unnatural amino acids that are amenable to cellular uptake pathways is to provide biosynthetic pathways to create amino acids in vivo.
BIOSYNTHESIS OF UNNATURAL AMINO ACIDS
[00316] Many biosynthetic pathways already exist in cells for the production of amino acids and other compounds. While a biosynthetic method for a particular unnatural amino acid may not exist in nature, including but not limited to, in a eukaryotic cell, the invention provides such methods. For example, biosynthetic pathways for unnatural amino acids are optionally generated in host cell by adding new enzymes or modifying existing host cell pathways. Additional new enzymes are optionally naturally occurring enzymes or artificially evolved enzymes. For example, the biosynthesis of ?-aminophenylalanine (as presented in an example in WO 2002/085923 entitled "In vivo incorporation of unnatural amino acids") relies on the addition of a combination of known enzymes from other organisms. The genes for these enzymes can be introduced into a eukaryotic cell by transforming the cell with a plasmid comprising the genes. The genes, when expressed in the cell, provide an enzymatic pathway to synthesize the desired compound. Examples of the types of enzymes that are optionally added are provided in the examples below. Additional enzymes sequences are found, for example, in Genbank. Artificially evolved enzymes are also optionally added into a cell in the same manner. In this manner, the cellular machinery and resources of a cell are manipulated to produce unnatural amino acids.
[00317] A variety of methods are available for producing novel enzymes for use in biosynthetic pathways or for evolution of existing pathways. For example, recursive recombination, including but not limited to, as developed by Maxygen, Inc. (available on the World Wide Web at maxygen.com), is optionally used to develop novel enzymes and pathways. See, e.g., Stemmer (1994), Rapid evolution of a protein in vitro by DNA shuffling, Nature 370(4): 389-391 ; and, Stemmer, (1994), DNA shuffling by random fragmentation and
reassembly: In vitro recombination for molecular evolution, Proc. Natl. Acad. Sci. USA., 91 : 10747-10751. Similarly DesignPath™, developed by Genencor (available on the World Wide Web at genencor.com) is optionally used for metabolic pathway engineering, including but not limited to, to engineer a pathway to create O-methyl-L-tyrosine in a cell. This technology reconstructs existing pathways in host organisms using a combination of new genes, including but not limited to, identified through functional genomics, and molecular evolution and design. Diversa Corporation (available on the World Wide Web at diversa.com) also provides technology for rapidly screening libraries of genes and gene pathways, including but not limited to, to create new pathways.
[00318] Typically, the unnatural amino acid produced with an engineered biosynthetic pathway of the invention is produced in a concentration sufficient for efficient protein biosynthesis, including but not limited to, a natural cellular amount, but not to such a degree as to affect the concentration of the other amino acids or exhaust cellular resources. Typical concentrations produced in vivo in this manner are about 10 mM to about 0.05 mM. Once a cell is transformed with a plasmid comprising the genes used to produce enzymes desired for a specific pathway and an unnatural amino acid is generated, in vivo selections are optionally used to further optimize the production of the unnatural amino acid for both ribosomal protein synthesis and cell growth.
POLYPEPTIDES WITH UNNATURAL AMINO ACIDS
[00319] The incorporation of an unnatural amino acid can be done for a variety of purposes, including but not limited to, tailoring changes in protein structure and/or function, changing size, acidity, nucleophilicity, hydrogen bonding, hydrophobicity, accessibility of protease target sites, targeting to a moiety (including but not limited to, for a protein array), adding a biologically active molecule, attaching a polymer, attaching a radionuclide, modulating serum half-life, modulating tissue penetration (e.g. tumors), modulating active transport, modulating tissue, cell or organ specificity, modulating immunogenicity, modulating protease resistance, etc. Proteins that include an unnatural amino acid can have enhanced or even entirely new catalytic or biophysical properties. For example, the following properties are optionally modified by inclusion of an unnatural amino acid into a protein: toxicity, biodistribution, structural properties, spectroscopic properties, chemical and/or photochemical properties, catalytic ability, half-life (including but not limited to, serum half-life), ability to react with other molecules, including but not limited to, covalently or noncovalently, and the like. The compositions including proteins that include at least one
unnatural amino acid are useful for, including but not limited to, novel therapeutics, diagnostics, catalytic enzymes, industrial enzymes, binding proteins (including but not limited to, antibodies), and including but not limited to, the study of protein structure and function. See, e.g., Dougherty, (2000) Unnatural Amino Acids as Probes of Protein Structure and Function, Current Opinion in Chemical Biology, 4:645-652.
[00320] In one aspect of the invention, a composition includes at least one protein with at least one, including but not limited to, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, or at least ten or more unnatural amino acids. The unnatural amino acids can be the same or different, including but not limited to, there can be 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more different sites in the protein that comprise 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more different unnatural amino acids. In another aspect, a composition includes a protein with at least one, but fewer than all, of a particular amino acid present in the protein is substituted with the unnatural amino acid. For a given protein with more than one unnatural amino acids, the unnatural amino acids can be identical or different (including but not limited to, the protein can include two or more different types of unnatural amino acids, or can include two of the same unnatural amino acid). For a given protein with more than two unnatural amino acids, the unnatural amino acids can be the same, different or a combination of a multiple unnatural amino acid of the same kind with at least one different unnatural amino acid.
[00321] PSMC's of interest with at least one unnatural amino acid are a feature of the invention. The invention also includes polypeptides or proteins with at least one unnatural amino acid produced using the compositions and methods of the invention. An excipient (including but not limited to, a pharmaceutically acceptable excipient) can also be present with the protein.
[00322] By producing proteins or polypeptides of interest with at least one unnatural amino acid in eukaryotic cells, proteins or polypeptides will typically include eukaryotic post-translational modifications. In certain embodiments, a protein includes at least one unnatural amino acid and at least one post-translational modification that is made in vivo by a eukaryotic cell, where the post-translational modification is not made by a prokaryotic cell. For example, the post-translation modification includes, including but not limited to, acetylation, acylation, lipid-modification, palmitoylation, palmitate addition, phosphorylation, glycolipid-linkage modification, glycosylation, and the like. In one aspect, the post-translational modification includes attachment of an oligosaccharide (including but
not limited to, (GlcNAc-Man)2-Man-GlcNAc-GlcNAc)) to an asparagine by a GlcNAc- asparagine linkage. See Table 1 which lists some examples of N-linked oligosaccharides of eukaryotic proteins (additional residues can also be present, which are not shown). In another aspect, the post-translational modification includes attachment of an oligosaccharide (including but not limited to, Gal-GalNAc, Gal-GlcNAc, etc.) to a serine or threonine by a GalNAc-serine or GalNAc-threonine linkage, or a GlcNAc-serine or a GlcNAc-threonine linkage.
TABLE 1 : EXAMPLES OF OLIGOSACCHARIDES THROUGH GlcNAc-LI KAGE
[00323] In yet another aspect, the post-translation modification includes proteolytic processing of precursors (including but not limited to, calcitonin precursor, calcitonin gene- related peptide precursor, preproparathyroid hormone, preproinsulin, proinsulin, prepro- opiomelanocortin, pro-opiomelanocortin and the like), assembly into a multisubunit protein or macromolecular assembly, translation to another site in the cell (including but not limited to, to organelles, such as the endoplasmic reticulum, the Golgi apparatus, the nucleus, lysosomes, peroxisomes, mitochondria, chloroplasts, vacuoles, etc., or through the secretory pathway). In certain embodiments, the protein comprises a secretion or localization sequence, an epitope tag, a FLAG tag, a polyhistidine tag, a GST fusion, or the like.
[00324] One advantage of an unnatural amino acid is that it presents additional chemical moieties that can be used to add additional molecules. These modifications can be made in vivo in a eukaryotic or non-eukaryotic cell, or in vitro. Thus, in certain embodiments, the post-translational modification is through the unnatural amino acid. For example, the post-translational modification can be through a nucleophilic-electrophilic reaction. Most reactions currently used for the selective modification of proteins involve covalent bond formation between nucleophilic and electrophilic reaction partners, including but not limited to the reaction of a-haloketones with histidine or cysteine side chains. Selectivity in these cases is determined by the number and accessibility of the nucleophilic residues in the protein. In proteins of the invention, other more selective reactions can be used such as the reaction of an unnatural keto-amino acid with hydrazides or aminooxy compounds, in vitro and in vivo. See, e.g., Cornish, et al., (1996) Am. Chem. Soc, 1 18:8150-8151 ; Mahal, et al., (1997) Science, 276: 1 125-1 128; Wang, et al., (2001) Science 292:498-500; Chin, et al., (2002) Am. Chem. Soc. 124:9026-9027; Chin, et al., (2002) Proc. Natl. Acad. Sci.. 99: 1 1020-1 1024; Wang, et al., (2003) Proc. Natl. Acad. Sci., 100:56-61 ; Zhang, et al., (2003) Biochemistry, 42:6735-6746; and, Chin, et al., (2003) Science, in press. This allows the selective labeling of virtually any protein with a host of reagents including fluorophores, crosslinking agents, saccharide derivatives and cytotoxic molecules. See also, U.S. Patent Application Serial No. 10/686,944 entitled "Glycoprotein synthesis" filed October 15, 2003 based on U.S. provisional patent application Serial No. 60/419,265, filed Oct. 16, 2002, U.S. provisional patent application Serial No. 60/420,990, filed Oct. 23, 2002, and U.S. provisional patent application Serial No. 60/441,450, filed January 16, 2003, which are incorporated by reference herein. Post-translational modifications, including but not limited to, through an azido amino acid, can also made through the Staudinger ligation (including but not limited to, with triarylphosphine reagents). See, e.g., Kiick et al., (2002) Incorporation of azides into recombinant proteins for chemoselective modification by the Staudinger ligation, PNAS 99: 19-24.
[00325] This invention provides another highly efficient method for the selective modification of proteins, which involves the genetic incorporation of unnatural amino acids, including but not limited to, containing an azide or alkynyl moiety into proteins in response to a selector codon. These amino acid side chains can then be modified by, including but not limited to, a Huisgen [3+2] cycloaddition reaction {see, e.g., Padwa, A. in Comprehensive Organic Synthesis, Vol. 4, (1991) Ed. Trost, B. M., Pergamon, Oxford, p. 1069-1 109; and,
Huisgen, R. in 1 ,3-Dipolar Cycloaddition Chemistry, (1984) Ed. Padwa, A., Wiley, New York, p. 1-176) with, including but not limited to, alkynyl or azide derivatives, respectively. Because this method involves a cycloaddition rather than a nucleophilic substitution, proteins can be modified with extremely high selectivity. This reaction can be carried out at room temperature in aqueous conditions with excellent regioselectivity (1 ,4 > 1 ,5) by the addition of catalytic amounts of Cu(I) salts to the reaction mixture. See, e.g., Tornoe, et al., (2002) Org. Chem. 67:3057-3064; and, Rostovtsev, et al., (2002) Angew. Chem. Int. Ed. 41 :2596- 2599. Another method that can be used is the ligand exchange on a bisarsenic compound with a tetracysteine motif, see, e.g., Griffin, et al., (1998) Science 281 :269-272.
[00326] A molecule that can be added to a protein of the invention through a [3+2] cycloaddition includes virtually any molecule with an azide or alkynyl derivative. Molecules include, but are not limited to, dyes, fluorophores, crosslinking agents, saccharide derivatives, polymers (including but not limited to, derivatives of polyethylene glycol), photocrosslinkers, cytotoxic compounds, affinity labels, derivatives of biotin, resins, beads, a second protein or polypeptide (or more), polynucleotide(s) (including but not limited to, DNA, RNA, etc.), metal chelators, cofactors, fatty acids, carbohydrates, and the like. These molecules can be added to an unnatural amino acid with an alkynyl group, including but not limited to, p- propargyloxyphenylalanine, or azido group, including but not limited to, p-azido- phenylalanine, respectively.
V. In vivo generation of PSMC comprising non-genetically-encoded amino acids
[00327] The antigen-binding polypeptides of the invention can be generated in vivo using modified tRNA and tRNA synthetases to add to or substitute amino acids that are not encoded in naturally-occurring systems.
[00328] Methods for generating tRNAs and tRNA synthetases which use amino acids that are not encoded in naturally-occurring systems are described in, e.g., U.S. Patent Application Publications 2003/0082575 (Serial No. 10/126,927) and 2003/0108885 (Serial No. 10/126,931) which are incorporated by reference herein. These methods involve generating a translational machinery that functions independently of the synthetases and tRNAs endogenous to the translation system (and are therefore sometimes referred to as "orthogonal"). Typically, the translation system comprises an orthogonal tRNA (O-tRNA) and an orthogonal aminoacyl tRNA synthetase (O-RS). Typically, the O-RS preferentially aminoacylates the O-tRNA with at least one non-naturally occurring amino acid in the
translation system and the O-tRNA recognizes at least one selector codon that is not recognized by other tRNAs in the system. The translation system thus inserts the non- naturally-encoded amino acid into a protein produced in the system, in response to an encoded selector codon, thereby "substituting" an amino. acid into a position in the encoded polypeptide.
[00329] A wide variety of orthogonal tRNAs and aminoacyl tRNA synthetases have been described in the art for inserting particular synthetic amino acids into polypeptides, and are generally suitable for use in the present invention. For example, keto-specific O- tRNA/aminoacyl-tRNA synthetases are described in Wang, L., et al, Proc. Natl. Acad. Sci. USA 100:56-61 (2003) and Zhang, Z. et al., Biochem. 42(22):6735-6746 (2003). Exemplary O-RS, or portions thereof, are encoded by polynucleotide sequences and include amino acid sequences disclosed in U.S. Patent Application Publications 2003/0082575 and 2003/0108885, each incorporated herein by reference. Corresponding O-tRNA molecules for use with the O-RSs are also described in U.S. Patent Application Publications 2003/0082575 (Serial No. 10/126,927) and 2003/0108885 (Serial No. 10/126,931) which are incorporated by reference herein.
[00330] An example of an azide-specific O-tRNA/aminoacyl-tRNA synthetase system is described in Chin, J. W., et al, J. Am. Chem. Soc. 124:9026-9027 (2002). Exemplary O- RS sequences for -azido-L-Phe include, but are not limited to, nucleotide sequences SEQ ID NOs: 14-16 and 29-32 and amino acid sequences SEQ ID NOs: 46-48 and 61-64 as disclosed in U.S. Patent Application Publication 2003/0108885 (Serial No. 10/126,931) which is incorporated by reference herein. Exemplary O-tRNA sequences suitable for use in the present invention include, but are not limited to, nucleotide sequences SEQ ID NOs: 1 -3 as disclosed in U.S. Patent Application Publication 2003/0108885 (Serial No. 10/126,931) which is incorporated by reference herein. Other examples of O-tRNA/aminoacyl-tRNA synthetase pairs specific to particular non-naturally encoded amino acids are described in U.S. Patent Application Publication 2003/0082575 (Serial No. 10/126,927) which is incorporated by reference herein. O-RS and O-tRNA that incorporate both keto- and azide- containing amino acids in S. cerevisiae are described in Chin, J. W., et al., Science 301 :964- 967 (2003).
[00331] Use of O-tRNA/aminoacyl-tRNA synthetases involves selection of a specific codon which encodes the non-naturally encoded amino acid. While any codon can be used, it is generally desirable to select a codon that is rarely or never used in the cell in which the O-
tRNA/aminoacyl-tRNA synthetase is expressed. For example, exemplary codons include nonsense codon such as stop codons (amber, ochre, and opal), four or more base codons and other natural three-base codons that are rarely or unused.
[00332] Specific selector codon(s) can be introduced into appropriate positions in the PSMC polynucleotide coding sequence using mutagenesis methods known in the art (including but not limited to, site-specific mutagenesis, cassette mutagenesis, restriction selection mutagenesis, etc.).
[00333] Methods for generating components of the protein biosynthetic machinery, such as O-RSs, O-tRNAs, and orthogonal O-tRNA/O-RS pairs that can be used to incorporate a non-naturally encoded amino acid are described in Wang, L., et al, Science 292: 498-500 (2001); Chin, J. W., et al, J. Am. Chem. Soc. 124:9026-9027 (2002); Zhang, Z. et al, Biochemistry 42: 6735-6746 (2003). Methods and compositions for the in vivo incorporation of non-naturally encoded amino acids are described in U.S. Patent Application Publication 2003/0082575 (Serial No. 10/126,927) which is incorporated by reference herein. Methods for selecting an orthogonal tRNA-tRNA synthetase pair for use in in vivo translation system of an organism are also described in U.S. Patent Application Publications 2003/0082575 (Serial No. 10/126,927) and 2003/0108885 (Serial No. 10/126,931) which are incorporated by reference herein.
[00334] Methods for producing at least one recombinant orthogonal aminoacyl-tRNA synthetase (O-RS) comprise: (a) generating a library of (optionally mutant) RSs derived from at least one aminoacyl-tRNA synthetase (RS) from a first organism, including but not limited to, a prokaryotic organism, such as Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, P. furiosus, P. horikoshii, A. pernix, T. thermophilus, or the like, or a eukaryotic organism; (b) selecting (and/or screening) the library of RSs (optionally mutant RSs) for members that aminoacylate an orthogonal tRNA (O-tRNA) in the presence of a non-naturally encoded amino acid and a natural amino acid, thereby providing a pool of active (optionally mutant) RSs; and/or, (c) selecting (optionally through negative selection) the pool for active RSs (including but not limited to, mutant RSs) that preferentially aminoacylate the O-tRNA in the absence of the non-naturally encoded amino acid, thereby providing the at least one recombinant O-RS; wherein the at least one recombinant O-RS preferentially aminoacylates the O-tRNA with the non-naturally encoded amino acid.
[00335] In one embodiment, the RS is an inactive RS. The inactive RS can be generated by mutating an active RS. For example, the inactive RS can be generated by mutating at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, or at least about 10 or more amino acids to different amino acids, including but not limited to, alanine.
[00336] Libraries of mutant RSs can be generated using various techniques known in the art, including but not limited to rational design based on protein three dimensional RS structure, or mutagenesis of RS nucleotides in a random or rational design technique. For example, the mutant RSs can be generated by site-specific mutations, random mutations, diversity generating recombination mutations, chimeric constructs, rational design and by other methods described herein or known in the art.
[00337] In one embodiment, selecting (and/or screening) the library of RSs (optionally mutant RSs) for members that are active, including but not limited to, that aminoacylate an orthogonal tRNA (O-tRNA) in the presence of a non-naturally encoded amino acid and a natural amino acid, includes: introducing a positive selection or screening marker, including but not limited to, an antibiotic resistance gene, or the like, and the library of (optionally mutant) RSs into a plurality of cells, wherein the positive selection and/or screening marker comprises at least one selector codon, including but not limited to, an amber, ochre, or opal codon; growing the plurality of cells in the presence of a selection agent; identifying cells that survive (or show a specific response) in the presence of the selection and/or screening agent by suppressing the at least one selector codon in the positive selection or screening marker, thereby providing a subset of positively selected cells that contains the pool of active (optionally mutant) RSs. Optionally, the selection and/or screening agent concentration can be varied.
[00338] In one aspect, the positive selection marker is a chloramphenicol acetyltransferase (CAT) gene and the selector codon is an amber stop codon in the CAT gene. Optionally, the positive selection marker is a β-lactamase gene and the selector codon is an amber stop codon in the β-lactamase gene. In another aspect the positive screening marker comprises a fluorescent or luminescent screening marker or an affinity based screening marker (including but not limited to, a cell surface marker).
[00339] In one embodiment, negatively selecting or screening the pool for active RSs
(optionally mutants) that preferentially aminoacylate the O-tRNA in the absence of the non- naturally encoded amino acid includes: introducing a negative selection or screening marker
with the pool of active (optionally mutant) RSs from the positive selection or screening into a plurality of cells of a second organism, wherein the negative selection or screening marker comprises at least one selector codon (including but not limited to, an antibiotic resistance gene, including but not limited to, a chloramphenicol acetyltransferase (CAT) gene); and, identifying cells that survive or show a specific screening response in a first medium supplemented with the non-naturally encoded amino acid and a screening or selection agent, but fail to survive or to show the specific response in a second medium not supplemented with the non-naturally encoded amino acid and the selection or screening agent, thereby providing surviving cells or screened cells with the at least one recombinant O-RS. For example, a CAT identification protocol optionally acts as a positive selection and/or a negative screening in determination of appropriate O-RS recombinants. For instance, a pool of clones is optionally replicated on growth plates containing CAT (which comprises at least one selector codon) either with or without one or more non-naturally encoded amino acid. Colonies growing exclusively on the plates containing non-naturally encoded amino acids are thus regarded as containing recombinant O-RS. In one aspect, the concentration of the selection (and/or screening) agent is varied. In some aspects the first and second organisms are different. Thus, the first and/or second organism optionally comprises: a prokaryote, a eukaryote, a mammal, an Escherichia coli, a fungi, a yeast, an archaebacterium, a eubacterium, a plant, an insect, a protist, etc. In other embodiments, the screening marker comprises a fluorescent or luminescent screening marker or an affinity based screening marker.
[00340] In another embodiment, screening or selecting (including but not limited to, negatively selecting) the pool for active (optionally mutant) RSs includes: isolating the pool of active mutant RSs from the positive selection step (b); introducing a negative selection or screening marker, wherein the negative selection or screening marker comprises at least one selector codon (including but not limited to, a toxic marker gene, including but not limited to, a ribonuclease barnase gene, comprising at least one selector codon), and the pool of active (optionally mutant) RSs into a plurality of cells of a second organism; and identifying cells that survive or show a specific screening response in a first medium not supplemented with the non-naturally encoded amino acid, but fail to survive or show a specific screening response in a second medium supplemented with the non-naturally encoded amino acid, thereby providing surviving or screened cells with the at least one recombinant O-RS, wherein the at least one recombinant O-RS is specific for the non-naturally encoded amino
acid. In one aspect, the at least one selector codon comprises about two or more selector codons. Such embodiments optionally can include wherein the at least one selector codon comprises two or more selector codons, and wherein the first and second organism are different (including but not limited to, each organism is optionally, including but not limited to, a prokaryote, a eukaryote, a mammal, an Escherichia coli, a. fungi, a yeast, an archaebacteria, a eubacteria, a plant, an insect, a protist, etc.). Also, some aspects include wherein the negative selection marker comprises a ribonuclease barnase gene (which comprises at least one selector codon). Other aspects include wherein the screening marker optionally comprises a fluorescent or luminescent screening marker or an affinity based screening marker. In the embodiments herein, the screenings and/or selections optionally include variation of the screening and/or selection stringency.
[00341] In one embodiment, the methods for producing at least one recombinant orthogonal aminoacyl-tR A synthetase (O-RS) can further comprise: (d) isolating the at least one recombinant O-RS; (e) generating a second set of O-RS (optionally mutated) derived from the at least one recombinant O-RS; and, (f) repeating steps (b) and (c) until a mutated O-RS is obtained that comprises an ability to preferentially aminoacylate the O-tRNA. Optionally, steps (d)-(f) are repeated, including but not limited to, at least about two times. In one aspect, the second set of mutated O-RS derived from at least one recombinant O-RS can be generated by mutagenesis, including but not limited to, random mutagenesis, site-specific mutagenesis, recombination or a combination thereof.
[00342] The stringency of the selection/screening steps, including but not limited to, the positive selection/screening step (b), the negative selection/screening step (c) or both the positive and negative selection/screening steps (b) and (c), in the above-described methods, optionally includes varying the selection/screening stringency. In another embodiment, the positive selection/screening step (b), the negative selection/screening step (c) or both the positive and negative selection/screening steps (b) and (c) comprise using a reporter, wherein the reporter is detected by fluorescence-activated cell sorting (FACS) or wherein the reporter is detected by luminescence. Optionally, the reporter is displayed on a cell surface, on a phage display or the like and selected based upon affinity or catalytic activity involving the non-naturally encoded amino acid or an analogue. In one embodiment, the mutated synthetase is displayed on a cell surface, on a phage display or the like.
[00343] Methods for producing a recombinant orthogonal tRNA (O-tRNA) include: (a) generating a library of mutant tRNAs derived from at least one tRNA, including but not
limited to, a suppressor tRNA, from a first organism; (b) selecting (including but not limited to, negatively selecting) or screening the library for (optionally mutant) tRNAs that are aminoacylated by an aminoacyl-tRNA synthetase (RS) from a second organism in the absence of a RS from the first organism, thereby providing a pool of tRNAs (optionally mutant); and, (c) selecting or screening the pool of tRNAs (optionally mutant) for members that are aminoacylated by an introduced orthogonal RS (O-RS), thereby providing at least one recombinant O-tRNA; wherein the at least one recombinant O-tRNA recognizes a selector codon and is not efficiency recognized by the RS from the second organism and is preferentially aminoacylated by the O-RS. In some embodiments the at least one tRNA is a suppressor tRNA and/or comprises a unique three base codon of natural and/or unnatural bases, or is a nonsense codon, a rare codon, an unnatural codon, a codon comprising at least 4 bases, an amber codon, an ochre codon, or an opal stop codon. In one embodiment, the recombinant O-tRNA possesses an improvement of orthogonality. It will be appreciated that in some embodiments, O-tRNA is optionally imported into a first organism from a second organism without the need for modification. In various embodiments, the first and second organisms are either the same or different and are optionally chosen from, including but not limited to, prokaryotes (including but not limited to, Methanococcus jannaschii, Methanobacteium thermoautotrophicum, Escherichia coli, Halobacterium, etc.), eukaryotes, mammals, fungi, yeasts, archaebacteria, eubacteria, plants, insects, protists, etc. Additionally, the recombinant tRNA is optionally aminoacylated by a non-naturally encoded amino acid, wherein the non-naturally encoded amino acid is biosynthesized in vivo either naturally or through genetic manipulation. The non-naturally encoded amino acid is optionally added to a growth medium for at least the first or second organism.
[00344] In one aspect, selecting (including but not limited to, negatively selecting) or screening the library for (optionally mutant) tRNAs that are aminoacylated by an aminoacyl- tRNA synthetase (step (b)) includes: introducing a toxic marker gene, wherein the toxic marker gene comprises at least one of the selector codons (or a gene that leads to the production of a toxic or static agent or a gene essential to the organism wherein such marker gene comprises at least one selector codon) and the library of (optionally mutant) tRNAs into a plurality of cells from the second organism; and, selecting surviving cells, wherein the surviving cells contain the pool of (optionally mutant) tRNAs comprising at least one orthogonal tRNA or nonfunctional tRNA. For example, surviving cells can be selected by using a comparison ratio cell density assay.
[00345] In another aspect, the toxic marker gene can include two or more selector codons. In another embodiment of the methods, the toxic marker gene is a ribonuclease barnase gene, where the ribonuclease barnase gene comprises at least one amber codon. Optionally, the ribonuclease barnase gene can include two or more amber codons.
[00346] In one embodiment, selecting or screening the pool of (optionally mutant) tRNAs for members that are aminoacylated by an introduced orthogonal RS (O-RS) can include: introducing a positive selection or screening marker gene, wherein the positive marker gene comprises a drug resistance gene (including but not limited to, β-lactamase gene, comprising at least one of the selector codons, such as at least one amber stop codon) or a gene essential to the organism, or a gene that leads to detoxification of a toxic agent, along with the O-RS, and the pool of (optionally mutant) tRNAs into a plurality of cells from the second organism; and, identifying surviving or screened cells grown in the presence of a selection or screening agent, including but not limited to, an antibiotic, thereby providing a pool of cells possessing the at least one recombinant tRNA, where the at least one recombinant tRNA is aminoacylated by the O-RS and inserts an amino acid into a translation product encoded by the positive marker gene, in response to the at least one selector codons. In another embodiment, the concentration of the selection and/or screening agent is varied.
[00347] Methods for generating specific O-tRNA/O-RS pairs are provided. Methods include: (a) generating a library of mutant tRNAs derived from at least one tRNA from a first organism; (b) negatively selecting or screening the library for (optionally mutant) tRNAs that are aminoacylated by an aminoacyl-tRNA synthetase (RS) from a second organism in the absence of a RS from the first organism, thereby providing a pool of (optionally mutant) tRNAs; (c) selecting or screening the pool of (optionally mutant) tRNAs for members that are aminoacylated by an introduced orthogonal RS (O-RS), thereby providing at least one recombinant O-tRNA. The at least one recombinant O-tRNA recognizes a selector codon and is not efficiency recognized by the RS from the second organism and is preferentially aminoacylated by the O-RS. The method also includes (d) generating a library of (optionally mutant) RSs derived from at least one aminoacyl-tRNA synthetase (RS) from a third organism; (e) selecting or screening the library of mutant RSs for members that preferentially aminoacylate the at least one recombinant O-tRNA in the presence of a non-naturally encoded amino acid and a natural amino acid, thereby providing a pool of active (optionally mutant) RSs; and, (f) negatively selecting or screening the pool for active (optionally mutant) RSs that preferentially aminoacylate the at least one recombinant O-tRNA in the absence of
the non-naturally encoded amino acid, thereby providing the at least one specific 0-tRNA/O- RS pair, wherein the at least one specific O-tRNA/O-RS pair comprises at least one recombinant O-RS that is specific for the non-naturally encoded amino acid and the at least one recombinant O-tRNA. Specific O-tRNA/O-RS pairs produced by the methods are included. For example, the specific O-tRNA/O-RS pair can include, including but not limited to, a mutRNATyr-mutTyrRS pair, such as a mutRNATyr-SS 12TyrRS pair, a mutRNALeu- mutLeuRS pair, a mutRNAThr-mutThrRS pair, a mutRNAGlu-mutGluRS pair, or the like. Additionally, such methods include wherein the first and third organism are the same (including but not limited to, Methanococcus jannaschii).
[00348] Methods for selecting an orthogonal tRNA-tRNA synthetase pair for use in an in vivo translation system of a second organism are also included in the present invention. The methods include: introducing a marker gene, a tRNA and an aminoacyl-tRNA synthetase (RS) isolated or derived from a first organism into a first set of cells from the second organism; introducing the marker gene and the tRNA into a duplicate cell set from a second organism; and, selecting for surviving cells in the first set that fail to survive in the duplicate cell set or screening for cells showing a specific screening response that fail to give such response in the duplicate cell set, wherein the first set and the duplicate cell set are grown in the presence, of a selection or screening agent, wherein the surviving or screened cells comprise the orthogonal tRNA-tRNA synthetase pair for use in the in the in vivo translation system of the second organism. In one embodiment, comparing and selecting or screening includes an in vivo complementation assay. The concentration of the selection or screening agent can be varied.
[00349] The organisms of the present invention comprise a variety of organism and a variety of combinations. For example, the first and the second organisms of the methods of the present invention can be the same or different. In one embodiment, the organisms are optionally a prokaryotic organism, including but not limited to, Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, P. furiosus, P. horikoshii, A. pernix, T. thermophilus, or the like. Alternatively, the organisms optionally comprise a eukary otic organism, including but not limited to, plants (including but not limited to, complex plants such as monocots, or dicots), algae, protists, fungi (including but not limited to, yeast, etc), animals (including but not limited to, mammals, insects, arthropods, etc.), or the like. In another embodiment, the second organism is a prokaryotic organism, including but not limited to, Methanococcus jannaschii, Methanobacterium
thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, Halobacterium, P. furiosus, P. horikoshii, A. pernix, T. thermophilics, or the like. Alternatively, the second organism can be a eukaryotic organism, including but not limited to, a yeast, a animal cell, a plant cell, a fungus, a mammalian cell, or the like. In various embodiments the first and second organisms are different.
VI. Location of non-naturally-occurring amino acids in PSMC
[00350] The present invention contemplates incorporation of one or more non- naturally-occurring amino acids into PSMC. One or more non-naturally-occurring amino acids may be incorporated at a particular position which does not disrupt activity of the polypeptide. This can be achieved by making "conservative" substitutions, including but not limited to, substituting hydrophobic amino acids with hydrophobic amino acids, bulky amino acids for bulky amino acids, hydrophilic amino acids for hydrophilic amino acids) and/or inserting the non-naturally-occurring amino acid in a location that is not required for activity.
[00351] A variety of biochemical and structural approaches can be employed to select the desired sites for substitution with a non-naturally encoded amino acid within the antigen- binding polypeptide. It is readily apparent to those of ordinary skill in the art that any position of the polypeptide chain is suitable for selection to incorporate a non-naturally encoded amino acid, and selection may be based on rational design or by random selection for any or no particular desired purpose. Selection of desired sites may be for producing a PSMC molecule having any desired property or activity, including but not limited to, agonists, super-agonists, inverse agonists, antagonists, receptor binding modulators, receptor activity modulators, dimer or multimer formation, no change to activity or property compared to the native molecule, or manipulating any physical or chemical property of the polypeptide such as solubility, aggregation, or stability. For example, locations in the polypeptide required for biological activity of PSMC can be identified using alanine scanning or homolog scanning methods known in the art. Residues other than those identified as critical to biological activity by alanine or homolog scanning mutagenesis may be good candidates for substitution with a non-naturally encoded amino acid depending on the desired activity sought for the polypeptide. Alternatively, the sites identified as critical to biological activity may also be good candidates for substitution with a non-naturally encoded amino acid, again depending on the desired activity sought for the polypeptide. Another alternative would be to simply make serial substitutions in each position on the polypeptide chain with a non- naturally encoded amino acid and observe the effect on the activities of the polypeptide. It is
readily apparent to those of ordinary skill in the art that any means, technique, or method for selecting a position for substitution with a non-natural amino acid into any polypeptide is suitable for use in the present invention.
[00352] Once residues that are likely to be intolerant to substitution with non-naturally encoded amino acids have been eliminated, the impact of proposed substitutions at each of the remaining positions can be examined from the secondary, tertiary or quaternary structure, or the three-dimensional crystal structure of the antigen-binding polypeptide and its binding partners. Thus, those of skill in the art can readily identify amino acid positions that can be substituted with non-naturally encoded amino acids.
[00353] Exemplary residues of incorporation of a non-naturally encoded amino acid include, but are not limited to, those that are excluded from potential antigen binding regions, may be fully or partially solvent exposed, have minimal or no hydrogen-bonding interactions with nearby residues, may be minimally exposed to nearby reactive residues, may be on one or more of the exposed faces of PSMC, may be a site or sites of PSMC that are juxtaposed to a second PSMC, or other molecule or fragment thereof, may be in regions that are highly flexible, or structurally rigid, as predicted by the three-dimensional, secondary, tertiary, or quaternary structure of PSMC, bound or unbound to its antigen, or coupled or not coupled to another PSMC or other biologically active molecule, or may modulate the conformation of the PSMC itself or a dimer or multimer comprising one or more PSMC, by altering the flexibility or rigidity of the complete structure as desired. Residues for incorporation of non- natural amino acids may be a part of a cleavage sequence, linker sequence joining antibody fragments or PSMCs, antibody-binding domain (including but not limited to, myc tag, FLAG or poly-His) or other affinity based sequence (including but not limited to, FLAG, poly-His, GST, etc.). Residues for incorporation of a non-natural amino acid may be N-terminal or C- terminal residues of a PSMC or non-antigen binding residues of a PSMC.
[00354] A wide variety of non-naturally encoded amino acids can be substituted for, or incorporated into, a given position in PSMC. In general, a particular non-naturally encoded amino acid is selected for incorporation based on an examination of the three dimensional crystal structure of PSMC with its antigen or the secondary, tertiary, or quartemary structure of PSMC determined by any other means, a preference for conservative substitutions (i.e., aryl-based non-naturally encoded amino acids, such as p-acetylphenylalanine or O- propargyltyrosine substituting for Phe, Tyr or Trp), and the specific conjugation chemistry that one desires to introduce into the antigen-binding polypeptide (e.g., the introduction of 4-
azidophenylalanine if one wants to effect a Huisgen [3+2] cycloaddition with a water soluble polymer bearing an alkyne moiety or a amide bond formation with a water soluble polymer that bears an aryl ester that, in turn, incorporates a phosphine moiety).
[00355] In one embodiment, the method further includes incorporating into the protein the unnatural amino acid, where the unnatural amino acid comprises a first reactive group; and contacting the protein with a molecule (including but not limited to, a label, a dye, a polymer, a water-soluble polymer, a derivative of polyethylene glycol, a photocrosslinker, a radionuclide, a cytotoxic compound, a drug, an affinity label, a photoaffinity label, a reactive compound, a resin, a second protein or polypeptide or polypeptide analog, an antibody or antibody fragment, a metal chelator, a cofactor, a fatty acid, a carbohydrate, a polynucleotide, a DNA, a RNA, an antisense polynucleotide, a water-soluble dendrimer, a cyclodextrin, an inhibitory ribonucleic acid, a biomaterial, a nanoparticle, a spin label, a fluorophore, a metal- containing moiety, a radioactive moiety, a novel functional group, a group that covalently or noncovalently interacts with other molecules, a photocaged moiety, a photoisomerizable moiety, biotin, a derivative of biotin, a derivative of biotin, a biotin analogue, a moiety incorporating a heavy atom, a chemically cleavable group, a photocleavable group, an elongated side chain, a carbon-linked sugar, a redox-active agent, an amino thioacid, a toxic moiety, an isotopically labeled moiety, a biophysical probe, a phosphorescent group, a chemiluminescent group, an electron dense group, a magnetic group, an intercalating group, a chromophore, an energy transfer agent, a biologically active agent, a detectable label, a small molecule, or any combination of the above, or any other desirable compound or substance) that comprises a second reactive group. The first reactive group reacts with the second reactive group to attach the molecule to the unnatural amino acid through a [3+2] cycloaddition. In one embodiment, the first reactive group is an alkynyl or azido moiety and the second reactive group is an azido or alkynyl moiety. For example, the first reactive group is the alkynyl moiety (including but not limited to, in unnatural amino acid p- propargyloxyphenylalanine) and the second reactive group is the azido moiety. In another example, the first reactive group is the azido moiety (including but not limited to, in the unnatural amino acid p-azido-L-phenylalanine) and the second reactive group is the alkynyl moiety.
[00356] In some cases, the non-naturally encoded amino acid substitution(s) will be combined with other additions, substitutions or deletions within the antigen-binding polypeptide to affect other biological traits of PSMC. In some cases, the other additions,
substitutions or deletions may increase the stability (including but not limited to, resistance to proteolytic degradation) of the PSMC or increase affinity of the PSMC for a PSMC receptor or antigen. In some cases, the other additions, substitutions or deletions may increase the solubility (including but not limited to, when expressed in E. coli or other host cells) of the antigen-binding polypeptide. In some embodiments additions, substitutions or deletions may increase the polypeptide solubility following expression in coli or other recombinant host cells. In some embodiments sites are selected for substitution with a naturally encoded or non-natural amino acid in addition to another site for incorporation of a non-natural amino acid that results in increasing the polypeptide solubility following expression in E. coli or other recombinant host cells. In some embodiments, the antigen-binding polypeptides comprise another addition, substitution or deletion that modulates affinity for the PSMC receptor, modulates (including but not limited to, increases or decreases) receptor dimerization, stabilizes receptor dimers, modulates circulating half-life, modulates release or bio-availability, facilitates purification, or improves or alters a particular route of administration. Similarly, antigen-binding polypeptides can comprise chemical or enzyme cleavage sequences, protease cleavage sequences, reactive groups, antibody-binding domains (including but not limited to, FLAG or poly-His) or other affinity based sequences (including, but not limited to, FLAG, poly-His, GST, etc.) or linked molecules (including, but not limited to, biotin) that improve detection (including, but not limited to, GFP), purification, transport through tissues or cell membranes, prodrug release or activation, PSMC size reduction, or other traits of the polypeptide.
[00357] In some cases, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, or more amino acids are substituted with one or more non-naturally-encoded amino acids. In some cases, the PSMC further includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more substitutions of one or more non-naturally encoded amino acids for naturally-occurring amino acids. In some embodiments, at least two residues in the following regions of PSMC are substituted with one or more non-naturally encoded amino acids. In some cases, the two or more non-naturally encoded residues are linked to one or more lower molecular weight linear or branched PEGs (approximately ~ 5- 20 kDa in mass or less), thereby enhancing binding affinity and comparable serum half-life relative to the species attached to a single, higher molecular weight PEG.
[00358] In some embodiments, up to two of the residues of an antigen-binding polypeptide are substituted with one or more non-naturally-encoded amino acids.
VII. Expression in Non-eukaryotes and Eukaryotes
[00359] To obtain high level expression of a cloned PSMC polynucleotide, one typically subclones polynucleotides encoding an antigen-binding polypeptide of the invention into an expression vector that contains a strong promoter to direct transcription, a transcription/translation terminator, and if for a nucleic acid encoding a protein, a ribosome binding site for translational initiation. Suitable bacterial promoters are well known in the art and described, e.g., in Sambrook et al. and Ausubel et al.
[00360] Bacterial expression systems for expressing PSMC polypeptides of the invention are available in, including but not limited to, E. coli, Bacillus sp., Pseudomonas fluorescens, Pseudomonas aeruginosa, Pseudomonas putida, and Salmonella (Palva et al., Gene 22:229-235 (1983); Mosbach et al, Nature 302:543-545 (1983)). Kits for such expression systems are commercially available. Eukaryotic expression systems for mammalian cells, yeast, and insect cells are well known in the art and are also commercially available. In cases where orthogonal tRNAs and aminoacyl tR A synthetases (described above) are used to express the antigen-binding polypeptides of the invention, host cells for expression are selected based on their ability to use the orthogonal components. Exemplary host cells include Gram-positive bacteria (including but not limited to B. brevis, B. subtilis, or Streptomyces) and Gram-negative bacteria E. coli, Pseudomonas fluorescens, Pseudomonas aeruginosa, Pseudomonas putida), as well as yeast and other eukaryotic cells. Cells comprising O-tR A/O-RS pairs can be used as described herein.
[00361] A eukaryotic host cell or non-eukaryotic host cell of the present invention provides the ability to synthesize proteins that comprise unnatural amino acids in large useful quantities. In one aspect, the composition optionally includes, including but not limited to, at least 10 micrograms, at least 50 micrograms, at least 75 micrograms, at least 100 micrograms, at least 200 micrograms, at least 250 micrograms, at least 500 micrograms, at least 1 milligram, at least 10 milligrams, at least 100 milligrams, at least one gram, or more of the protein that comprises an unnatural amino acid, or an amount that can be achieved with in vivo protein production methods (details on recombinant protein production and purification are provided herein). In another aspect, the protein is optionally present in the composition at a concentration of, including but not limited to, at least 10 micrograms of protein per liter, at least 50 micrograms of protein per liter, at least 75 micrograms of protein per liter, at least 100 micrograms of protein per liter, at least 200 micrograms of protein per liter, at least 250 micrograms of protein per liter, at least 500 micrograms of protein per liter, at least 1
milligram of protein per liter, or at least 10 milligrams of protein per liter or more, in, including but not limited to, a cell lysate, a buffer, a pharmaceutical buffer, or other liquid suspension (including but not limited to, in a volume of, including but not limited to, anywhere from about 1 nl to about 100 L). The production of large quantities (including but not limited to, greater that that typically possible with other methods, including but not limited to, in vitro translation) of a protein in a eukaryotic cell including at least one unnatural amino acid is a feature of the invention.
[00362] A eukaryotic host cell or non-eukaryotic host cell of the present invention provides the ability to biosynthesize proteins that comprise unnatural amino acids in large useful quantities. For example, proteins comprising an unnatural amino acid can be produced at a concentration of, including but not limited to, at least 10 μg/liter, at least 50 μg/liter, at least 75 μg/liter, at least 100 μg/liter, at least 200 μg/liter, at least 250 μg/liter, or at least 500 μg/liter, at least lmg/liter, at least 2mg/liter, at least 3 mg/liter, at least 4 mg/liter, at least 5 mg/liter, at least 6 mg/liter, at least 7 mg/liter, at least 8 mg/liter, at least 9 mg/liter, at least 10 mg/liter, at least 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900 mg/liter, 1 g/liter, 5 g/liter, 10 g/liter or more of protein in a cell extract, cell lysate, culture medium, a buffer, and/or the like.
I. Expression Systems, Culture, and Isolation
[00363] PSMC may be expressed in any number of suitable expression systems including, for example, yeast, insect cells, mammalian cells, and bacteria. A description of exemplary expression systems is provided below.
[00364] Yeast As used herein, the term "yeast" includes any of the various yeasts capable of expressing a gene encoding PSMC. Such yeasts include, but are not limited to, ascosporogenous yeasts {Endomycetales), basidiosporogenous yeasts and yeasts belonging to the Fungi imperfecti {Blastomycetes) group. The ascosporogenous yeasts are divided into two families, Spermophthoraceae and Saccharomycetaceae. The latter is comprised of four subfamilies, Schizosaccharomycoideae (e.g., genus Schizosaccharomyces), Nadsonioideae, Lipomycoideae and Saccharomycoideae (e.g., genera Pichia, Kluyveromyces and Saccharomyces). The basidiosporogenous yeasts include the genera Leucosporidium, Rhodosporidium, Sporidiobolus, Filobasidium, and Filobasidiella. Yeasts belonging to the Fungi Imperfecti {Blastomycetes) group are divided into two families, Sporobolomycetaceae (e.g., genera Sporobolomyces and Bullera) and Cryptococcaceae (e.g., genus Candida).
[00365] Of particular interest for use with the present invention are species within the genera Pichia, Kluyveromyces, Saccharomyces, Schizosaccharomyces, Hansenula, Torulopsis, and Candida, including, but not limited to, P. pastoris, P. guillerimondii, S. cerevisiae, S. carlsbergensis, S. diastaticus, S. douglasii, S. kluyveri, S, norbensis, S. oviformis, K. lactis, K. fragilis, C. albicans, C. maltosa, and H. polymorpha.
[00366] The selection of suitable yeast for expression of PSMC is within the skill of one of ordinary skill in the art. In selecting yeast hosts for expression, suitable hosts may include those shown to have, for example, good secretion capacity, low proteolytic activity, good secretion capacity, good soluble protein production, and overall robustness. Yeast are generally available from a variety of sources including, but not limited to, the Yeast Genetic Stock Center, Department of Biophysics and Medical Physics, University of California (Berkeley, CA), and the American Type Culture Collection ("ATCC") (Manassas, VA).
[00367] The term "yeast host" or "yeast host cell" includes yeast that can be, or has been, used as a recipient for recombinant vectors or other transfer DNA. The term includes the progeny of the original yeast host cell that has received the recombinant vectors or other transfer DNA. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement to the original parent, due to accidental or deliberate mutation. Progeny of the parental cell that are sufficiently similar to the parent to be characterized by the relevant property, such as the presence of a nucleotide sequence encoding PSMC, are included in the progeny intended by this definition.
[00368] Expression and transformation vectors, including extrachromosomal replicons or integrating vectors, have been developed for transformation into many yeast hosts. For example, expression vectors have been developed for S. cerevisiae (Sikorski et al., GENETICS (1998) 1 12: 19; Ito et al., J. BACTERIOL. (1983) 153 : 163; Hinnen et al., PROC. NATL. ACAD. SCI. USA (1978) 75: 1929); C. albicans (Kurtz et al., MOL. CELL. BIOL. (1986) 6: 142); C. maltosa (Kunze et al., J. BASIC MICROBIOL. (1985) 25: 141); H. polymorpha (Gleeson et al., J. GEN. MICROBIOL. (1986) 132:3459; Roggenkamp et al., MOL. GEN. GENET. (1986) 202:302); K. fragilis (Das et al., J. BACTERIOL. (1984) 158: 1 165); K. lactis (De Louvencourt et al., J. BACTERIOL. (1983) 154:737; Van den Berg et al., BIO/TECHNOLOGY (1990) 8: 135); P. guillerimondii (Kunze et al., J. BASIC MICROBIOL. (1985) 25: 141); P. pastoris (U.S. Patent Nos. 5,324,639; 4,929,555; and 4,837,148; Cregg et al., MOL. CELL. BIOL. (1985) 5:3376); Schizosaccharomyces pombe (Beach and Nurse, NATURE (1981) 300:706); and Y. lipolytica
(Davidow et al., CURR. GENET. (1985) 10:380 (1985); Gaillardin et al., CURR. GENET. (1985) 10:49); A. nidulans (Ballance et al., BiOCHEM. BiOPHYS. RES. COMMUN. (1983) 1 12:284-89; Tilburn et al., GENE (1983) 26:205-221 ; and Yelton et al., PROC. NATL. ACAD. SCI. USA (1984) 81 : 1470-74); A. niger (Kelly and Hynes, EMBO J. (1985) 4:475479); T. reesia (EP 0 244 234); and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium (WO 91/00357), each incorporated by reference herein.
[00369] Control sequences for yeast vectors are well known to those of ordinary skill in the art and include, but are not limited to, promoter regions from genes such as alcohol dehydrogenase (ADH) (EP 0 284 044); enolase; glucokinase; glucose-6-phosphate isomerase; glyceraldehydes-3-phosphate-dehydrogenase (GAP or GAPDH); hexokinase; phosphofructokinase; 3-phosphoglycerate mutase; and pyruvate kinase (PyK) (EP 0 329 203). The yeast PH05 gene, encoding acid phosphatase, also may provide useful promoter sequences (Myanohara et al., PROC. NATL. ACAD. SCI. USA (1983) 80: 1). Other suitable promoter sequences for use with yeast hosts may include the promoters for 3- phosphoglycerate kinase (Hitzeman et al., J. BIOL. CHEM. (1980) 255:2073); and other glycolytic enzymes, such as pyruvate decarboxylase, triosephosphate isomerase, and phosphoglucose isomerase (Holland et al., BIOCHEMISTRY (1978) 17:4900; Hess et al., J. ADV. ENZYME REG. (1968) 7: 149). Inducible yeast promoters having the additional advantage of transcription controlled by growth conditions may include the promoter regions for alcohol dehydrogenase 2; isocytochrome C; acid phosphatase; metallothionein; glyceraldehyde-3 -phosphate dehydrogenase; degradative enzymes associated with nitrogen metabolism; and enzymes responsible for maltose and galactose utilization. Suitable vectors and promoters for use in yeast expression are further described in EP 0 073 657.
[00370] Yeast enhancers also may be used with yeast promoters. In addition, synthetic promoters may also function as yeast promoters. For example, the upstream activating sequences (UAS) of a yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter. Examples of such hybrid promoters include the ADH regulatory sequence linked to the GAP transcription activation region. See U.S. Patent Nos. 4,880,734 and 4,876,197, which are incorporated by reference herein. Other examples of hybrid promoters include promoters that consist of the regulatory sequences of the ADH2, GAL4, GAL 10, or PH05 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such as GAP or PyK. See EP 0 164 556. Furthermore, a yeast promoter may include naturally occurring promoters
of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription.
[00371] Other control elements that may comprise part of the yeast expression vectors include terminators, for example, from GAPDH or the enolase genes (Holland et al, J. BIOL. CHE . (1981) 256: 1385). In addition, the origin of replication from the 2μ plasmid origin is suitable for yeast. A suitable selection gene for use in yeast is the trpl gene present in the yeast plasmid. See Tschemper et al., GENE (1980) 10: 157; Kingsman et al., GENE (1979) 7: 141. The trpl gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan. Similarly, Leu2-deficient yeast strains (ATCC 20,622 or 38,626) are complemented by known plasmids bearing the Leu2 gene.
[00372] Methods of introducing exogenous DNA into yeast hosts are well known to those of ordinary skill in the art, and typically include, but are not limited to, either the transformation of spheroplasts or of intact yeast host cells treated with alkali cations. For example, transformation of yeast can be carried out according to the method described in Hsiao et al., PROC. NATL. ACAD. SCI. USA (1979) 76:3829 and Van Solingen et al., J. BACT. (1977) 130:946. However, other methods for introducing DNA into cells such as by nuclear injection, electroporation, or protoplast fusion may also be used as described generally in SAMBROO ET AL., MOLECULAR CLONING: A LAB. MANUAL (2001). Yeast host cells may then be cultured using standard techniques known to those of ordinary skill in the art.
[00373] Other methods for expressing heterologous proteins in yeast host cells are well known to those of ordinary skill in the art. See generally U.S. Patent Publication No. 20020055169, U.S. Patent Nos. 6,361 ,969; 6,312,923; 6,183,985; 6,083,723; 6,017,731 ; 5,674,706; 5,629,203; 5,602,034; and 5,089,398; U.S. Reexamined Patent Nos. RE37,343 and RE35J49; PCT Published Patent Applications WO 99/078621 ; WO 98/37208; and WO 98/26080; European Patent Applications EP 0 946 736; EP 0 732 403; EP 0 480 480; EP 0 460 071 ; EP 0 340 986; EP 0 329 203; EP 0 324 274; and EP 0 164 556. See also Gellissen et al., ANTONIE VAN LEEUWENHOEK (1992) 62(l-2):79-93; Romanos et al., YEAST (1992) 8(6):423-488; Goeddel, METHODS IN ENZYMOLOGY (1990) 185:3-7, each incorporated by reference herein.
[00374] The yeast host strains may be grown in fermentors during the amplification stage using standard feed batch fermentation methods well known to those of ordinary skill in the art. The fermentation methods may be adapted to account for differences in a particular yeast host's carbon utilization pathway or mode of expression control. For example,
fermentation of a Saccharomyces yeast host may require a single glucose feed, complex nitrogen source (e.g., casein hydrolysates), and multiple vitamin supplementation. In contrast, the methylotrophic yeast P. pastoris may require glycerol, methanol, and trace mineral feeds, but only simple ammonium (nitrogen) salts for optimal growth and expression. See, e.g., U.S. Patent No. 5,324,639; Elliott et al., J. PROTEIN CHE . (1990) 9:95; and Fieschko et al., BIOTECH. BIOENG. (1987) 29: 1 1 13, incorporated by reference herein.
[00375] Such fermentation methods, however, may have certain common features independent of the yeast host strain employed. For example, a growth limiting nutrient, typically carbon, may be added to the fermentor during the amplification phase to allow maximal growth. In addition, fermentation methods generally employ a fermentation medium designed to contain adequate amounts of carbon, nitrogen, basal salts, phosphorus, and other minor nutrients (vitamins, trace minerals and salts, etc.). Examples of fermentation media suitable for use with Pichia are described in U.S. Patent Nos. 5,324,639 and 5,231 ,178, which are incorporated by reference herein.
[00376] Baculovirus-Infected Insect Cells The term "insect host" or "insect host cell" refers to a insect that can be, or has been, used as a recipient for recombinant vectors or other transfer DNA. The term includes the progeny of the original insect host cell that has been transfected. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement to the original parent, due to accidental or deliberate mutation. Progeny of the parental cell that are sufficiently similar to the parent to be characterized by the relevant property, such as the presence of a nucleotide sequence encoding PSMC, are included in the progeny intended by this definition.
[00377] The selection of suitable insect cells for expression of PSMC is well known to those of ordinary skill in the art. Several insect species are well described in the art and are commercially available including Aedes aegypti, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusia ni. In selecting insect hosts for expression, suitable hosts may include those shown to have, inter alia, good secretion capacity, low proteolytic activity, and overall robustness. Insect are generally available from a variety of sources including, but not limited to, the Insect Genetic Stock Center, Department of Biophysics and Medical Physics, University of California (Berkeley, CA); and the American Type Culture Collection ("ATCC") (Manassas, VA).
[00378] Generally, the components of a baculovirus-infected insect expression system include a transfer vector, usually a bacterial plasmid, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene to be expressed; a wild type baculovirus with sequences homologous to the baculovirus-specific fragment in the transfer vector (this allows for the homologous recombination of the heterologous gene in to the baculovirus genome); and appropriate insect host cells and growth media. The materials, methods and techniques used in constructing vectors, transfecting cells, picking plaques, growing cells in culture, and the like are known in the art and manuals are available describing these techniques.
[00379] After inserting the heterologous gene into the transfer vector, the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome recombine. The packaged recombinant virus is expressed and recombinant plaques are identified and purified. Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, for example, Invitrogen Corp. (Carlsbad, CA). These techniques are generally known to those skilled in the art and fully described in SUMMERS AND SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN No. 1555 (1987), herein incorporated by reference. See also, RICHARDSON, 39 METHODS IN MOLECULAR BIOLOGY: BACULOVIRUS EXPRESSION PROTOCOLS ( 1995); AUSUBEL ET AL., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY 16.9-16.1 1 (1994); KING AND POSSEE, THE BACULOVIRUS SYSTEM: A LABORATORY GUIDE (1992); and O'REILLY ET AL., BACULOVIRUS EXPRESSION VECTORS: A LABORATORY MANUAL (1992).
[00380] Indeed, the production of various heterologous proteins using baculovirus/insect cell expression systems is well known in the art. See, e.g., U.S. Patent
Nos. 6,368,825 ; 6,342,216; 6,338,846; 6,261 ,805; 6,245,528, 6,225,060; 6, 183,987; 6, 168,932; 6, 126,944; 6,096,304; 6,013,433 ; 5,965,393 ; 5,939,285 ; 5,891 ,676; 5,871 ,986;
5,861 ,279; 5,858,368; 5,843,733 ; 5,762,939; 5,753,220; 5,605,827; 5,583,023 ; 5,571 ,709;
5,516,657; 5,290,686; WO 02/06305 ; WO 01/90390; WO 01/27301 ; WO 01/05956;
WO 00/55345; WO 00/20032 WO 99/5 1721 ; WO 99/45 130; WO 99/3 1257; WO 99/10515;
WO 99/09193 ; WO 97/26332; WO 96/29400; WO 96/25496; WO 96/06161 ; WO 95/20672; WO 93/03 173 ; WO 92/16619; WO 92/03628; WO 92/01801 ; WO 90/14428; WO 90/10078;
WO 90/02566; WO 90/021 86; WO 90/01556; WO 89/01038; WO 89/01037; WO 88/07082, which are incorporated by reference herein.
[00381] Vectors that are useful in baculovirus/insect cell expression systems are known in the art and include, for example, insect expression and transfer vectors derived from the baculovirus Autographacalifornica nuclear polyhedrosis virus (AcNPV), which is a helper-independent, viral expression vector. Viral expression vectors derived from this system usually use the strong viral polyhedrin gene promoter to drive expression of heterologous genes. See generally, Reilly ET AL., BACULOVIRUS EXPRESSION VECTORS: A LABORATORY MANUAL (1992).
[00382] Prior to inserting the foreign gene into the baculovirus genome, the above- described components, comprising a promoter, leader (if desired), coding sequence of interest, and transcription termination sequence, are typically assembled into an intermediate transplacement construct (transfer vector). Intermediate transplacement constructs are often maintained in a replicon, such as an extra chromosomal element (e.g., plasmids) capable of stable maintenance in a host, such as bacteria. The replicon will have a replication system, thus allowing it to be maintained in a suitable host for cloning and amplification. More specifically, the plasmid may contain the polyhedrin polyadenylation signal (Miller et al., ANN. REV. MICROBIOL. (1988) 42: 177) and a prokaryotic ampicillin-resistance {amp) gene and origin of replication for selection and propagation in E. coli.
[00383] One commonly used transfer vector for introducing foreign genes into AcNPV is pAc373. Many other vectors, known to those of skill in the art, have also been designed including, for example, pVL985, which alters the polyhedrin start codon from ATG to ATT, and which introduces a BamHI cloning site 32 base pairs downstream from the ATT. See Luckow and Summers, 17 VIROLOGY 31 (1989). Other commercially available vectors include, for example, PBlueBac4.5/V5-His; pBlueBacHis2; pMelBac; pBlueBac4.5 (Invitrogen Corp., Carlsbad, CA).
[00384] After insertion of the heterologous gene, the transfer vector and wild type baculoviral genome are co-transfected into an insect cell host. Methods for introducing heterologous DNA into the desired site in the baculovirus virus are known in the art. See SUMMERS AND SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN NO. 1555 (1987); Smith et al., MOL. CELL. BIOL. (1983) 3:2156; Luckow and Summers, VIROLOGY (1989) 17:31. For example, the insertion can be into a gene such as the polyhedrin gene, by homologous double crossover recombination; insertion can also be into a restriction enzyme site engineered into the desired baculovirus gene. See Miller et al., BiOESSAYS (1989) 4:91.
[00385] Transfection may be accomplished by electroporation. See TROTTER AND WOOD, 39 METHODS IN MOLECULAR BIOLOGY (1995); Mann and King, J. GEN. VIROL. (1989) 70:3501. Alternatively, liposomes may be used to transfect the insect cells with the recombinant expression vector and the baculovirus. See, e.g., Liebman et al., BIOTECHNIQUES (1999) 26(1):36; Graves et al., BIOCHEMISTRY (1998) 37:6050; Nomura et al., J. BIOL. CHEM. (1998) 273(22): 13570; Schmidt et al., PROTEIN EXPRESSION AND PURIFICATION (1998) 12:323; Siffert et al., NATURE GENETICS (1998) 18:45; TILKINS ET AL., CELL BIOLOGY: A LABORATORY HANDBOOK 145-154 (1998); Cai et al., PROTEIN EXPRESSION AND PURIFICATION (1997) 10:263; Dolphin et al., NATURE GENETICS (1997) 17:491 ; Kost et al., GENE (1997) 190: 139; Jakobsson et al., J. BIOL. CHEM. (1996) 271 :22203; Rowles et al., J. BIOL. CHEM. (1996) 271(37):22376; Reversey et al., J. BIOL. CHEM. (1996) 271(39):23607- 10; Stanley et al., J. BIOL. CHEM. (1995) 270:4121 ; Sisk et al., J. VIROL. (1994) 68(2):766; and Peng et al., BIOTECHNIQUES (1993) 14.2:274. Commercially available liposomes include, for example, Cellfectin® and Lipofectin® (Invitrogen, Corp., Carlsbad, CA). In addition, calcium phosphate transfection may be used. See TROTTER AND WOOD, 39 METHODS IN MOLECULAR BIOLOGY (1995); Kitts, NAR (1990) 18(19):5667; and Mann and King, J. GEN. VIROL. (1989) 70:3501.
[00386] Baculovirus expression vectors usually contain a baculovirus promoter. A baculovirus promoter is any DNA sequence capable of binding a baculovirus R A polymerase and initiating the downstream (3') transcription of a coding sequence (e.g., structural gene) into mRNA. A promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region typically includes an RNA polymerase binding site and a transcription initiation site. A baculovirus promoter may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene. Moreover, expression may be either regulated or constitutive.
[00387] Structural genes, abundantly transcribed at late times in the infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein (FRIESEN ET AL., The Regulation of Baculovirus Gene Expression in THE MOLECULAR BIOLOGY OF BACULOVIRUSES (1986); EP 0 127 839 and 0 155 476) and the gene encoding the plO protein (Vlak et al., J. GEN. VIROL. (1988) 69:765).
[00388] The newly formed baculovirus expression vector is packaged into an infectious recombinant baculovirus and subsequently grown plaques may be purified by techniques known to those skilled in the art. See Miller et al., BiOESSAYS (1989) 4:91 ; SUMMERS AND SMITH, TEXAS AGRICULTURAL EXPERIMENT STATION BULLETIN NO. 1555 (1987).
[00389] Recombinant baculovirus expression vectors have been developed for infection into several insect cells. For example, recombinant baculoviruses have been developed for, inter alia, Aedes aegypti (ATCC No. CCL-125), Bombyx mori (ATCC No. CRL-8910), Drosophila melanogaster (ATCC No. 1963), Spodoptera frugiperda, and Trichoplusia ni. See WO 89/046,699; Wright, NATURE (1986) 321 :718; Carbonell et al., J. VIROL. (1985) 56: 153; Smith et al., MoL. CELL. BIOL. (1983) 3 :2156. See generally, Fraser et al., IN VITRO CELL. DEV. BIOL. (1989) 25:225. More specifically, the cell lines used for baculovirus expression vector systems commonly include, but are not limited to, Sf9 {Spodoptera frugiperda) (ATCC No. CRL-171 1 ), Sf21 {Spodoptera frugiperda) (Invitrogen Corp., Cat. No. 1 1497-013 (Carlsbad, CA)), Tri-368 {Trichopulsia ni), and High-Five™ BTI- TN-5B 1 -4 {Trichopulsia ni).
[00390] Cells and culture media are commercially available for both direct and fusion expression of heterologous polypeptides in a baculovirus/expression, and cell culture technology is generally known to those skilled in the art.
[00391] E. Coli, Pseudomonas species, and other Prokaryotes Bacterial expression techniques are well known in the art. A wide variety of vectors are available for use in bacterial hosts. The vectors may be single copy or low or high multicopy vectors. Vectors may serve for cloning and/or expression. In view of the ample literature concerning vectors, commercial availability of many vectors, and even manuals describing vectors and their restriction maps and characteristics, no extensive discussion is required here. As is well- known, the vectors normally involve markers allowing for selection, which markers may provide for cytotoxic agent resistance, prototrophy or immunity. Frequently, a plurality of markers is present, which provide for different characteristics.
[00392] A bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3') transcription of a coding sequence (e.g. structural gene) into mRNA. A promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region typically includes an RNA polymerase binding site and a transcription initiation site.
A bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) transcription, as a gene repressor protein may bind the operator and thereby inhibit transcription of a specific gene. Constitutive expression may occur in the absence of negative regulatory elements, such as the operator. In addition, positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5') to the RNA polymerase binding sequence. An example of a gene activator protein is the catabolite activator protein (CAP), which helps initiate transcription of the lac operon in Escherichia coli (E. coli) [Raibaud et al., ANNU. REV. GENET. (1984) 18: 173]. Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
[00393] Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac) [Chang et al., NATURE (1977) 198: 1056], and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al., Nuc. ACIDS RES. (1980) 8:4057; Yelverton et al., NUCL. ACIDS RES. (1981) 9:731 ; U.S. Pat. No. 4,738,921 ; EP Pub. Nos. 036 776 and 121 775, which are incorporated by reference herein]. The β-galactosidase (bla) promoter system [Weissmann (1981) "The cloning of interferon and other mistakes." In Interferon 3 (Ed. I. Gresser)], bacteriophage lambda PL [Shimatake et al., NATURE (1981) 292: 128] and T5 [U.S. Pat. No. 4,689,406, which are incorporated by reference herein] promoter systems also provide useful promoter sequences. Preferred methods of the present invention utilize strong promoters, such as the T7 promoter to induce PSMC at high levels. Examples of such vectors are well known in the art and include the pET29 series from Novagen, and the pPOP vectors described in WO99/05297, which is incorporated by reference herein. Such expression systems produce high levels of PSMC in the host without compromising host cell viability or growth parameters. pET19 (Novagen) is another vector known in the art.
[00394] In addition, synthetic promoters which do not occur in nature also function as bacterial promoters. For example, transcription activation sequences of one bacterial or bacteriophage promoter may be joined with the operon sequences of another bacterial or bacteriophage promoter, creating a synthetic hybrid promoter [U.S. Pat. No. 4,551 ,433, which is incorporated by reference herein]. For example, the tac promoter is a hybrid trp-lac promoter comprised of both tip promoter and lac operon sequences that is regulated by the
lac repressor [Amann et al., GENE (1983) 25: 167; de Boer et al., PROC. NATL. ACAD. SCI. (1983) 80:21]. Furthermore, a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription. A naturally occurring promoter of non-bacterial origin can also be coupled with a compatible RNA polymerase to produce high levels of expression of some genes in prokaryotes. The bacteriophage T7 RNA polymerase/promoter system is an example of a coupled promoter system [Studier et al., J. MOL. BIOL. (1986) 189: 1 13; Tabor et al., Proc Natl. Acad. Sci. (1985) 82: 1074]. In addition, a hybrid promoter can also be comprised of a bacteriophage promoter and an E. coli operator region (EP Pub. No. 267 851).
[00395] In addition to a functioning promoter sequence, an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes. In E. coli, the ribosome binding site is called the Shine-Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-1 1 nucleotides upstream of the initiation codon [Shine et al., NATURE (1975) 254:34]. The SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD sequence and the 3' and of E. coli 16S rRNA [Steitz et al. "Genetic signals and nucleotide sequences in messenger RNA", In Biological Regulation and Development: Gene Expression (Ed. R. F. Goldberger, 1979)]. To express eukaryotic genes and prokaryotic genes with weak ribosome- binding site [Sambrook et al. "Expression of cloned genes in Escherichia coli", Molecular Cloning: A Laboratory Manual, 1989].
[00396] The term "bacterial host" or "bacterial host cell" refers to a bacterial that can be, or has been, used as a recipient for recombinant vectors or other transfer DNA. The term includes the progeny of the original bacterial host cell that has been transfected. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement to the original parent, due to accidental or deliberate mutation. Progeny of the parental cell that are sufficiently similar to the parent to be characterized by the relevant property, such as the presence of a nucleotide sequence encoding PSMC, are included in the progeny intended by this definition.
[00397] The selection of suitable host bacteria for expression of PSMC is well known to those of ordinary skill in the art. In selecting bacterial hosts for expression, suitable hosts may include those shown to have, inter alia, good inclusion body formation capacity, low proteolytic activity, and overall robustness. Bacterial hosts are generally available from a variety of sources including, but not limited to, the Bacterial Genetic Stock Center,
Department of Biophysics and Medical Physics, University of California (Berkeley, CA); and the American Type Culture Collection ("ATCC") (Manassas, VA). Industrial/pharmaceutical fermentation generally use bacterial derived from K strains (e.g. W31 10) or from bacteria derived from B strains (e.g. BL21). These strains are particularly useful because their growth parameters are extremely well known and robust. In addition, these strains are nonpathogenic, which is commercially important for safety and environmental reasons. In one embodiment of the methods of the present invention, the E. coli host is a strain of BL21. In another embodiment of the methods of the present invention, the E. coli host is a protease minus strain including, but not limited to, OMP- and LON-. In another embodiment of the methods of the present invention, the host cell strain is a species of Pseudomonas, including but not limited to, Pseudomonas fluorescens, Pseudomonas aeruginosa, and Pseudomonas putida. Pseudomonas fluorescens biovar 1 , designated strain MB101 , is known to be useful for recombinant production and is available for therapeutic protein production processes. An example of a Pseudomonas expression system includes the system available from The Dow Chemical Company as a host strain (Midland, MI available on the World Wide Web at dow.com). U.S. Patent Nos. 4,755,465 and 4,859,600, which are incorporated by reference herein, describes the use of Pseudomonas strains as a host cell for human growth hormone production.
[00398] Once a recombinant host cell strain has been established (i.e., the expression construct has been introduced into the host cell and host cells with the proper expression construct are isolated), the recombinant host cell strain is cultured under conditions appropriate for production of PSMC. As will be apparent to one of skill in the art, the method of culture of the recombinant host cell strain will be dependent on the nature of the expression construct utilized and the identity of the host cell. Recombinant host strains are normally cultured using methods that are well known to the art. Recombinant host cells are typically cultured in liquid medium containing assimilatable sources of carbon, nitrogen, and inorganic salts and, optionally, containing vitamins, amino acids, growth factors, and other proteinaceous culture supplements well known to the art. Liquid media for culture of host cells may optionally contain antibiotics or anti-fungals to prevent the growth of undesirable microorganisms and/or compounds including, but not limited to, antibiotics to select for host cells containing the expression vector.
[00399] Recombinant host cells may be cultured in batch or continuous formats, with either cell harvesting (in the case where the PSMC accumulates intracellularly) or harvesting
of culture supernatant in either batch or continuous formats. For production in prokaryotic host cells, batch culture and cell harvest are preferred.
[00400] The antigen-binding polypeptides of the present invention are normally purified after expression in recombinant systems. The PSMC may be purified from host cells by a variety of methods known to the art. Normally, PSMC produced in bacterial host cells is poorly soluble or insoluble (in the form of inclusion bodies). In one embodiment of the present invention, amino acid substitutions may readily be made in the antigen-binding polypeptide that are selected for the purpose of increasing the solubility of the recombinantly produced protein utilizing the methods disclosed herein as well as those known in the art. In the case of insoluble protein, the protein may be collected from host cell lysates by centrifugation and may further be followed by homogenization of the cells. In the case of poorly soluble protein, compounds including, but not limited to, polyethylene imine (PEI) may be added to induce the precipitation of partially soluble protein. The precipitated protein may then be conveniently collected by centrifugation. Recombinant host cells may be disrupted or homogenized to release the inclusion bodies from within the cells using a variety of methods well known to those of ordinary skill in the art. Host cell disruption or homogenization may be performed using well known techniques including, but not limited to, enzymatic cell disruption, sonication, dounce homogenization, or high pressure release disruption. In one embodiment of the method of the present invention, the high pressure release technique is used to disrupt the E. coli host cells to release the inclusion bodies of PSMC. When handling inclusion bodies of PSMC, it is advantageous to minimize the homogenization time on repetitions in order to maximize the yield of inclusion bodies without loss due to factors such as solubilization, mechanical shearing or proteolysis.
[00401] Insoluble or precipitated PSMC may then be solubilized using any of a number of suitable solubilization agents known to the art. Preferably, PSMC is solubilized with urea or guanidine hydrochloride. The volume of the solubilized PSMC should be minimized so that large batches may be produced using conveniently manageable batch sizes. This factor may be significant in a large-scale commercial setting where the recombinant host may be grown in batches that are thousands of liters in volume. In addition, when manufacturing PSMC in a large-scale commercial setting, in particular for human pharmaceutical uses, the avoidance of harsh chemicals that can damage the machinery and container, or the protein product itself, should be avoided, if possible. It has been shown in the method of the present invention that the milder denaturing agent urea can be used to
solubilize the PSMC inclusion bodies in place of the harsher denaturing agent guanidine hydrochloride. The use of urea significantly reduces the risk of damage to stainless steel equipment utilized in the manufacturing and purification process of PSMC while efficiently solubilizing the PSMC inclusion bodies.
[00402] In the case of soluble PSMC, PSMC may be secreted into the periplasmic space or into the culture medium. In addition, soluble PSMC may be present in the cytoplasm of the host cells. It may be desired to concentrate soluble PSMC prior to performing purification steps. Standard techniques known to those skilled in the art may be used to concentrate soluble PSMC from, for example, cell lysates or culture medium. In addition, standard techniques known to those skilled in the art may be used to disrupt host cells and release soluble PSMC from the cytoplasm or periplasmic space of the host cells.
[00403] When PSMC is produced as a fusion protein, the fusion sequence is preferably removed. Removal of a fusion sequence may be accomplished by enzymatic or chemical cleavage, preferably by enzymatic cleavage. Enzymatic removal of fusion sequences may be accomplished using methods well known to those in the art. The choice of enzyme for removal of the fusion sequence will be determined by the identity of the fusion, and the reaction conditions will be specified by the choice of enzyme as will be apparent to one skilled in the art. The cleaved PSMC is preferably purified from the cleaved fusion sequence by well known methods. Such methods will be determined by the identity and properties of the fusion sequence and the PSMC, as will be apparent to one skilled in the art. Methods for purification may include, but are not limited to, size-exclusion chromatography, hydrophobic interaction chromatography, ion-exchange chromatography or dialysis or any combination thereof.
[00404] The PSMC is also preferably purified to remove DNA from the protein solution. DNA may be removed by any suitable method known to the art, such as precipitation or ion exchange chromatography, but is preferably removed by precipitation with a nucleic acid precipitating agent, such as, but not limited to, protamine sulfate. PSMC may be separated from the precipitated DNA using standard well known methods including, but not limited to, centrifugation or filtration. Removal of host nucleic acid molecules is an important factor in a setting where the PSMC is to be used to treat humans and the methods of the present invention reduce host cell DNA to pharmaceutically acceptable levels.
[00405] Methods for small-scale or large-scale fermentation can also be used in protein expression, including but not limited to, fermentors, shake flasks, fluidized bed bioreactors,
hollow fiber bioreactors, roller bottle culture systems, and stirred tank bioreactor systems. Each of these methods can be performed in a batch, fed-batch, or continuous mode process.
[00406] Huma PSMC of the invention can generally be recovered using methods standard in the art. For example, culture medium or cell lysate can be centrifuged or filtered to remove cellular debris. The supernatant may be concentrated or diluted to a desired volume or diafiltered into a suitable buffer to condition the preparation for further purification. Further purification of the PSMC of the present invention include separating deamidated and clipped forms of the PSMC variant from the intact form.
[00407] Any of the following exemplary procedures can be employed for purification of antigen-binding polypeptides of the invention: affinity chromatography; anion- or cation- exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse phase HPLC; gel filtration (using, including but not limited to, SEPHADEX G-75); hydrophobic interaction chromatography; size-exclusion chromatography, metal-chelate chromatography; ultrafiltration/diafiltration; ethanol precipitation; ammonium sulfate precipitation; chromatofocusing; displacement chromatography; electrophoretic procedures (including but not limited to preparative isoelectric focusing), differential solubility (including but not limited to ammonium sulfate precipitation), SDS-PAGE, or extraction.
[00408] Proteins of the present invention, including but not limited to, proteins comprising unnatural amino acids, antibodies to proteins comprising unnatural amino acids, binding partners for proteins comprising unnatural amino acids, etc., can be purified, either partially or substantially to homogeneity, according to standard procedures known to and used by those of skill in the art. Accordingly, polypeptides of the invention can be recovered and purified by any of a number of methods well known in the art, including but not limited to, ammonium sulfate or ethanol precipitation, acid or base extraction, column chromatography, affinity column chromatography, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, hydroxylapatite chromatography, lectin chromatography, gel electrophoresis and the like. Protein refolding steps can be used, as desired, in making correctly folded mature proteins. High performance liquid chromatography (HPLC), affinity chromatography or other suitable methods can be employed in final purification steps where high purity is desired. In one embodiment, antibodies made against unnatural amino acids (or proteins comprising unnatural amino acids) are used as purification reagents, including but
not limited to, for affinity-based purification of proteins comprising one or more unnatural amino acid(s). Once purified, partially or to homogeneity, as desired, the polypeptides are optionally used for a wide variety of utilities, including but not limited to, as assay components, therapeutics, prophylaxis, diagnostics, research reagents, and/or as immunogens for antibody production.
[00409] In addition to other references noted herein, a variety of purification/protein folding methods are well known in the art, including, but not limited to, those set forth in R. Scopes, Protein Purification, Springer-Verlag, N.Y. (1982); Deutscher, Methods in Enzvmology Vol. 182: Guide to Protein Purification, Academic Press, Inc. N.Y. (1990); Sandana, (1997) Bioseparation of Proteins, Academic Press, Inc.; Bollag et al. (1996) Protein Methods. 2nd Edition Wiley-Liss, NY; Walker, (1996) The Protein Protocols Handbook Humana Press, NJ, Harris and Angal, (1990) Protein Purification Applications: A Practical Approach IRL Press at Oxford, Oxford, England; Harris and Angal, Protein Purification Methods: A Practical Approach IRL Press at Oxford, Oxford, England; Scopes, (1993) Protein Purification: Principles and Practice 3rd Edition Springer Verlag, NY; Janson and Ryden, (1998) Protein Purification: Principles, High Resolution Methods and Applications, Second Edition Wiley-VCH, NY; and Walker (1998), Protein Protocols on CD-ROM Humana Press, NJ; and the references cited therein.
[00410] One advantage of producing a protein or polypeptide of interest with an unnatural amino acid in a eukaryotic host cell or non-eukaryotic host cell is that typically the proteins or polypeptides will be folded in their native conformations. However, in certain embodiments of the invention, those of skill in the art will recognize that, after synthesis, expression and/or purification, proteins can possess a conformation different from the desired conformations of the relevant polypeptides. In one aspect of the invention, the expressed protein is optionally denatured and then renatured. This is accomplished utilizing methods known in the art, including but not limited to, by adding a chaperonin to the protein or polypeptide of interest, by solubilizing the proteins in a chaotropic agent such as guanidine HC1, utilizing protein disulfide isomerase, etc.
[00411] In general, it is occasionally desirable to denature and reduce expressed polypeptides and then to cause the polypeptides to re-fold into the preferred conformation. For example, guanidine, urea, DTT, DTE, and/or a chaperonin can be added to a translation product of interest. Methods of reducing, denaturing and renaturing proteins are well known to those of skill in the art (see, the references above, and Debinski, et al. (1993) J. Biol.
Chem.. 268: 14065-14070; reitman and Pastan (1993) Bioconiug. Chem., 4: 581-585; and Buchner, et al., (1992) Anal. Biochem.. 205: 263-270). Debinski, et al., for example, describe the denaturation and reduction of inclusion body proteins in guanidine-DTE. The proteins can be refolded in a redox buffer containing, including but not limited to, oxidized glutathione and L-arginine. Refolding reagents can be flowed or otherwise moved into contact with the one or more polypeptide or other expression product, or vice-versa.
[00412] In the case of prokaryotic production of PSMC, PSMC thus produced may be misfolded and thus lacks or has reduced biological activity. The bioactivity of the protein may be restored by "refolding". In general, misfolded PSMC is refolded by solubilizing (where the PSMC is also insoluble), unfolding and reducing the polypeptide chain using, for example, one or more chaotropic agents (e.g. urea and/or guanidine) and a reducing agent capable of reducing disulfide bonds (e.g. dithiothreitol, DTT or 2-mercaptoethanol, 2-ME). At a moderate concentration of chaotrope, an oxidizing agent is then added (e.g., oxygen, cystine or cystamine), which allows the reformation of disulfide bonds. PSMC may be refolded using standard methods known in the art, such as those described in U.S. Pat. Nos. 4,511,502, 4,51 1,503, and 4,512,922, which are incorporated by reference herein. The PSMC may also be cofolded with other proteins to form heterodimers or heteromultimers. After refolding or cofolding, the PSMC is preferably further purified.
[00413] General Purification Methods Any one of a variety of isolation steps may be performed on the cell lysate comprising PSMC or on any PSMC mixtures resulting from any isolation steps including, but not limited to, affinity chromatography, ion exchange chromatography, hydrophobic interaction chromatography, gel filtration chromatography, high performance liquid chromatography ("HPLC"), reversed phase-HPLC ("RP-HPLC"), expanded bed adsorption, or any combination and/or repetition thereof and in any appropriate order.
[00414] Equipment and other necessary materials used in performing the techniques described herein are commercially available. Pumps, fraction collectors, monitors, recorders, and entire systems are available from, for example, Applied Biosystems (Foster City, CA), Bio-Rad Laboratories, Inc. (Hercules, CA), and Amersham Biosciences, Inc. (Piscataway, NJ). Chromatographic materials including, but not limited to, exchange matrix materials, media, and buffers are also available from such companies.
[00415] Equilibration, and other steps in the column chromatography processes described herein such as washing and elution, may be more rapidly accomplished using
specialized equipment such as a pump. Commercially available pumps include, but are not limited to, HILOAD® Pump P-50, Peristaltic Pump P-l , Pump P-901 , and Pump P-903 (Amersham Biosciences, Piscataway, NJ).
[00416] Examples of fraction collectors include RediFrac Fraction Collector, FRAC- 100 and FRAC-200 Fraction Collectors, and SUPERFRAC® Fraction Collector (Amersham Biosciences, Piscataway, NJ). Mixers are also available to form pH and linear concentration gradients. Commercially available mixers include Gradient Mixer GM-1 and In-Line Mixers (Amersham Biosciences, Piscataway, NJ).
[00417] The chromatographic process may be monitored using any commercially available monitor. Such monitors may be used to gather information like UV, pH, and conductivity. Examples of detectors include Monitor UV-1, UVICORD® S II, Monitor UV- M II, Monitor UV-900, Monitor UPC-900, Monitor pH/C-900, and Conductivity Monitor (Amersham Biosciences, Piscataway, NJ). Indeed, entire systems are commercially available including the various AKTA® systems from Amersham Biosciences (Piscataway, NJ).
[00418] In one embodiment of the present invention, for example, the PSMC may be reduced and denatured by first denaturing the resultant purified PSMC in urea, followed by dilution into TRIS buffer containing a reducing agent (such as DTT) at a suitable pH. In another embodiment, the PSMC is denatured in urea in a concentration range of between about 2 M to about 9 M, followed by dilution in TRIS buffer at a pH in the range of about 5.0 to about 8.0. The refolding mixture of this embodiment may then be incubated. In one embodiment, the refolding mixture is incubated at room temperature for four to twenty-four hours. The reduced and denatured PSMC mixture may then be further isolated or purified.
[00419] As stated herein, the pH of the first PSMC mixture may be adjusted prior to performing any subsequent isolation steps. In addition, the first PSMC mixture or any subsequent mixture thereof may be concentrated using techniques known in the art. Moreover, the elution buffer comprising the first PSMC mixture or any subsequent mixture thereof may be exchanged for a buffer suitable for the next isolation step using techniques well known to those of ordinary skill in the art.
[00420] Ion Exchange Chromatography In one embodiment, and as an optional, additional step, ion exchange chromatography may be performed on the first PSMC mixture. See generally ION EXCHANGE CHROMATOGRAPHY: PRINCIPLES AND METHODS (Cat. No. 18- 1 1 14-21, Amersham Biosciences (Piscataway, NJ)). Commercially available ion exchange columns include HITRAP®, HIPREP®, and HILOAD® Columns (Amersham Biosciences,
Piscataway, NJ). Such columns utilize strong anion exchangers such as Q SEPHAROSE Fast Flow, Q SEPHAROSE® High Performance, and Q SEPHAROSE® XL; strong cation exchangers such as SP SEPHAROSE® High Performance, SP SEPHAROSE® Fast Flow, and SP SEPHAROSE® XL; weak anion exchangers such as DEAE SEPHAROSE® Fast Flow; and weak cation exchangers such as CM SEPHAROSE® Fast Flow (Amersham Biosciences, Piscataway, NJ). Anion or cation exchange column chromatography may be performed on the PSMC at any stage of the purification process to isolate substantially purified PSMC. The cation exchange chromatography step may be performed using any suitable cation exchange matrix. Useful cation exchange matrices include, but are not limited to, fibrous, porous, non-porous, microgranular, beaded, or cross-linked cation exchange matrix materials. Such cation exchange matrix materials include, but are not limited to, cellulose, agarose, dextran, polyacrylate, polyvinyl, polystyrene, silica, polyether, or composites of any of the foregoing.
[00421] The cation exchange matrix may be any suitable cation exchanger including strong and weak cation exchangers. Strong cation exchangers may remain ionized over a wide pH range and thus, may be capable of binding PSMC over a wide pH range. Weak cation exchangers, however, may lose ionization as a function of pH. For example, a weak cation exchanger may lose charge when the pH drops below about pH 4 or pH 5. Suitable strong cation exchangers include, but are not limited to, charged functional groups such as sulfopropyl (SP), methyl sulfonate (S), or sulfoethyl (SE). The cation exchange matrix may be a strong cation exchanger, preferably having a PSMC binding pH range of about 2.5 to about 6.0. Alternatively, the strong cation exchanger may have a PSMC binding pH range of about pH 2.5 to about pH 5.5. The cation exchange matrix may be a strong cation exchanger having a PSMC binding pH of about 3.0. Alternatively, the cation exchange matrix may be a strong cation exchanger, preferably having a PSMC binding pH range of about 6.0 to about 8.0. The cation exchange matrix may be a strong cation exchanger preferably having a PSMC binding pH range of about 8.0 to about 12.5. Alternatively, the strong cation exchanger may have an PSMC binding pH range of about pH 8.0 to about pH 12.0.
[00422] Prior to loading the PSMC, the cation exchange matrix may be equilibrated, for example, using several column volumes of a dilute, weak acid, e.g., four column volumes of 20 mM acetic acid, pH 3. Following equilibration, the PSMC may be added and the column may be washed one to several times, prior to elution of substantially purified PSMC, also using a weak acid solution such as a weak acetic acid or phosphoric acid solution. For
example, approximately 2-4 column volumes of 20 mM acetic acid, pH 3, may be used to wash the column. Additional washes using, e.g., 2-4 column volumes of 0.05 M sodium acetate, pH 5.5, or 0.05 M sodium acetate mixed with 0.1 M sodium chloride, pH 5.5, may also be used. Alternatively, using methods known in the art, the cation exchange matrix may be equilibrated using several column volumes of a dilute, weak base.
[00423] Alternatively, substantially purified PSMC may be eluted by contacting the cation exchanger matrix with a buffer having a sufficiently low pH or ionic strength to displace the PSMC from the matrix. The pH of the elution buffer may range from about pH 2.5 to about pH 6.0. More specifically, the pH of the elution buffer may range from about pH 2.5 to about pH 5.5, about pH 2.5 to about pH 5.0. The elution buffer may have a pH of about 3.0. In addition, the quantity of elution buffer may vary widely and will generally be in the range of about 2 to about 10 column volumes. Moreover, suitable buffers known to those of skill in the art may find use herein including, but not limited to, citrate, phosphate, formate, HEPES, and MES buffers ranging in concentration from at least about 5 mM to at least about 100 mM.
[00424] Following adsorption of the PSMC polypeptide to the cation exchanger matrix, substantially purified PSMC polypeptide may be eluted by contacting the matrix with a buffer having a sufficiently high pH or ionic strength to displace the PSMC from the matrix. Suitable buffers for use in high pH elution of substantially purified PSMC may include, but are not limited to, citrate, phosphate, formate, acetate, HEPES, and MES buffers ranging in concentration from at least about 5 mM to at least about 100 mM.
[00425] Reverse-Phase Chromatography RP-HPLC may be performed to purify proteins following suitable protocols that are known to those of ordinary skill in the art. See, e.g., Pearson et al., ANAL BIOCHEM. (1982) 124:217-230 (1982); Rivier et al., J. CHROM. (1983) 268: 1 12-1 19; Kunitani et al., J. CHROM. (1986) 359:391-402. RP-HPLC may be performed on the PSMC to isolate substantially purified PSMC. In this regard, silica derivatized resins with alkyl functionalities with a wide variety of lengths, including, but not limited to, at least about C3 to at least about C30, at least about C3 to at least about C20, or at least about C3 to at least about C18, resins may be used. Alternatively, a polymeric resin may be used. For example, TosoHaas Amberchrome CGlOOOsd resin may be used, which is a styrene polymer resin. Cyano or polymeric resins with a wide variety of alkyl chain lengths may also be used. Furthermore, the RP-HPLC column may be washed with a solvent such as ethanol. The Source RP column is another example of a RP-HPLC column.
[00426] A suitable elution buffer containing an ion pairing agent and an organic modifier such as methanol, isopropanol, tetrahydrofuran, acetonitrile or ethanol, may be used to elute the PSMC from the RP-HPLC column. The most commonly used ion pairing agents include, but are not limited to, acetic acid, formic acid, perchloric acid, phosphoric acid, trifluoroacetic acid, heptafluorobutyric acid, triethylamine, tetramethylammonium, tetrabutylammonium, and triethylammonium acetate. Elution may be performed using one or more gradients or isocratic conditions, with gradient conditions preferred to reduce the separation time and to decrease peak width. Another method involves the use of two gradients with different solvent concentration ranges. Examples of suitable elution buffers for use herein may include, but are not limited to, ammonium acetate and acetonitrile solutions.
[00427] Hydrophobic Interaction Chromatography Purification Techniques
Hydrophobic interaction chromatography (HIC) may be performed on the PSMC. See generally HYDROPHOBIC INTERACTION CHROMATOGRAPHY HANDBOOK: PRINCIPLES AND METHODS (Cat. No. 18-1020-90, Amersham Biosciences (Piscataway, NJ) which is incorporated by reference herein. Suitable HIC matrices may include, but are not limited to, alkyl- or aryl-substituted matrices, such as butyl-, hexyl-, octyl- or phenyl-substituted matrices including agarose, cross-linked agarose, sepharose, cellulose, silica, dextran, polystyrene, poly(methacrylate) matrices, and mixed mode resins, including but not limited to, a polyethyleneamine resin or a butyl- or phenyl-substituted poly(methacrylate) matrix. Commercially available sources for hydrophobic interaction column chromatography include, but are not limited to, HITRAP®, HIPREP®, and HILOAD® columns (Amersham Biosciences, Piscataway, NJ).
[00428] Briefly, prior to loading, the HIC column may be equilibrated using standard buffers known to those of ordinary skill in the art, such as an acetic acid/sodium chloride solution or HEPES containing ammonium sulfate. Ammonium sulfate may be used as the buffer for loading the HIC column. After loading the PSMC, the column may then washed using standard buffers and conditions to remove unwanted materials but retaining the PSMC on the HIC column. PSMC may be eluted with about 3 to about 10 column volumes of a standard buffer, such as a HEPES buffer containing EDTA and lower ammonium sulfate concentration than the equilibrating buffer, or an acetic acid/sodium chloride buffer, among others. A decreasing linear salt gradient using, for example, a gradient of potassium phosphate, may also be used to elute the PSMC molecules. The eluant may then be
concentrated, for example, by filtration such as diafiltration or ultrafiltration. Diafiltration may be utilized to remove the salt used to elute PSMC.
[00429] Other Purification Techniques Yet another isolation step using, for example, gel filtration (GEL FILTRATION: PRINCIPLES AND METHODS (Cat. No. 18-1022-18, Amersham Biosciences, Piscataway, NJ) which is incorporated by reference herein, hydroxyapatite chromatography (suitable matrices include, but are not limited to, HA-Ultrogel, High Resolution (Calbiochem), CHT Ceramic Hydroxyapatite (BioRad), Bio - Gel HTP Hydroxyapatite (BioRad)), HPLC, expanded bed adsorption, ultrafiltration, diafiltration, lyophilization, and the like, may be performed on the first PSMC mixture or any subsequent mixture thereof, to remove any excess salts and to replace the buffer with a suitable buffer for the next isolation step or even formulation of the final drug product.
[00430] The non-naturally encoded amino acid present in the PSMC may also be utilized to provide separation from other cellular proteins that do not contain the non- naturally encoded amino acid. Since the non-naturally encoded amino acid may comprise unique chemical functional groups, the coupling of the unique functional group to another molecule may provide a substantial purification step. For example, the non-naturally encoded amino acid may be coupled to another molecule that facilitates separation from other proteins. Such molecules for coupling to the non-natural amino acid include, but are not limited to, PEG and other polymers, beads, and other solid substances.
[00431] The yield of PSMC, including substantially purified PSMC, may be monitored at each step described herein using techniques known to those of ordinary skill in the art. Such techniques may also be used to assess the yield of substantially purified PSMC following the last isolation step. For example, the yield of PSMC may be monitored using any of several reverse phase high pressure liquid chromatography columns, having a variety of alkyl chain lengths such as cyano RP-HPLC, CigRP-HPLC; as well as cation exchange HPLC and gel filtration HPLC.
[00432] In specific embodiments of the present invention, the yield of PSMC after each purification step may be at least about 30%, at least about 35%>, at least about 40%>, at least about 45%>, at least about 50%>, at least about 55%>, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%), at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about
99%, at least about 99.9%, or at least about 99.99%, of the PSMC in the starting material for each purification step.
[00433] Purity may be determined using standard techniques, such as SDS-PAGE, or by measuring PSMC using Western blot and ELISA assays. For example, polyclonal antibodies may be generated against proteins isolated from negative control yeast fermentation and the cation exchange recovery. The antibodies may also be used to probe for the presence of contaminating host cell proteins.
[00434] RP-HPLC material Vydac C4 (Vydac) consists of silica gel particles, the surfaces of which carry C4-alkyl chains. The separation of PSMC from the proteinaceous impurities is based on differences in the strength of hydrophobic interactions. Elution is performed with an acetonitrile gradient in diluted trifluoroacetic acid. Preparative HPLC is performed using a stainless steel column (filled with 2.8 to 3.2 liter of Vydac C4 silicagel). The Hydroxyapatite Ultrogel eluate is acidified by adding trifluoroacetic acid and loaded onto the Vydac C4 column. For washing and elution an acetonitrile gradient in diluted trifluoroacetic acid is used. Fractions are collected and immediately neutralized with phosphate buffer. The PSMC fractions which are within the IPC limits are pooled.
[00435] DEAE Sepharose (Pharmacia) material consists of diethylaminoethyl (DEAE)- groups which are covalently bound to the surface of Sepharose beads. The binding of PSMC to the DEAE groups is mediated by ionic interactions. Acetonitrile and trifluoroacetic acid pass through the column without being retained. After these substances have been washed off, trace impurities are removed by washing the column with acetate buffer at a low pH. Then the column is washed with neutral phosphate buffer and PSMC is eluted with a buffer with increased ionic strength. The column is packed with DEAE Sepharose fast flow. The column volume is adjusted to assure a PSMC load in the range of 3-10 mg PSMC polypeptide/ml gel. The column is washed with water and equilibration buffer (sodium/potassium phosphate). The pooled fractions of the HPLC eluate are loaded and the column is washed with equilibration buffer. Then the column is washed with washing buffer (sodium acetate buffer) followed by washing with equilibration buffer. Subsequently, PSMC is eluted from the column with elution buffer (sodium chloride, sodium/potassium phosphate) and collected in a single fraction in accordance with the master elution profile. The eluate of the DEAE Sepharose column is adjusted to the specified conductivity. The resulting drug substance is sterile filtered into Teflon bottles and stored at -70°C.
[00436] Additional methods that may be employed include, but are not limited to, steps to remove endotoxins. Endotoxins are lipopoly-saccharides (LPSs) which are located on the outer membrane of Gram-negative host cells, such as, for example, Escherichia coli. Methods for reducing endotoxin levels are known to one skilled in the art and include, but are not limited to, purification techniques using silica supports, glass powder or hydroxyapatite, reverse-phase, affinity, size-exclusion, anion-exchange chromatography, hydrophobic interaction chromatography, a combination of these methods, and the like. Modifications or additional methods may be required to remove contaminants such as co-migrating proteins from the polypeptide of interest
[00437] A wide variety of methods and procedures can be used to assess the yield and purity of a PSMC protein one or more non-naturally encoded amino acids, including but not limited to, the Bradford assay, SDS-PAGE, silver stained SDS-PAGE, coomassie stained SDS-PAGE, mass spectrometry (including but not limited to, MALDI-TOF) and other methods for characterizing proteins known to one skilled in the art.
VIII. Expression in Alternate Systems
[00438] Several strategies have been employed to introduce unnatural amino acids into proteins in non-recombinant host cells, mutagenized host cells, or in cell-free systems. These systems are also suitable for use in making the antigen-binding polypeptides of the present invention. Derivatization of amino acids with reactive side-chains such as Lys, Cys and Tyr resulted in the conversion of lysine to N2-acetyl-lysine. Chemical synthesis also provides a straightforward method to incorporate unnatural amino acids. With the recent development of enzymatic ligation and native chemical ligation of peptide fragments, it is possible to make larger proteins. See, e.g., P. E. Dawson and S. B. H. Kent, Annu. Rev. Biochem, 69:923 (2000). A general in vitro biosynthetic method in which a suppressor tRNA chemically acylated with the desired unnatural amino acid is added to an in vitro extract capable of supporting protein biosynthesis, has been used to site-specifically incorporate over 100 unnatural amino acids into a variety of proteins of virtually any size. See, e.g., V. W. Cornish, D. Mendel and P. G. Schultz, Angew. Chem. Int. Ed. Engl., 1995, 34:621 (1995); C.J. Noren, S.J. Anthony-Cahill, M.C. Griffith, P.G. Schultz, A general method for site- specific incorporation of unnatural amino acids into proteins, Science 244: 182-188 (1989); and, J.D. Bain, C.G. Glabe, T.A. Dix, A.R. Chamberlin, E.S. Diala, Biosynthetic site-specific incorporation of a non-natural amino acid into a polypeptide, J. Am. Chem. Soc. I l l : 8013-
8014 (1989). A broad range of functional groups has been introduced into proteins for studies of protein stability, protein folding, enzyme mechanism, and signal transduction.
[00439] An in vivo method, termed selective pressure incorporation, was developed to exploit the promiscuity of wild-type synthetases. See, e.g., N. Budisa, C. Minks, S. Alefelder, W. Wenger, F. M. Dong, L. Moroder and R. Huber, FASEB J., 13:41 (1999). An auxotrophic strain, in which the relevant metabolic pathway supplying the cell with a particular natural amino acid is switched off, is grown in minimal media containing limited concentrations of the natural amino acid, while transcription of the target gene is repressed. At the onset of a stationary growth phase, the natural amino acid is depleted and replaced with the unnatural amino acid analog. Induction of expression of the recombinant protein results in the accumulation of a protein containing the unnatural analog. For example, using this strategy, o, m and p-fluorophenylalanines have been incorporated into proteins, and exhibit two characteristic shoulders in the UV spectrum which can be easily identified, see, e.g., C. Minks, R. Huber, L. Moroder and N. Budisa, Anal. Biochem.. 284:29 (2000); trifluoromethionine has been used to replace methionine in bacteriophage T4 lysozyme to study its interaction with chitooligosaccharide ligands by 19F NMR, see, e.g., H. Duewel, E. Daub, V. Robinson and J. F. Honek, Biochemistry, 36:3404 (1997); and trifluoroleucine has been incorporated in place of leucine, resulting in increased thermal and chemical stability of a leucine-zipper protein. See, e.g., Y. Tang, G. Ghirlanda, W. A. Petka, T. Nakajima, W. F. DeGrado and D. A. Tirrell, Angew. Chem. Int. Ed. Engl., 40: 1494 (2001). Moreover, selenomethionine and telluromethionine are incorporated into various recombinant proteins to facilitate the solution of phases in X-ray crystallography. See, e.g., W. A. Hendrickson, J. R. Horton and D. M. Lemaster, EMBO J., 9: 1665 (1990); J. O. Boles, K. Lewinski, M. Kunkle, J. D. Odom, B. Dunlap, L. Lebioda and M. Hatada, Nat. Struct. Biol., 1 :283 (1994); N. Budisa, B. Steipe, P. Demange, C. Eckerskorn, J. Kellermann and R. Huber, Eur. J. Biochem.. 230:788 (1995); and, N. Budisa, W. Karnbrock, S. Steinbacher, A. Humm, L. Prade, T. Neuefeind, L. Moroder and R. Huber, J. Mol. Biol.. 270:616 (1997). Methionine analogs with alkene or alkyne functionalities have also been incorporated efficiently, allowing for additional modification of proteins by chemical means. See, e.g., J. C. M. vanHest and D. A. Tirrell, FEBS Lett.. 428:68 (1998); J. C. M. van Hest, K. L. Kiick and D. A. Tirrell, J. Am. Chem. Soc. 122: 1282 (2000); and, K. L. Kiick and D. A. Tirrell, Tetrahedron, 56:9487 (2000); U.S. Patent No. 6,586,207; U.S. Patent Publication 2002/0042097, which are incorporated by reference herein.
[00440] The success of this method depends on the recognition of the unnatural amino acid analogs by aminoacyl-tRNA synthetases, which, in general, require high selectivity to insure the fidelity of protein translation. One way to expand the scope of this method is to relax the substrate specificity of aminoacyl-tRNA synthetases, which has been achieved in a limited number of cases. For example, replacement of Ala294 by Gly in Escherichia coli phenylalanyl-tRNA synthetase (PheRS) increases the size of substrate binding pocket, and results in the acylation of tRNAPhe by p-Cl-phenylalanine (p-Cl-Phe). See, M. Ibba, P. Kast and H. Hennecke, Biochemistry, 33:7107 (1994). An Escherichia coli strain harboring this mutant PheRS allows the incorporation of p-Cl-phenylalanine or p-Br-phenylalanine in place of phenylalanine. See, e.g., M. Ibba and H. Hennecke, FEBS Lett., 364:272 (1995); and, N. Sharma, R. Furter, P. Kast and D. A. Tirrell, FEBS Lett., 467:37 (2000). Similarly, a point mutation Phel30Ser near the amino acid binding site of Escherichia coli tyrosyl-tRNA synthetase was shown to allow azatyrosine to be incorporated more efficiently than tyrosine. See, F. Hamano-Takaku, T. Iwama, S. Saito-Yano, K. Takaku, Y. Monden, M. Kitabatake, D. Soli and S. Nishimura. J. Biol. Chem.. 275:40324 (2000V
[00441] Another strategy to incorporate unnatural amino acids into proteins in vivo is to modify synthetases that have proofreading mechanisms. These synthetases cannot discriminate and therefore activate amino acids that are structurally similar to the cognate natural amino acids. This error is corrected at a separate site, which deacylates the mischarged amino acid from the tRNA to maintain the fidelity of protein translation. If the proofreading activity of the synthetase is disabled, structural analogs that are misactivated may escape the editing function and be incorporated. This approach has been demonstrated recently with the valyl-tRNA synthetase (ValRS). See, V. Doring, H. D. Mootz, L. A. Nangle, T. L. Hendrickson, V. de Crecy-Lagard, P. Schimmel and P. Marliere, Science, 292:501 (2001). ValRS can misaminoacylate tRNAVal with Cys, Thr, or aminobutyrate (Abu); these noncognate amino acids are subsequently hydrolyzed by the editing domain. After random mutagenesis of the Escherichia coli chromosome, a mutant Escherichia coli strain was selected that has a mutation in the editing site of ValRS. This edit-defective ValRS incorrectly charges tRNAVal with Cys. Because Abu sterically resembles Cys (-SH group of Cys is replaced with -CH3 in Abu), the mutant ValRS also incorporates Abu into proteins when this mutant Escherichia coli strain is grown in the presence of Abu. Mass spectrometric analysis shows that about 24% of valines are replaced by Abu at each valine position in the native protein.
[00442] Solid-phase synthesis and semisynthetic methods have also allowed for the synthesis of a number of proteins containing novel amino acids. For example, see the following publications and references cited within, which are as follows: Crick, F.J.C., Barrett, L. Brenner, S. Watts-Tobin, R. General nature of the genetic code for proteins. Nature. 192: 1227-1232 (1961); Hofmann, K., Bohn, H. Studies on polypeptides. XXXVI. The effect of pyrazole-imidazole replacements on the S-protein activating potency of an S- peptide fragment, J. Am Chem, 88(24):5914-5919 (1966); Kaiser, E.T. Synthetic approaches to biologically active peptides and proteins including enyzmes, Acc Chem Res, 47-54 (1989); Nakatsuka, T., Sasaki, T., Kaiser, E.T. Peptide segment coupling catalyzed by the semisynthetic enzyme thiosubtilisin, J Am Chem Soc, 3808-3810 (1987); Schnolzer, M., Kent, S B H. Constructing proteins by dovetailing unprotected synthetic peptides: backbone- engineered HIV protease, Science, 256(5054):221 -225 (1992); Chaiken, I.M. Semisynthetic peptides and proteins, CRC Crit Rev Biochem. 1 1(3):255-301 (1981); Offord, R.E. Protein engineering by chemical means? Protein Eng., 1 (3): 151-157 (1987); and, Jackson, D.Y., Burnier, J., Quan, C, Stanley, M., Tom, J., Wells, J.A. A Designed Peptide Ligase for Total Synthesis of Ribonuclease A with Unnatural Catalytic Residues, Science, 266(5183):243 (1994).
[00443] Chemical modification has been used to introduce a variety of unnatural side chains, including cofactors, spin labels and oligonucleotides into proteins in vitro. See, e.g., Corey, D.R., Schultz, P.G. Generation of a hybrid sequence-specific single-stranded deoxyribonuclease, Science. 238(4832): 1401-1403 (1987); Kaiser, E.T., Lawrence D.S., Rokita, S.E. The chemical modification of enzymatic specificity, Annu Rev Biochem, 54:565- 595 (1985); Kaiser, E.T., Lawrence, D.S. Chemical mutation of enyzme active sites, Science, 226(4674):505-51 1 (1984); Neet, K.E., Nanci A, Koshland, D.E. Properties of thiol- subtilisin, J Biol. Chem, 243(24):6392-6401 (1968); Polgar, L.B., M.L. A new enzyme containing a synthetically formed active site. Thiol-subtilisin. J. Am Chem Soc, 3153-3154 (1966); and, Pollack, S.J., Nakayama, G. Schultz, P.G. Introduction of nucleophiles and spectroscopic probes into antibody combining sites, Science, 242(4881): 1038-1040 (1988).
[00444] Alternatively, biosynthetic methods that employ chemically modified aminoacyl-tRNAs have been used to incorporate several biophysical probes into proteins synthesized in vitro. See the following publications and references cited within: Brunner, J. New Photolabeling and crosslinking methods, Annu. Rev Biochem, 62:483-514 (1993); and, Krieg, U.C., Walter, P., Hohnson, A.E. Photocrosslinking of the signal sequence of nascent
preprolactin of the 54-kilodalton polypeptide of the signal recognition particle, Proc. Natl. Acad. Sci. 83(22):8604-8608 (1986).
[00445] Previously, it has been shown that unnatural amino acids can be site- specifically incorporated into proteins in vitro by the addition of chemically aminoacylated suppressor tRNAs to protein synthesis reactions programmed with a gene containing a desired amber nonsense mutation. Using these approaches, one can substitute a number of the common twenty amino acids with close structural homologues, e.g., fluorophenylalanine for phenylalanine, using strains auxotropic for a particular amino acid. See, e.g., Noren, C.J., Anthony-Cahill, Griffith, M.C., Schultz, P.G. A general method for site-specific incorporation of unnatural amino acids into proteins, Science, 244: 182-188 (1989); M.W. Nowak, et al., Science 268:439-42 (1995); Bain, J.D., Glabe, C.G., Dix, T.A., Chamberlin, A.R., Diala, E.S. Biosynthetic site-specific Incorporation of a non-natural amino acid into a polypeptide, J. Am Chem Soc, 1 1 1 :8013-8014 (1989); N. Budisa et al., FASEB J. 13:41-51 (1999); Ellman, J.A., Mendel, D., Anthony-Cahill, S., Noren, C.J., Schultz, P.G. Biosynthetic method for introducing unnatural amino acids site-specifically into proteins. Methods in Enz., 301-336 (1992); and, Mendel, D., Cornish, V.W. & Schultz, P.G. Site-Directed Mutagenesis with an Expanded Genetic Code, Annu Rev Biophys. Biomol Struct. 24, 435-62 (1995).
[00446] For example, a suppressor tRNA was prepared that recognized the stop codon UAG and was chemically aminoacylated with an unnatural amino acid. Conventional site- directed mutagenesis was used to introduce the stop codon TAG, at the site of interest in the protein gene. See, e.g., Sayers, J.R., Schmidt, W. Eckstein, F. 5', 3' Exonuclease in phosphorothioate-based olignoucleotide-directed mutagensis, Nucleic Acids Res, 16(3):791 - 802 (1988). When the acylated suppressor tRNA and the mutant gene were combined in an in vitro transcription/translation system, the unnatural amino acid was incorporated in response to the UAG codon which gave a protein containing that amino acid at the specified position. Experiments using [3H]-Phe and experiments with a-hydroxy acids demonstrated that only the desired amino acid is incorporated at the position specified by the UAG codon and that this amino acid is not incorporated at any other site in the protein. See, e.g., Noren, et al, supra; Kobayashi et al., (2003) Nature Structural Biology 10(6):425-432; and, Ellman, J.A., Mendel, D., Schultz, P.G. Site-specific incorporation of novel backbone structures into proteins, Science, 255(5041): 197-200 (1992).
[00447] Microinjection techniques have also been use incorporate unnatural amino acids into proteins. See, e.g., M. W. Nowak, P. C. Kearney, J. R. Sampson, M. E. Saks, C. G. Labarca, S. K. Silverman, W. G. Zhong, J. Thorson, J. N. Abelson, N. Davidson, P. G. Schultz, D. A. Dougherty and H. A. Lester, Science, 268:439 (1995); and, D. A. Dougherty, Curr. Opin. Chem. Biol., 4:645 (2000). A Xenopus oocyte was coinjected with two RNA species made in vitro: an mRNA encoding the target protein with a UAG stop codon at the amino acid position of interest and an amber suppressor tRNA aminoacylated with the desired unnatural amino acid. The translational machinery of the oocyte then inserts the unnatural amino acid at the position specified by UAG. This method has allowed in vivo structure-function studies of integral membrane proteins, which are generally not amenable to in vitro expression systems. Examples include the incorporation of a fluorescent amino acid into tachykinin neurokinin-2 receptor to measure distances by fluorescence resonance energy transfer, see, e.g., G. Turcatti, K. Nemeth, M. D. Edgerton, U. Meseth, F. Talabot, M. Peitsch, J. Knowles, H. Vogel and A. Chollet, J. Biol. Chem., 271 : 19991 (1996); the incorporation of biotinylated amino acids to identify surface-exposed residues in ion channels, see, e.g., J. P. Gallivan, H. A. Lester and D. A. Dougherty, Chem. Biol., 4:739 (1997); the use of caged tyrosine analogs to monitor conformational changes in an ion channel in real time, see, e.g., J. C. Miller, S. K. Silverman, P. M. England, D. A. Dougherty and H. A. Lester, Neuron, 20:619 (1998); and, the use of alpha hydroxy amino acids to change ion channel backbones for probing their gating mechanisms. See, e.g., P. M. England, Y. Zhang, D. A. Dougherty and H. A. Lester, Cell, 96:89 (1999); and, T. Lu, A. Y. Ting, J. Mainland, L. Y. Jan, P. G. Schultz and J. Yang, Nat. Neurosci., 4:239 (2001).
[00448] The ability to incorporate unnatural amino acids directly into proteins in vivo offers the advantages of high yields of mutant proteins, technical ease, the potential to study the mutant proteins in cells or possibly in living organisms and the use of these mutant proteins in therapeutic treatments. The ability to include unnatural amino acids with various sizes, acidities, nucleophilicities, hydrophobicities, and other properties into proteins can greatly expand our ability to rationally and systematically manipulate the structures of proteins, both to probe protein function and create new proteins or organisms with novel properties. However, the process is difficult, because the complex nature of tRNA-synthetase interactions that are required to achieve a high degree of fidelity in protein translation.
[00449] In one attempt to site-specifically incorporate para-F-Phe, a yeast amber suppressor tRNAPheCUA /phenylalanyl-tRNA synthetase pair was used in a p-F-Phe
resistant, Phe auxotrophic Escherichia coli strain. See, e.g., R. Furter, Protein Sci., 7:419 (1998).
[00450] It may also be possible to obtain expression of a PSMC polynucleotide of the present invention using a cell-free (in-vitro) translational system. In these systems, which can include either mRNA as a template (in-vitro translation) or DNA as a template (combined in-vitro transcription and translation), the in vitro synthesis is directed by the ribosomes. Considerable effort has been applied to the development of cell-free protein expression systems. See, e.g., Kim, D.-M. and J.R. Swartz, Biotechnology and Bioengineering, 74 :309- 316 (2001); Kim, D.-M. and J.R. Swartz, Biotechnology Letters, 22, 1537-1542, (2000); Kim, D.-M., and J.R. Swartz, Biotechnology Progress, 16, 385-390, (2000); Kim, D.-M., and J.R. Swartz, Biotechnology and Bioengineering, 66, 180-188, (1999); and Patnaik, R. and J.R. Swartz, Biotechniques 24, 862-868, (1998); U.S. Patent No. 6,337,191 ; U.S. Patent Publication No. 2002/0081660; WO 00/55353; WO 90/05785, which are incorporated by reference herein. Another approach that may be applied to the expression of antigen-binding polypeptides comprising a non-naturally encoded amino acid includes the mRNA-peptide fusion technique. See, e.g., R. Roberts and J. Szostak, Proc. Natl Acad. Sci. (USA) 94: 12297- 12302 (1997); A. Frankel, et al, Chemistry & Biology 10: 1043-1050 (2003). In this approach, an mRNA template linked to puromycin is translated into peptide on the ribosome. If one or more tRNA molecules has been modified, non-natural amino acids can be incorporated into the peptide as well. After the last mRNA codon has been read, puromycin captures the C-terminus of the peptide. If the resulting mRNA-peptide conjugate is found to have interesting properties in an in vitro assay, its identity can be easily revealed from the mRNA sequence. In this way, one may screen libraries of antigen-binding polypeptides comprising one or more non-naturally encoded amino acids to identify polypeptides having desired properties. More recently, in vitro ribosome translations with purified components have been reported that permit the synthesis of peptides substituted with non-naturally encoded amino acids. See, e.g., A. Forster et al , Proc. Natl Acad. Sci. (USA) 100:6353 (2003).
IX. Macromolecular Polymers Coupled to PSMC
[00451] Various modifications to the non-natural amino acid polypeptides described herein can be effected using the compositions, methods, techniques and strategies described herein. These modifications include the incorporation of further functionality onto the non- natural amino acid component of the polypeptide, including but not limited to, a label; a dye;
a polymer; a water-soluble polymer; a derivative of polyethylene glycol; a photocrosslinker; a radionuclide; a cytotoxic compound; a drug; an affinity label; a photoaffinity label; a reactive compound; a resin; a second protein or polypeptide or polypeptide analog; an antibody or antibody fragment; a metal chelator; a cofactor; a fatty acid; a carbohydrate; a polynucleotide; a DNA; a RNA; an antisense polynucleotide; a water-soluble dendrimer; a cyclodextrin; an inhibitory ribonucleic acid; a biomaterial; a nanoparticle; a spin label; a fluorophore, a metal -containing moiety; a radioactive moiety; a novel functional group; a group that covalently or noncovalently interacts with other molecules; a photocaged moiety; a photoisomerizable moiety; biotin; a derivative of biotin; a biotin analogue; a moiety incorporating a heavy atom; a chemically cleavable group; a photocleavable group; an elongated side chain; a carbon-linked sugar; a redox-active agent; an amino thioacid; a toxic moiety; an isotopically labeled moiety; a biophysical probe; a phosphorescent group; a chemiluminescent group; an electron dense group; a magnetic group; an intercalating group; a chromophore; an energy transfer agent; a biologically active agent; a detectable label; a small molecule; or any combination of the above, or any other desirable compound or substance. As an illustrative, non-limiting example of the compositions, methods, techniques and strategies described herein, the following description will focus on adding macromolecular polymers to the non-natural amino acid polypeptide with the understanding that the compositions, methods, techniques and strategies described thereto are also applicable (with appropriate modifications, if necessary and for which one of skill in the art could make with the disclosures herein) to adding other functionalities, including but not limited to those listed above.
[00452] A wide variety of macromolecular polymers and other molecules can be linked to antigen-binding polypeptides of the present invention to modulate biological properties of the PSMC, and/or provide new biological properties to the PSMC molecule. These macromolecular polymers can be linked to the PSMC via a naturally encoded amino acid, via a non-naturally encoded amino acid, or any functional substituent of a natural or non-natural amino acid, or any substituent or functional group added to a natural or non- natural amino acid. The molecular weight of the polymer may be of a wide range, including but not limited to, between about 100 Da and about 100,000 Da or more.
[00453] The present invention provides substantially homogenous preparations of polymenprotein conjugates. "Substantially homogenous" as used herein means that polymer:protein conjugate molecules are observed to be greater than half of the total protein.
The polymenprotein conjugate has biological activity and the present "substantially homogenous" PEGylated PSMC preparations provided herein are those which are homogenous enough to display the advantages of a homogenous preparation, e.g., ease in clinical application in predictability of lot to lot pharmacokinetics.
[00454] One may also choose to prepare a mixture of polymenprotein conjugate molecules, and the advantage provided herein is that one may select the proportion of mono- polymenprotein conjugate to include in the mixture. Thus, if desired, one may prepare a mixture of various proteins with various numbers of polymer moieties attached (i.e., di-, tri-, tetra-, etc.) and combine said conjugates with the mono-polymer:protein conjugate prepared using the methods of the present invention, and have a mixture with a predetermined proportion of mono-polymer:protein conjugates.
[00455] The polymer selected may be water soluble so that the protein to which it is attached does not precipitate in an aqueous environment, such as a physiological environment. The polymer may be branched or unbranched. Preferably, for therapeutic use of the end-product preparation, the polymer will be pharmaceutically acceptable.
[00456] The proportion of polyethylene glycol molecules to protein molecules will vary, as will their concentrations in the reaction mixture. In general, the optimum ratio (in terms of efficiency of reaction in that there is minimal excess unreacted protein or polymer) may be determined by the molecular weight of the polyethylene glycol selected and on the number of available reactive groups available. As relates to molecular weight, typically the higher the molecular weight of the polymer, the fewer number of polymer molecules which may be attached to the protein. Similarly, branching of the polymer should be taken into account when optimizing these parameters. Generally, the higher the molecular weight (or the more branches) the higher the polymenprotein ratio.
[00457] As used herein, and when contemplating PEG:PSMC conjugates, the term "therapeutically effective amount" refers to an amount which gives the desired benefit to a patient. The amount will vary from one individual to another and will depend upon a number of factors, including the overall physical condition of the patient and the underlying cause of the condition to be treated. The amount of PSMC polypeptide used for therapy gives an acceptable rate of change and maintains desired response at a beneficial level. A therapeutically effective amount of the present compositions may be readily ascertained by one skilled in the art using publicly available materials and procedures.
[00458] The water soluble polymer may be any structural form including but not limited to linear, forked or branched. Typically, the water soluble polymer is a poly(alkylene glycol), such as poly(ethylene glycol) (PEG), but other water soluble polymers can also be employed. By way of example, PEG is used to describe certain embodiments of this invention.
[00459] PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161). The term "PEG" is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented as linked to the PSMC by the formula:
XO-(CH2CH20)n-CH2CH2-Y
where n is 2 to 10,000 and X is H or a terminal modification, including but not limited to, a C alkyl.
[00460] In some cases, a PEG used in the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH3 ("methoxy PEG"). Alternatively, the PEG can terminate with a reactive group, thereby forming a bifunctional polymer. Typical reactive groups can include those reactive groups that are commonly used to react with the functional groups found in the 20 common amino acids (including but not limited to, maleimide groups, activated carbonates (including but not limited to, p-nitrophenyl ester), activated esters (including but not limited to, N-hydroxysuccinimide, p-nitrophenyl ester) and aldehydes) as well as functional groups that are inert to the 20 common amino acids but that react specifically with complementary functional groups present in non-naturally encoded amino acids (including but not limited to, azide groups, alkyne groups). It is noted that the other end of the PEG, which is shown in the above formula by Y, will attach either directly or indirectly to an antigen-binding polypeptide via a naturally-occurring or non-naturally encoded amino acid. For instance, Y may be an amide, carbamate or urea linkage to an amine group (including but not limited to, the epsilon amine of lysine or the N-terminus) of the polypeptide. Alternatively, Y may be a maleimide linkage to a thiol group (including but not limited to, the thiol group of cysteine). Alternatively, Y may be a linkage to a residue not commonly accessible via the 20 common amino acids. For example, an azide group on the PEG can be reacted with an alkyne group on the PSMC to form a Huisgen [3+2] cycloaddition product. Alternatively, an alkyne group on the PEG can be reacted with an
azide group present in a non-naturally encoded amino acid to form a similar product. In some embodiments, a strong nucleophile (including but not limited to, hydrazine, hydrazide, hydroxylamine, semicarbazide) can be reacted with an aldehyde or ketone group present in a non-naturally encoded amino acid to form a hydrazone, oxime or semicarbazone, as applicable, which in some cases can be further reduced by treatment with an appropriate reducing agent. Alternatively, the strong nucleophile can be incorporated into the PSMC via a non-naturally encoded amino acid and used to react preferentially with a ketone or aldehyde group present in the water soluble polymer.
[00461] Any molecular mass for a PEG can be used as practically desired, including but not limited to, from about 100 Daltons (Da) to 100,000 Da or more as desired (including but not limited to, sometimes 0.1-50 kDa or 10-40 kDa). Branched chain PEGs, including but not limited to, PEG molecules with each chain having a MW ranging from 1-100 kDa (including but not limited to, 1-50 kDa or 5-20 kDa) can also be used. A wide range of PEG molecules are described in, including but not limited to, the Shearwater Polymers, Inc. catalog, Nektar Therapeutics catalog, incorporated herein by reference.
[00462] Generally, at least one terminus of the PEG molecule is available for reaction with the non-naturally-encoded amino acid. For example, PEG derivatives bearing alkyne and azide moieties for reaction with amino acid side chains can be used to attach PEG to non- naturally encoded amino acids as described herein. If the non-naturally encoded amino acid comprises an azide, then the PEG will typically contain either an alkyne moiety to effect formation of the [3+2] cycloaddition product or an activated PEG species (i.e., ester, carbonate) containing a phosphine group to effect formation of the amide linkage. Alternatively, if the non-naturally encoded amino acid comprises an alkyne, then the PEG will typically contain an azide moiety to effect formation of the [3+2] Huisgen cycloaddition product. If the non-naturally encoded amino acid comprises a carbonyl group, the PEG will typically comprise a potent nucleophile (including but not limited to, a hydrazide, hydrazine, hydroxylamine, or semicarbazide functionality) in order to effect formation of corresponding hydrazone, oxime, and semicarbazone linkages, respectively. In other alternatives, a reverse of the orientation of the reactive groups described above can be used, i.e., an azide moiety in the non-naturally encoded amino acid can be reacted with a PEG derivative containing an alkyne.
[00463] In some embodiments, the PSMC variant with a PEG derivative contains a chemical functionality that is reactive with the chemical functionality present on the side chain of the non-naturally encoded amino acid.
[00464] The invention provides in some embodiments azide- and acetylene-containing polymer derivatives comprising a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da. The polymer backbone of the water-soluble polymer can be poly(ethylene glycol). However, it should be understood that a wide variety of water soluble polymers including but not limited to poly(ethylene)glycol and other related polymers, including poly(dextran) and poly(propylene glycol), are also suitable for use in the practice of this invention and that the use of the term PEG or poly(ethylene glycol) is intended to encompass and include all such molecules. The term PEG includes, but is not limited to, poly(ethylene glycol) in any of its forms, including bifunctional PEG, multiarmed PEG, derivatized PEG, forked PEG, branched PEG, pendent PEG (i.e. PEG or related polymers having one or more functional groups pendent to the polymer backbone), or PEG with degradable linkages therein.
[00465] PEG is typically clear, colorless, odorless, soluble in water, stable to heat, inert to many chemical agents, does not hydrolyze or deteriorate, and is generally non-toxic. Poly(ethylene glycol) is considered to be biocompatible, which is to say that PEG is capable of coexistence with living tissues or organisms without causing harm. More specifically, PEG is substantially non-immunogenic, which is to say that PEG does not tend to produce an immune response in the body. When attached to a molecule having some desirable function in the body, such as a biologically active agent, the PEG tends to mask the agent and can reduce or eliminate any immune response so that an organism can tolerate the presence of the agent. PEG conjugates tend not to produce a substantial immune response or cause clotting or other undesirable effects. PEG having the formula - CH2CH20-(CH2CH20)n - CH2CH2~, where n is from about 3 to about 4000, typically from about 20 to about 2000, is suitable for use in the present invention. PEG having a molecular weight of from about 800 Da to about 100,000 Da are in some embodiments of the present invention particularly useful as the polymer backbone.
[00466] The polymer backbone can be linear or branched. Branched polymer backbones are generally known in the art. Typically, a branched polymer has a central branch core moiety and a plurality of linear polymer chains linked to the central branch core. PEG is commonly used in branched forms that can be prepared by addition of ethylene oxide to
various polyols, such as glycerol, glycerol oligomers, pentaerythritol and sorbitol. The central branch moiety can also be derived from several amino acids, such as lysine. The branched poly(ethylene glycol) can be represented in general form as R(-PEG-OH)m in which R is derived from a core moiety, such as glycerol, glycerol oligomers, or pentaerythritol, and m represents the number of arms. Multi-armed PEG molecules, such as those described in U.S. Pat. Nos. 5,932,462 5,643,575; 5,229,490; 4,289,872; U.S. Pat. Appl. 2003/0143596; WO 96/21469; and WO 93/21259, each of which is incorporated by reference herein in its entirety, can also be used as the polymer backbone.
[00467] Branched PEG can also be in the form of a forked PEG represented by PEG(— YCHZ2)n, where Y is a linking group and Z is an activated terminal group linked to CH by a chain of atoms of defined length.
[00468] Yet another branched form, the pendant PEG, has reactive groups, such as carboxyl, along the PEG backbone rather than at the end of PEG chains.
[00469] In addition to these forms of PEG, the polymer can also be prepared with weak or degradable linkages in the backbone. For example, PEG can be prepared with ester linkages in the polymer backbone that are subject to hydrolysis. As shown below, this hydrolysis results in cleavage of the polymer into fragments of lower molecular weight:
-PEG-C02-PEG-+H20 -» PEG-C02H+HO-PEG-
It is understood by those skilled in the art that the term poly(ethylene glycol) or PEG represents or includes all the forms known in the art including but not limited to those disclosed herein.
[00470] Many other polymers are also suitable for use in the present invention. In some embodiments, polymer backbones that are water-soluble, with from 2 to about 300 termini, are particularly useful in the invention. Examples of suitable polymers include, but are not limited to, other poly(alkylene glycols), such as poly(propylene glycol) ("PPG"), copolymers thereof (including but not limited to copolymers of ethylene glycol and propylene glycol), terpolymers thereof, mixtures thereof, and the like. Although the molecular weight of each chain of the polymer backbone can vary, it is typically in the range of from about 800 Da to about 100,000 Da, often from about 6,000 Da to about 80,000 Da.
[00471] Those of ordinary skill in the art will recognize that the foregoing list for substantially water soluble backbones is by no means exhaustive and is merely illustrative, and that all polymeric materials having the qualities described above are contemplated as being suitable for use in the present invention.
[00472] In some embodiments of the present invention the polymer derivatives are
"multi-functional", meaning that the polymer backbone has at least two termini, and possibly as many as about 300 termini, functionalized or activated with a functional group. Multifunctional polymer derivatives include, but are not limited to, linear polymers having two termini, each terminus being bonded to a functional group which may be the same or different.
[00473] In one embodiment, the polymer derivative has the structure:
X— A— POLY— B— N=N=N
wherein:
N=N=N is an azide moiety;
B is a linking moiety, which may be present or absent;
POLY is a water-soluble non-antigenic polymer;
A is a linking moiety, which may be present or absent and which may be the same as B or different; and
X is a second functional group.
Examples of a linking moiety for A and B include, but are not limited to, a multiply- functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms. A heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain. The alkyl chain may also be branched at a heteroatom. Other examples of a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl group, containing up to 10 and more preferably 5-6 carbon atoms. The aryl group may be substituted with one more carbon atoms, nitrogen, oxygen or sulfur atoms. Other examples of suitable linking groups include those linking groups described in U.S. Pat. Nos. 5,932,462; 5,643,575; and U.S. Pat. Appl. Publication 2003/0143596, each of which is incorporated by reference herein. Those of ordinary skill in the art will recognize that the foregoing list for linking moieties is by no means exhaustive and is merely illustrative, and that all linking moieties having the qualities described above are contemplated to be suitable for use in the present invention.
[00474] Examples of suitable functional groups for use as X include, but are not limited to, hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N- hydroxysuccinimidyl esters and 1 -benzotriazolyl esters, active carbonate, such as N- hydroxysuccinimidyl carbonates and 1 -benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy,
protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, tresylate, alkene, ketone, and azide. As is understood by those skilled in the art, the selected X moiety should be compatible with the azide group so that reaction with the azide group does not occur. The azide-containing polymer derivatives may be homobifunctional, meaning that the second functional group (i.e., X) is also an azide moiety, or heterobifunctional, meaning that the second functional group is a different functional group.
[00475] The term "protected" refers to the presence of a protecting group or moiety that prevents reaction of the chemically reactive functional group under certain reaction conditions. The protecting group will vary depending on the type of chemically reactive group being protected. For example, if the chemically reactive group is an amine or a hydrazide, the protecting group can be selected from the group of tert-butyloxycarbonyl (t- Boc) and 9-fluorenylmethoxycarbonyl (Fmoc). If the chemically reactive group is a thiol, the protecting group can be orthopyridyldisulfide. If the chemically reactive group is a carboxylic acid, such as butanoic or propionic acid, or a hydroxyl group, the protecting group can be benzyl or an alkyl group such as methyl, ethyl, or tert-butyl. Other protecting groups known in the art may also be used in the present invention.
[00476] Specific examples of terminal functional groups in the literature include, but are not limited to, N-succinimidyl carbonate (see e.g., U.S. Pat. Nos. 5,281 ,698, 5,468,478), amine (see, e.g., Buckmann et al. Makromol. Chem. 182: 1379 (1981), Zaplipsky et al. Eur. Polym. J. 19: 1 177 (1983)), hydrazide (See, e.g., Andresz et al. Makromol. Chem. 179:301 (1978)), succinimidyl propionate and succinimidyl butanoate (see, e.g., Olson et al. in Poly(ethylene glycol) Chemistry & Biological Applications, pp 170-181 , Harris & Zaplipsky Eds., ACS, Washington, D.C., 1997; see also U.S. Pat. No. 5,672,662), succinimidyl succinate (See, e.g., Abuchowski et al. Cancer Biochem. Biophys. 7: 175 (1984) and Joppich et al. Macrolol. Chem. 180: 1381 (1979), succinimidyl ester (see, e.g., U.S. Pat. No. 4,670,417), benzotriazole carbonate (see, e.g., U.S. Pat. No. 5,650,234), glycidyl ether (see, e.g., Pitha et al. Eur. J Biochem. 94: 1 1 (1979), Elling et al., Biotech. Appl. Biochem. 13:354 (1991), oxycarbonylimidazole (see, e.g., Beauchamp, et al., Anal. Biochem. 131 :25 (1983), Tondelli et al. J. Controlled Release 1 :251 (1985)), p-nitrophenyl carbonate (see, e.g., Veronese, et al., Appl. Biochem. Biotech., 1 1 : 141 (1985); and Sartore et al., Appl. Biochem. Biotech., 27:45 (1991)), aldehyde (see, e.g., Harris et al. J. Polym. Sci. Chem. Ed. 22:341
(1984), U.S. Pat. No. 5,824,784, U.S. Pat. No. 5,252,714), maleimide (see, e.g., Goodson et al. Bio/Technology 8:343 (1990), Romani et al. in Chemistry of Peptides and Proteins 2:29 (1984)), and Kogan, Synthetic Comm. 22:2417 (1992)), orthopyridyl-disulfide (see, e.g., Woghiren, et al. Bioconj. Chem. 4:314(1993)), acrylol (see, e.g., Sawhney et al., Macromolecules, 26:581 (1993)), vinylsulfone (see, e.g., U.S. Pat. No. 5,900,461). All of the above references and patents are incorporated herein by reference.
[00477] In certain embodiments of the present invention, the polymer derivatives of the invention comprise a polymer backbone having the structure:
X— CH2CH20-(CH2CH20)n -CH2CH2 -N=N=N
wherein:
X is a functional group as described above; and
n is about 20 to about 4000.
In another embodiment, the polymer derivatives of the invention comprise a polymer backbone having the structure:
X— CH2CH20-(CH2CH20)n -CH2CH2 - 0-(CH2)m-W-N=N=N
wherein:
W is an aliphatic or aromatic linker moiety comprising between 1-10 carbon atoms;
n is about 20 to about 4000; and
X is a functional group as described above, m is between 1 and 10.
[00478] The azide-containing PEG derivatives of the invention can be prepared by a variety of methods known in the art and/or disclosed herein. In one method, shown below, a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, the polymer backbone having a first terminus bonded to a first functional group and a second terminus bonded to a suitable leaving group, is reacted with an azide anion (which may be paired with any of a number of suitable counter-ions, including sodium, potassium, tert-butylammonium and so forth). The leaving group undergoes a nucleophilic displacement and is replaced by the azide moiety, affording the desired azide-containing PEG polymer.
X-PEG-L + N3 " -» X-PEG- N3
[00479] As shown, a suitable polymer backbone for use in the present invention has the formula X-PEG-L, wherein PEG is poly(ethylene glycol) and X is a functional group
which does not react with azide groups and L is a suitable leaving group. Examples of suitable functional groups include, but are not limited to, hydroxyl, protected hydroxyl, acetal, alkenyl, amine, aminooxy, protected amine, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, maleimide, dithiopyridine, and vinylpyridine, and ketone. Examples of suitable leaving groups include, but are not limited to, chloride, bromide, iodide, mesylate, tresylate, and tosylate.
[00480] In another method for preparation of the azide-containing polymer derivatives of the present invention, a linking agent bearing an azide functionality is contacted with a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, wherein the linking agent bears a chemical functionality that will react selectively with a chemical functionality on the PEG polymer, to form an azide-containing polymer derivative product wherein the azide is separated from the polymer backbone by a linking group.
[00481] An exemplary reaction scheme is shown below:
X-PEG-M + N-linker-N=N=N -» PG-X-PEG-linker-N=N=N
wherein:
PEG is poly(ethylene glycol) and X is a capping group such as alkoxy or a functional group as described above; and
M is a functional group that is not reactive with the azide functionality but that will react efficiently and selectively with the N functional group.
[00482] Examples of suitable functional groups include, but are not limited to, M being a carboxylic acid, carbonate or active ester if N is an amine; M being a ketone if N is a hydrazide or aminooxy moiety; M being a leaving group if N is a nucleophile.
[00483] Purification of the crude product may be accomplished by known methods including, but are not limited to, precipitation of the product followed by chromatography, if necessary.
[00484] A more specific example is shown below in the case of PEG diamine, in which one of the amines is protected by a protecting group moiety such as tert-butyl-Boc and the resulting mono-protected PEG diamine is reacted with a linking moiety that bears the azide functionality:
BocHN-PEG-NH2 + H02C-(CH2)3-N=N=N
[00485] In this instance, the amine group can be coupled to the carboxylic acid group using a variety of activating agents such as thionyl chloride or carbodiimide reagents and N- hydroxysuccinimide or N-hydroxybenzotriazole to create an amide bond between the monoamine PEG derivative and the azide-bearing linker moiety. After successful formation of the amide bond, the resulting N-tert-butyl-Boc-protected azide-containing derivative can be used directly to modify bioactive molecules or it can be further elaborated to install other useful functional groups. For instance, the N-t-Boc group can be hydrolyzed by treatment with strong acid to generate an omega-amino-PEG-azide. The resulting amine can be used as a synthetic handle to install other useful functionality such as maleimide groups, activated disulfides, activated esters and so forth for the creation of valuable heterobifunctional reagents.
[00486] Heterobifunctional derivatives are particularly useful when it is desired to attach different molecules to each terminus of the polymer. For example, the omega-N- amino-N-azido PEG would allow the attachment of a molecule having an activated electrophilic group, such as an aldehyde, ketone, activated ester, activated carbonate and so forth, to one terminus of the PEG and a molecule having an acetylene group to the other terminus of the PEG.
[00487] In another embodiment of the invention, the polymer derivative has the structure:
X— A— POLY— B— C≡C-R
wherein:
R can be either H or an alkyl, alkene, alkyoxy, or aryl or substituted aryl group;
B is a linking moiety, which may be present or absent;
POLY is a water-soluble non-antigenic polymer;
A is a linking moiety, which may be present or absent and which may be the same as B or different; and
X is a second functional group.
[00488] Examples of a linking moiety for A and B include, but are not limited to, a multiply-functionalized alkyl group containing up to 18, and more preferably between 1-10 carbon atoms. A heteroatom such as nitrogen, oxygen or sulfur may be included with the alkyl chain. The alkyl chain may also be branched at a heteroatom. Other examples of a linking moiety for A and B include, but are not limited to, a multiply functionalized aryl
group, containing up to 10 and more preferably 5-6 carbon atoms. The aryl group may be substituted with one more carbon atoms, nitrogen, oxygen, or sulfur atoms. Other examples of suitable linking groups include those linking groups described in U.S. Pat. Nos. 5,932,462 and 5,643,575 and U.S. Pat. Appl. Publication 2003/0143596, each of which is incorporated by reference herein. Those of ordinary skill in the art will recognize that the foregoing list for linking moieties is by no means exhaustive and is intended to be merely illustrative, and that a wide variety of linking moieties having the qualities described above are contemplated to be useful in the present invention.
[00489] Examples of suitable functional groups for use as X include hydroxyl, protected hydroxyl, alkoxyl, active ester, such as N-hydroxysuccinimidyl esters and 1- benzotriazolyl esters, active carbonate, such as N-hydroxysuccinimidyl carbonates and 1- benzotriazolyl carbonates, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, and tresylate, alkene, ketone, and acetylene. As would be understood, the selected X moiety should be compatible with the acetylene group so that reaction with the acetylene group does not occur. The acetylene -containing polymer derivatives may be homobi unctional, meaning that the second functional group (i.e., X) is also an acetylene moiety, or heterobifunctional, meaning that the second functional group is a different functional group.
[00490] In another embodiment of the present invention, the polymer derivatives comprise a polymer backbone having the structure:
X— CH2CH20-(CH2CH20)n -CH2CH2 - 0-(CH2)m-C≡CH
wherein:
X is a functional group as described above;
n is about 20 to about 4000; and
m is between 1 and 10.
Specific examples of each of the heterobifunctional PEG polymers are shown below.
[00491] The acetylene-containing PEG derivatives of the invention can be prepared using methods known to those skilled in the art and/or disclosed herein. In one method, a water soluble polymer backbone having an average molecular weight from about 800 Da to about 100,000 Da, the polymer backbone having a first terminus bonded to a first functional
group and a second terminus bonded to a suitable nucleophilic group, is reacted with a compound that bears both an acetylene functionality and a leaving group that is suitable for reaction with the nucleophilic group on the PEG. When the PEG polymer bearing the nucleophilic moiety and the molecule bearing the leaving group are combined, the leaving group undergoes a nucleophilic displacement and is replaced by the nucleophilic moiety, affording the desired acetylene-containing polymer.
X-PEG-Nu + L-A-C -» X-PEG-Nu-A-C≡CR'
[00492] As shown, a preferred polymer backbone for use in the reaction has the formula X-PEG-Nu, wherein PEG is poly(ethylene glycol), Nu is a nucleophilic moiety and X is a functional group that does not react with Nu, L or the acetylene functionality.
[00493] Examples of Nu include, but are not limited to, amine, alkoxy, aryloxy, sulfhydryl, imino, carboxylate, hydrazide, aminoxy groups that would react primarily via a SN2-type mechanism. Additional examples of Nu groups include those functional groups that would react primarily via an nucleophilic addition reaction. Examples of L groups include chloride, bromide, iodide, mesylate, tresylate, and tosylate and other groups expected to undergo nucleophilic displacement as well as ketones, aldehydes, thioesters, olefins, alpha- beta unsaturated carbonyl groups, carbonates and other electrophilic groups expected to undergo addition by nucleophiles.
[00494] In another embodiment of the present invention, A is an aliphatic linker of between 1-10 carbon atoms or a substituted aryl ring of between 6-14 carbon atoms. X is a functional group which does not react with azide groups and L is a suitable leaving group
[00495] In another method for preparation of the acetylene-containing polymer derivatives of the invention, a PEG polymer having an average molecular weight from about 800 Da to about 100,000 Da, bearing either a protected functional group or a capping agent at one terminus and a suitable leaving group at the other terminus is contacted by an acetylene anion.
[00496] An exemplary reaction scheme is shown below: X-PEG-L + -C≡CR' X-PEG-C≡CR'
wherein:
PEG is poly(ethylene glycol) and X is a capping group such as alkoxy or a functional group as described above; and
R' is either H, an alkyl, alkoxy, aryl or aryloxy group or a substituted alkyl, alkoxyl, aryl or aryloxy group.
[00497] In the example above, the leaving group L should be sufficiently reactive to undergo SN2-type displacement when contacted with a sufficient concentration of the acetylene anion. The reaction conditions required to accomplish SN2 displacement of leaving groups by acetylene anions are well known in the art.
[00498] Purification of the crude product can usually be accomplished by methods known in the art including, but are not limited to, precipitation of the product followed by chromatography, if necessary.
[00499] Water soluble polymers can be linked to the antigen-binding polypeptides of the invention. The water soluble polymers may be linked via a non-naturally encoded amino acid incorporated in the antigen-binding polypeptide or any functional group or substituent of a non-naturally encoded or naturally encoded amino acid, or any functional group or substituent added to a non-naturally encoded or naturally encoded amino acid. Alternatively, the water soluble polymers are linked to an antigen-binding polypeptide incorporating a non- naturally encoded amino acid via a naturally-occurring amino acid (including but not limited to, cysteine, lysine or the amine group of the N-terminal residue). In some cases, the PSMC of the invention comprise 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10 non-natural amino acids, wherein one or more non-naturally-encoded amino acid(s) are linked to water soluble polymer(s) (including but not limited to, PEG and/or oligosaccharides). In some cases, the PSMC of the invention further comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more naturally-encoded amino acid(s) linked to water soluble polymers. In some cases, the PSMC of the invention comprise one or more non-naturally encoded amino acid(s) linked to water soluble polymers and one or more naturally-occurring amino acids linked to water soluble polymers. In some embodiments, the water soluble polymers used in the present invention enhance the serum half-life of the PSMC relative to the unconjugated form.
[00500] The number of water soluble polymers linked to an antigen-binding polypeptide (i.e., the extent of PEGylation or glycosylation) of the present invention can be adjusted to provide an altered (including but not limited to, increased or decreased) pharmacologic, pharmacokinetic or pharmacodynamic characteristic such as in vivo half-life. In some embodiments, the half-life of PSMC is increased at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 percent, 2- fold, 5-fold, 10-fold, 50-fold, or at least about 100-fold over an unmodified polypeptide.
PEG derivatives containing a strong nucleophilic group (i.e., hydrazide, hydrazine, hydroxylamine or semicarbazide)
[00501] In one embodiment of the present invention, an antigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety that is linked directly to the PEG backbone.
[00502] In some embodiments, the hydroxylamine-terminal PEG derivative will have the structure:
RO-(CH2CH20)n-0-(CH2)m-0-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
[00503] In some embodiments, the hydrazine- or hydrazide-containing PEG derivative will have the structure:
RO-(CH2CH20)n-0-(CH2)m-X-NH-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 and X is optionally a carbonyl group (C=0) that can be present or absent.
[00504] In some embodiments, the semicarbazide-containing PEG derivative will have the structure:
RO-(CH2CH20)n -0-(CH2)m-NH-C(0)-NH-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000.
[00505] In another embodiment of the invention, an antigen-binding polypeptide comprising a carbonyl-containing amino acid is modified with a PEG derivative that contains a terminal hydroxylamine, hydrazide, hydrazine, or semicarbazide moiety that is linked to the PEG backbone by means of an amide linkage.
[00506] In some embodiments, the hydroxylamine-terminal PEG derivatives have the structure:
RO-(CH2CH20)n-0-(CH2)2-NH-C(0)(CH2)m-0-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000 (i.e., average molecular weight is between 5-40 kDa).
[00507] In some embodiments, the hydrazine- or hydrazide-containing PEG derivatives have the structure:
RO-(CH2CH20)n-0-(CH2)2-NH-C(0)(CH2)m-X-NH-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, n is 100-1 ,000 and X is optionally a carbonyl group (C=0) that can be present or absent.
[00508] In some embodiments, the semicarbazide-containing PEG derivatives have the structure:
RO-(CH2CH20)n-0-(CH2)2-NH-C(0)(CH2)m-NH-C(0)-NH-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1 ,000.
[00509] In another embodiment of the invention, a PSMC comprising a carbonyl- containing amino acid is modified with a branched PEG derivative that contains a terminal hydrazine, hydroxylamine, hydrazide or semicarbazide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa.
[00510] In another embodiment of the invention, a PSMC comprising a non-naturally encoded amino acid is modified with a PEG derivative having a branched structure. For instance, in some embodiments, the hydrazine- or hydrazide-terminal PEG derivative will have the following structure:
[RO-(CH2CH20)n-0-(CH2)2-NH-C(0)]2CH(CH2)m-X-NH-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1,000, and X is optionally a carbonyl group (C=0) that can be present or absent.
[00511] In some embodiments, the PEG derivatives containing a semicarbazide group will have the structure:
[RO-(CH2CH20)n-0-(CH2)2-C(0)-NH-CH2-CH2]2CH-X-(CH2)m-NH-C(0)-NH-NH2 where R is a simple alkyl (methyl, ethyl, propyl, etc.), X is optionally NH, O, S, C(O) or not present, m is 2-10 and n is 100-1,000.
[00512] In some embodiments, the PEG derivatives containing a hydroxylamine group will have the structure:
[RO-(CH2CH20)n-0-(CH2)2-C(0)-NH-CH2-CH2]2CH-X-(CH2)m-0-NH2
where R is a simple alkyl (methyl, ethyl, propyl, etc.), X is optionally NH, O, S, C(O) or not present, m is 2-10 and n is 100-1 ,000.
[00513] The degree and sites at which the water soluble polymer(s) are linked to the PSMC can modulate the binding of the PSMC to an antigen or receptor.
[00514] Methods and chemistry for activation of polymers as well as for conjugation of peptides are described in the literature and are known in the art. Commonly used methods for activation of polymers include, but are not limited to, activation of functional groups with cyanogen bromide, periodate, glutaraldehyde, biepoxides, epichlorohydrin, divinylsulfone,
carbodiimide, sulfonyl halides, trichlorotriazine, etc. {see, R. F. Taylor, (1991), PROTEIN IMMOBILISATION. FUNDAMENTAL AND APPLICATIONS, Marcel Dekker, N.Y.; S. S. Wong, (1992), CHEMISTRY OF PROTEIN CONJUGATION AND CROSSLINKING, CRC Press, Boca Raton; G. T. Hermanson et al , (1993), IMMOBILIZED AFFINITY LIGAND TECHNIQUES, Academic Press, N.Y.; Dunn, R.L., et al, Eds. POLYMERIC DRUGS AND DRUG DELIVERY SYSTEMS, ACS Symposium Series Vol. 469, American Chemical Society, Washington, D.C. 1991).
[00515] Several reviews and monographs on the functionalization and conjugation of PEG are available. See, for example, Harris, Macronol. Chem. Phys. C25: 325-373 (1985); Scouten, Methods in Enzymology 135: 30-65 (1987); Wong et al, Enzyme Microb. Technol. 14: 866-874 (1992); Delgado et al, Critical Reviews in Therapeutic Drug Carrier Systems 9: 249-304 (1992); Zalipsky, Bioconjugate Chem. 6: 150-165 (1995).
[00516] Methods for activation of polymers can also be found in WO 94/17039, U.S. Pat. No. 5,324,844, WO 94/18247, WO 94/04193, U.S. Pat. No. 5,219,564, U.S. Pat. No. 5,122,614, WO 90/13540, U.S. Pat. No. 5,281 ,698, and WO 93/15189, and for conjugation between activated polymers and enzymes including but not limited to Coagulation Factor VIII (WO 94/15625), hemoglobin (WO 94/09027), oxygen carrying molecule (U.S. Pat. No. 4,412,989), ribonuclease and superoxide dismutase (Veronese at al, App. Biochem. Biotech. 1 1 : 141-45 (1985)). All references and patents cited are incorporated by reference herein.
[00517] PEGylation (i.e., addition of any water soluble polymer) of antigen-binding polypeptides containing a non-naturally encoded amino acid, such as -azido-L- phenylalanine, is carried out by any convenient method. For example, PSMC is PEGylated with an alkyne-terminated mPEG derivative. Briefly, an excess of solid mPEG(5000)-O- CH2-C≡CH is added, with stirring, to an aqueous solution of -azido-L-Phe-containing PSMC at room temperature. Typically, the aqueous solution is buffered with a buffer having a p a near the pH at which the reaction is to be carried out (generally about pH 4-10). Examples of suitable buffers for PEGylation at pH 7.5, for instance, include, but are not limited to, HEPES, phosphate, borate, TRIS-HCl, EPPS, and TES. The pH is continuously monitored and adjusted if necessary. The reaction is typically allowed to continue for between about 1-48 hours.
[00518] The reaction products are subsequently subjected to hydrophobic interaction chromatography to separate the PEGylated PSMC variants from free mPEG(5000)-O-CH2- C≡CH and any high-molecular weight complexes of the pegylated PSMC which may form
when unblocked PEG is activated at both ends of the molecule, thereby crosslinking PSMC variant molecules. The conditions during hydrophobic interaction chromatography are such that free mPEG(5000)-O-CH2-C≡CH flows through the column, while any crosslinked PEGylated PSMC variant complexes elute after the desired forms, which contain one PSMC variant molecule conjugated to one or more PEG groups. Suitable conditions vary depending on the relative sizes of the cross-linked complexes versus the desired conjugates and are readily determined by those skilled in the art. The eluent containing the desired conjugates is concentrated by ultrafiltration and desalted by diafiltration.
[00519] If necessary, the PEGylated PSMC obtained from the hydrophobic chromatography can be purified further by one or more procedures known to those skilled in the art including, but are not limited to, affinity chromatography; anion- or cation-exchange chromatography (using, including but not limited to, DEAE SEPHAROSE); chromatography on silica; reverse phase HPLC; gel filtration (using, including but not limited to, SEPHADEX G-75); hydrophobic interaction chromatography; size-exclusion chromatography, metal- chelate chromatography; ultrafiltration/diafiltration; ethanol precipitation; ammonium sulfate precipitation; chromatofocusing; displacement chromatography; electrophoretic procedures (including but not limited to preparative isoelectric focusing), differential solubility (including but not limited to ammonium sulfate precipitation), or extraction. Apparent molecular weight may be estimated by GPC by comparison to globular protein standards (PROTEIN PURIFICATION METHODS, A PRACTICAL APPROACH (Harris & Angal, Eds.) IRL Press 1989, 293-306). The purity of the PSMC-PEG conjugate can be assessed by proteolytic degradation (including but not limited to, trypsin cleavage) followed by mass spectrometry analysis. Pepinsky B., et al, J. Pharmcol. & Exp. Ther. 297(3): 1059-66 (2001).
[00520] A water soluble polymer linked to an amino acid of a PSMC of the invention can be further derivatized or substituted without limitation.
Azide-containing PEG derivatives
[00521] In another embodiment of the invention, an antigen-binding polypeptide is modified with a PEG derivative that contains an azide moiety that will react with an alkyne moiety present on the side chain of the non-naturally encoded amino acid. In general, the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
[00522] In some embodiments, the azide-terminal PEG derivative will have the structure:
RO-(CH2CH20)n-0-(CH2)m-N3
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1 ,000 (i.e., average molecular weight is between 5-40 kDa).
[00523] In another embodiment, the azide-terminal PEG derivative will have the structure:
RO-(CH2CH20)n -0-(CH2)m-NH-C(0)-(CH2)p-N3
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10 and n is 100-1 ,000 (i.e., average molecular weight is between 5-40 kDa).
[00524] In another embodiment of the invention, a PSMC comprising a alkyne- containing amino acid is modified with a branched PEG derivative that contains a terminal azide moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa. For instance, in some embodiments, the azide-terminal
PEG derivative will have the following structure:
[RO-(CH2CH20)n-0-(CH2)2-NH-C(0)]2CH(CH2)m-X-(CH2)pN3
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10, and n is 100-
1 ,000, and X is optionally an O, N, S or carbonyl group (C=0), in each case that can be present or absent.
Alkyne-containing PEG derivatives
[00525] In another embodiment of the invention, an antigen-binding polypeptide is modified with a PEG derivative that contains an alkyne moiety that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid.
[00526] In some embodiments, the alkyne-terminal PEG derivative will have the following structure:
RO-(CH2CH20)n-0-(CH2)m-C≡CH
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10 and n is 100-1 ,000 (i.e., average molecular weight is between 5-40 kDa).
[00527] In another embodiment of the invention, an antigen-binding polypeptide comprising an alkyne-containing non-naturally encoded amino acid is modified with a PEG derivative that contains a terminal azide or terminal alkyne moiety that is linked to the PEG backbone by means of an amide linkage.
[00528] In some embodiments, the alkyne-terminal PEG derivative will have the following structure:
RO-(CH2CH20)n -0-(CH2)m-NH-C(0)-(CH2)p-C≡CH
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10 and n is 100-1,000.
[00529] In another embodiment of the invention, an antigen-binding polypeptide comprising an azide-containing amino acid is modified with a branched PEG derivative that contains a terminal alkyne moiety, with each chain of the branched PEG having a MW ranging from 10-40 kDa and, more preferably, from 5-20 kDa. For instance, in some embodiments, the alkyne-terminal PEG derivative will have the following structure:
[RO-(CH2CH20)n-0-(CH2)2-NH-C(0)]2CH(CH2)m-X-(CH2)p C≡CH
where R is a simple alkyl (methyl, ethyl, propyl, etc.), m is 2-10, p is 2-10, and n is 100- 1 ,000, and X is optionally an O, N, S or carbonyl group (C=0), or not present.
Phosphine-containing PEG derivatives
[00530] In another embodiment of the invention, an antigen-binding polypeptide is modified with a PEG derivative that contains an activated functional group (including but not limited to, ester, carbonate) further comprising an aryl phosphine group that will react with an azide moiety present on the side chain of the non-naturally encoded amino acid. In general, the PEG derivatives will have an average molecular weight ranging from 1-100 kDa and, in some embodiments, from 10-40 kDa.
wherein n is 1-10; X can be O, N, S or not present, Ph is phenyl, and W is a water soluble polymer.
wherein X can be O, N, S or not present, Ph is phenyl, W is a water soluble polymer and R can be H, alkyl, aryl, substituted alkyl and substituted aryl groups. Exemplary R groups include but are not limited to -CH2, -C(CH3) 3, -OR', -NR'R", -SR', -halogen, -C(0)R', - CONR'R", -S(0)2R', -S(0)2NR'R", -CN and -N02. R', R", R'" and R"" each independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted aryl, including but not limited to, aryl substituted with 1-3 halogens, substituted or unsubstituted alkyl, alkoxy or thioalkoxy groups, or arylalkyl groups. When a compound of the invention includes more than one R group, for example, each of the R groups is independently selected as are each R', R", R'" and R"" groups when more than one of these groups is present. When
R' and R" are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 5-, 6-, or 7-membered ring. For example, -NR'R" is meant to include, but not be limited to, 1-pyrrolidinyl and 4-morpholinyl. From the above, discussion of substituents, one of skill in the art will understand that the term "alkyl" is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (including but not limited to, -CF3 and -CH2CF3) and acyl (including but not limited to, - C(0)CH3, -C(0)CF3, -C(0)CH2OCH3, and the like).
Other PEG derivatives and General PEGylation techniques
[00533] Other exemplary PEG molecules that may be linked to antigen-binding polypeptides, as well as PEGylation methods include those described in, e.g., U.S. Patent
Publication No. 2004/0001838; 2002/0052009; 2003/0162949; 2004/0013637;
2003/0228274; 2003/0220447; 2003/0158333; 2003/0143596; 2003/01 14647; 2003/0105275;
2003/0105224; 2003/0023023; 2002/0156047; 2002/0099133; 2002/0086939; 2002/0082345;
2002/0072573; 2002/0052430; 2002/0040076; 2002/0037949; 2002/0002250; 2001/0056171 ; 2001/0044526; 2001/0027217; 2001/0021763; U.S. Patent No. 6,646,1 10; 5,824,778;
5,476,653; 5,219,564; 5,629,384; 5,736,625; 4,902,502; 5,281,698; 5,122,614; 5,473,034;
5,516,673; 5,382,657; 6,552,167; 6,610,281 ; 6,515,100; 6,461,603; 6,436,386; 6,214,966;
5,990,237; 5,900,461 ; 5,739,208; 5,672,662; 5,446,090; 5,808,096; 5,612,460; 5,324,844;
5,252,714; 6,420,339; 6,201,072; 6,451,346; 6,306,821 ; 5,559,213; 5,612,460; 5,747,646; 5,834,594; 5,849,860; 5,980,948; 6,004,573; 6,129,912; WO 97/32607, EP 229,108, EP
402,378, WO 92/16555, WO 94/04193, WO 94/14758, WO 94/17039, WO 94/18247, WO
94/28024, WO 95/00162, WO 95/1 1924, WO95/13090, WO 95/33490, WO 96/00080, WO
97/18832, WO 98/41562, WO 98/48837, WO 99/32134, WO 99/32139, WO 99/32140, WO
96/40791 , WO 98/32466, WO 95/06058, EP 439 508, WO 97/03106, WO 96/21469, WO 95/13312, EP 921 131, , WO 98/05363, EP 809 996, WO 96/41813, WO 96/07670, EP 605
963, EP 510 356, EP 400 472, EP 183 503 and EP 154 316, which are incorporated by reference herein. Any of the PEG molecules described herein may be used in any form, including but not limited to, single chain, branched chain, multiarm chain, single functional, bi-functional, multi-functional, or any combination thereof.
Enhancing affinity for serum albumin
[00534] Various molecules can also be fused to the antigen-binding polypeptides of the invention to modulate the half-life of PSMC in serum. In some embodiments, molecules are
linked or fused to antigen-binding polypeptides of the invention to enhance affinity for endogenous serum albumin in an animal.
[00535] For example, in some cases, a recombinant fusion of an antigen-binding polypeptide and an albumin binding sequence is made. Exemplary albumin binding sequences include, but are not limited to, the albumin binding domain from streptococcal protein G (see. e.g., Makrides et al, J. Pharmacol. Exp. Ther. 277:534-542 (1996) and Sjolander et al, J Immunol. Methods 201 : 1 15-123 (1997)), or albumin-binding peptides such as those described in, e.g., Dennis, et al. , J. Biol. Chem. 277:35035-35043 (2002).
[00536] In other embodiments, the antigen-binding polypeptides of the present invention are acylated with fatty acids. In some cases, the fatty acids promote binding to serum albumin. See, e.g. , Kurtzhals, et al , Biochem. J. 312:725-731 (1995).
[00537] In other embodiments, the antigen-binding polypeptides of the invention are fused directly with serum albumin (including but not limited to, human serum albumin). Those of skill in the art will recognize that a wide variety of other molecules can also be linked to PSMC in the present invention to modulate binding to serum albumin or other serum components.
X. Glycosylation of PSMC
[00538] The invention includes antigen-binding polypeptides incorporating one or more non-naturally encoded amino acids bearing saccharide residues. The saccharide residues may be either natural (including but not limited to, N-acetylglucosamine) or non-natural (including but not limited to, 3-fluorogalactose). The saccharides may be linked to the non- naturally encoded amino acids either by an N- or O-linked glycosidic linkage (including but not limited to, N-acetylgalactose-L-serine) or a non-natural linkage (including but not limited to, an oxime or the corresponding C- or S-linked glycoside).
[00539] The saccharide (including but not limited to, glycosyl) moieties can be added to antigen-binding polypeptides either in vivo or in vitro. In some embodiments of the invention, a nantigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified with a saccharide derivatized with an aminooxy group to generate the corresponding glycosylated polypeptide linked via an oxime linkage. Once attached to the non-naturally encoded amino acid, the saccharide may be further elaborated by treatment with glycosyltransferases and other enzymes to generate an oligosaccharide bound to the antigen-binding polypeptide. See, e.g., H. Liu, et al. J. Am. Chem. Soc. 125: 1702-1703 (2003).
[00540] In some embodiments of the invention, an antigen-binding polypeptide comprising a carbonyl-containing non-naturally encoded amino acid is modified directly with a glycan with defined structure prepared as an aminooxy derivative. One skilled in the art will recognize that other functionalities, including azide, alkyne, hydrazide, hydrazine, and semicarbazide, can be used to link the saccharide to the non-naturally encoded amino acid.
[00541] In some embodiments of the invention, an antigen-binding polypeptide comprising an azide or alkynyl-containing non-naturally encoded amino acid can then be modified by, including but not limited to, a Huisgen [3+2] cycloaddition reaction with, including but not limited to, alkynyl or azide derivatives, respectively. This method allows for proteins to be modified with extremely high selectivity.
XI. PSMC Dimers and Multimers
[00542] The present invention also provides for PSMC combinations including but not limited to PSMC homodimers, heterodimers, homomultimers, or heteromultimers (i.e., trimers, tetramers, etc.) where a PSMC polypeptide containing one or more non-naturally encoded amino acids is bound to another PSMC or variant thereof or any other polypeptide that is non-PSMC polypeptide or variant thereof, either directly to the polypeptide backbone or via a linker. Due to its increased molecular weight compared to monomers, the PSMC dimer or multimer conjugates may exhibit new or desirable properties, including but not limited to different pharmacological, pharmacokinetic, pharmacodynamic, modulated therapeutic half-life, or modulated plasma half-life relative to the monomeric PSMC. In some embodiments, the PSMC dimers of the invention will modulate the dimerization of the PSMC receptor. In other embodiments, the PSMC dimers or multimers of the present invention will act as a PSMC receptor antagonist, agonist, or modulator.
[00543] In some embodiments, one or more of PSMC present in a PSMC containing dimer or multimer comprises a non-naturally encoded amino acid linked to a water soluble polymer. In some embodiments, the PSMCs are linked directly, including but not limited to, via an Asn-Lys amide linkage or Cys-Cys disulfide linkage. In some embodiments, the linked PSMCs, and/or the linked non-PSMC polypeptide, will comprise different non- naturally encoded amino acids to facilitate dimerization, including but not limited to, an alkyne in one non-naturally encoded amino acid of a first PSMC and an azide in a second non-naturally encoded amino acid of a second PSMC will be conjugated via a Huisgen [3+2] cycloaddition. Alternatively, a first PSMC, and/or the linked non-PSMC polypeptide comprising a ketone-containing non-naturally encoded amino acid can be conjugated to a
second PSMC polypeptide comprising a hydroxylamine-containing non-naturally encoded amino acid and the polypeptides are reacted via formation of the corresponding oxime.
[00544] Alternatively, the two PSMCs, and/or the linked non- PSMC polypeptide, are linked via a linker. Any hetero- or homo-bifunctional linker can be used to link the two PSMCs, and/or the linked non- PSMC polypeptides, which can have the same or different primary sequence. In some cases, the linker used to tether the PSMC, and/or the linked non- PSMC polypeptides together can be a bifunctional PEG reagent. The linker may have a wide range of molecular weight or molecular length. Larger or smaller molecular weight linkers may be used to provide a desired spatial relationship or conformation between the PSMC and the linked entity. Linkers having longer or shorter molecular length may also be used to provide a desired space or flexibility between the PSMC and the linked entity. Similarly, a linker having a particular shape or conformation may be utilized to impart a particular shape or conformation to the PSMC or the linked entity, either before or after the PSMC reaches its target. The functional groups present on each end of the linker may be selected to modulate the release of a PSMC or a non-PSMC polypeptide under desired conditions. This optimization of the spatial relationship between the PSMC and the linked entity may provide new, modulated, or desired properties to the molecule.
[00545] In some embodiments, the invention provides water-soluble bifunctional linkers that have a dumbbell structure that includes: a) an azide, an alkyne, a hydrazine, a hydrazide, a hydroxylamine, or a carbonyl-containing moiety on at least a first end of a polymer backbone; and b) at least a second functional group on a second end of the polymer backbone. The second functional group can be the same or different as the first functional group. The second functional group, in some embodiments, is not reactive with the first functional group. The invention provides, in some embodiments, water-soluble compounds that comprise at least one arm of a branched molecular structure. For example, the branched molecular structure can be dendritic.
[00546] In some embodiments, the invention provides multimers comprising one or more PSMC formed by reactions with water soluble activated polymers that have the structure:
R-(CH2CH20)n-0-(CH2)m-X
wherein n is from about 5 to 3,000, m is 2-10, X can be an azide, an alkyne, a hydrazine, a hydrazide, an aminooxy group, a hydroxylamine, a acetyl, or carbonyl-containing moiety, and R is a capping group, a functional group, or a leaving group that can be the same or
different as X. R can be, for example, a functional group selected from the group consisting of hydroxyl, protected hydroxyl, alkoxyl, N-hydroxysuccinimidyl ester, 1 -benzotriazolyl ester, N-hydroxysuccinimidyl carbonate, 1 -benzotriazolyl carbonate, acetal, aldehyde, aldehyde hydrates, alkenyl, acrylate, methacrylate, acrylamide, active sulfone, amine, aminooxy, protected amine, hydrazide, protected hydrazide, protected thiol, carboxylic acid, protected carboxylic acid, isocyanate, isothiocyanate, maleimide, vinylsulfone, dithiopyridine, vinylpyridine, iodoacetamide, epoxide, glyoxals, diones, mesylates, tosylates, and tresylate, alkene, and ketone.
XII. Measurement of PSMC Activity and Affinity of PSMC for the PSMC Antigen or Binding Partner
[00547] PSMC activity can be determined using standard in vitro or in vivo assays.
For example, cells or cell lines that bind PSMC (including but not limited to, cells containing native PSMC antigen or binding partner or recombinant PSMC antigen or binding partner producing cells) can be used to monitor PSMC binding. For a non-PEGylated or PEGylated antigen-binding polypeptide comprising a non-natural amino acid, the affinity of the PSMC for its antigen or binding partner can be measured by using techniques known in the art such as a BIAcore™ biosensor (Pharmacia).
[00548] Regardless of which methods are used to create the PSMC's, the PSMC's are subject to assays for biological activity. Tritiated thymidine assays may be conducted to ascertain the degree of cell division, if appropriate. Other biological assays, however, may be used to ascertain the desired activity. Biological assays such as measuring the ability to inhibit an antigen's biological activity, such as an enzymatic, proliferative, or metabolic activity also provides an indication of PSMC activity. Other in vitro assays may be used to ascertain biological activity. In general, the test for biological activity should provide analysis for the desired result, such as increase or decrease in biological activity (as compared to non-altered PSMC), different biological activity (as compared to non-altered PSMC), receptor affinity analysis, conformational or structural changes, or serum half-life analysis, as appropriate for the antigen's biological activity.
[00549] The above compilation of references for assay methodologies is not exhaustive, and those skilled in the art will recognize other assays useful for testing for the desired end result.
XIII. Measurement of Potency, Functional In Vivo Half-Life, and Pharmacokinetic Parameters
[00550] An important aspect of the invention is the prolonged biological half-life that is obtained by construction of PSMC with or without conjugation of the PSMC to a water soluble polymer moiety. The rapid decrease of PSMC serum concentrations has made it important to evaluate biological responses to treatment with conjugated and non-conjugated PSMC and variants thereof. Preferably, the conjugated and non-conjugated PSMC and variants thereof of the present invention have prolonged serum half-lives also after i.v. administration, making it possible to measure by, e.g. ELISA method or by a primary screening assay. Measurement of in vivo biological half-life is carried out as described herein.
[00551] Pharmacokinetic parameters for an antigen-binding polypeptide comprising a non-naturally encoded amino acid can be evaluated in normal Sprague-Dawley male rats (N=5 animals per treatment group). Animals will receive either a single dose of 25 ug/rat iv or 50 ug/rat sc, and approximately 5-7 blood samples will be taken according to a pre-defined time course, generally covering about 6 hours for a n antigen-binding polypeptide comprising a non-naturally encoded amino acid not conjugated to a water soluble polymer and about 4 days for an antigen-binding polypeptide comprising a non-naturally encoded amino acid and conjugated to a water soluble polymer. Pharmacokinetic data for PSMC is well-studied in several species and can be compared directly to the data obtained for PSMC comprising a non-naturally encoded amino acid.
[00552] The specific activity of PSMC in accordance with this invention can be determined by various assays known in the art. The biological activity of the PSMC muteins, or fragments thereof, obtained and purified in accordance with this invention can be tested by methods described or referenced herein or known to those skilled in the art.
XIV. Administration and Pharmaceutical Compositions
[00553] The polypeptides or proteins of the invention (including but not limited to, PSMC, synthetases, proteins comprising one or more unnatural amino acid, etc.) are optionally employed for therapeutic uses, including but not limited to, in combination with a suitable pharmaceutical carrier. Such compositions, for example, comprise a therapeutically effective amount of the compound, and a pharmaceutically acceptable carrier or excipient. Such a carrier or excipient includes, but is not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and/or combinations thereof. The formulation is made to suit the
mode of administration. In general, methods of administering proteins are well known in the art and can be applied to administration of the polypeptides of the invention.
[00554] Therapeutic compositions comprising one or more polypeptide of the invention are optionally tested in one or more appropriate in vitro and/or in vivo animal models of disease, to confirm efficacy, tissue metabolism, and to estimate dosages, according to methods well known in the art. In particular, dosages can be initially determined by activity, stability or other suitable measures of unnatural herein to natural amino acid homologues (including but not limited to, comparison of a PSMC modified to include one or more unnatural amino acids to a natural amino acid PSMC), i.e., in a relevant assay.
[00555] Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells. The unnatural amino acid polypeptides of the invention are administered in any suitable manner, optionally with one or more pharmaceutically acceptable carriers. Suitable methods of administering such polypeptides in the context of the present invention to a patient are available, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective action or reaction than another route.
[00556] Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present invention.
[00557] Polypeptide compositions can be administered by a number of routes including, but not limited to oral, intravenous, intraperitoneal, intramuscular, transdermal, subcutaneous, topical, sublingual, or rectal means. Compositions comprising non-natural amino acid polypeptides, modified or unmodified, can also be administered via liposomes. Such administration routes and appropriate formulations are generally known to those of skill in the art.
[00558] The PSMC comprising a non-natural amino acid, alone or in combination with other suitable components, can also be made into aerosol formulations (i.e., they can be "nebulized") to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.
[00559] Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal, intraperitoneal, and
subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The formulations of packaged PSMC can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.
[00560] Parenteral administration and intravenous administration are preferred methods of administration. In particular, the routes of administration already in use for natural amino acid homologue therapeutics (including but not limited to, those typically used for EPO, GH, PSMC, G-CSF, GM-CSF, IFNs, interleukins, antibodies, and/or any other pharmaceutically delivered protein), along with formulations in current use, provide preferred routes of administration and formulation for the polypeptides of the invention.
[00561] The dose administered to a patient, in the context of the present invention, is sufficient to have a beneficial therapeutic response in the patient over time, or, including but not limited to, to inhibit infection by a pathogen, or other appropriate activity, depending on the application. The dose is determined by the efficacy of the particular vector, or formulation, and the activity, stability or serum half-life of the unnatural amino acid polypeptide employed and the condition of the patient, as well as the body weight or surface area of the patient to be treated. The size of the dose is also determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, formulation, or the like in a particular patient.
[00562] In determining the effective amount of the vector or formulation to be administered in the treatment or prophylaxis of disease (including but not limited to, cancers, inherited diseases, diabetes, AIDS, or the like), the physician evaluates circulating plasma levels, formulation toxicities, progression of the disease, and/or where relevant, the production of anti- unnatural amino acid polypeptide antibodies.
[00563] The dose administered, for example, to a 70 kilogram patient, is typically in the range equivalent to dosages of currently-used therapeutic proteins, adjusted for the altered activity or serum half-life of the relevant composition. The vectors of this invention can supplement treatment conditions by any known conventional therapy, including antibody administration, vaccine administration, administration of cytotoxic agents, natural amino acid polypeptides, nucleic acids, nucleotide analogues, biologic response modifiers, and the like.
[00564] For administration, formulations of the present invention are administered at a rate determined by the LD-50 or ED-50 of the relevant formulation, and/or observation of any side-effects of the unnatural amino acids at various concentrations, including but not limited to, as applied to the mass and overall health of the patient. Administration can be accomplished via single or divided doses.
[00565] If a patient undergoing infusion of a formulation develops fevers, chills, or muscle aches, he/she receives the appropriate dose of aspirin, ibuprofen, acetaminophen or other pain/fever controlling drug. Patients who experience reactions to the infusion such as fever, muscle aches, and chills are premedicated 30 minutes prior to the future infusions with either aspirin, acetaminophen, or, including but not limited to, diphenhydramine. Meperidine is used for more severe chills and muscle aches that do not quickly respond to antipyretics and antihistamines. Cell infusion is slowed or discontinued depending upon the severity of the reaction.
[00566] Human antigen-binding polypeptides of the invention can be administered directly to a mammalian subject. Administration is by any of the routes normally used for introducing PSMC to a subject. The PSMC compositions according to embodiments of the present invention include those suitable for oral, rectal, topical, inhalation (including but not limited to, via an aerosol), buccal (including but not limited to, sub-lingual), vaginal, parenteral (including but not limited to, subcutaneous, intramuscular, intradermal, intraarticular, intrapleural, intraperitoneal, inracerebral, intraarterial, or intravenous), topical (i.e., both skin and mucosal surfaces, including airway surfaces) and transdermal administration, although the most suitable route in any given case will depend on the nature and severity of the condition being treated. Administration can be either local or systemic. The formulations of compounds can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials. PSMC of the invention can be prepared in a mixture in a unit dosage injectable form (including but not limited to, solution, suspension, or emulsion) with a pharmaceutically acceptable carrier. PSMC of the invention can also be administered by continuous infusion (using, including but not limited to, minipumps such as osmotic pumps), single bolus or slow-release depot formulations.
[00567] Formulations suitable for administration include aqueous and non-aqueous solutions, isotonic sterile solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and
preservatives. Solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described.
[00568] The pharmaceutical compositions of the invention may comprise a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions (including optional pharmaceutically acceptable carriers, excipients, or stabilizers) of the present invention {see, e.g., Remington 's Pharmaceutical Sciences, 17th ed. 1985)).
[00569] Suitable carriers include buffers containing phosphate, borate, HEPES, citrate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates, including glucose, mannose, or dextrins; chelating agents such as EDTA; divalent metal ions such as zinc, cobalt, or copper; sugar alcohols such as mannitol or sorbitol; salt-forming counter ions such as sodium; and/or nonionic surfactants such as Tween™, Pluronics™, or PEG.
[00570] PSMC's of the invention, including those linked to water soluble polymers such as PEG can also be administered by or as part of sustained-release systems. Sustained- release compositions include, including but not limited to, semi-permeable polymer matrices in the form of shaped articles, including but not limited to, films, or microcapsules. Sustained-release matrices include from biocompatible materials such as poly(2-hydroxyethyl methacrylate) (Langer et ah, J. Biomed. Mater. Res., 15: 167-277 (1981); Langer, Chem. Tech., 12: 98-105 (1982), ethylene vinyl acetate (Langer et al, supra) or poly-D-(-)-3- hydroxybutyric acid (EP 133,988), polylactides (polylactic acid) (U.S. Patent No. 3,773,919; EP 58,481), polyglycolide (polymer of glycolic acid), polylactide co-glycolide (copolymers of lactic acid and glycolic acid) polyanhydrides, copolymers of L-glutamic acid and gamma- ethyl-L-glutamate (U. Sidman et al., Biopolymers, 22, 547-556 (1983), poly(ortho)esters, polypeptides, hyaluronic acid, collagen, chondroitin sulfate, carboxylic acids, fatty acids, phospholipids, polysaccharides, nucleic acids, polyamino acids, amino acids such as phenylalanine, tyrosine, isoleucine, polynucleotides, polyvinyl propylene, polyvinylpyrrolidone and silicone. Sustained-release compositions also include a liposomally
entrapped compound. Liposomes containing the compound are prepared by methods known per se: DE 3,218,121 ; Epstein et al, Proc. Natl. Acad. Sci. U.S.A., 82: 3688-3692 (1985); Hwang et al , Proc. Natl. Acad. Sci. U.S.A., 77: 4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641 ; Japanese Pat. Appln. 83-1 18008; U.S. Pat. Nos. 4,485,045 and 4,544,545; and EP 102,324. All references and patents cited are incorporated by reference herein.
[00571] Liposomally entrapped PSMC can be prepared by methods described in, e.g., DE 3,218,121 ; Epstein et al., Proc. Natl. Acad. Sci. U.S.A., 82: 3688-3692 (1985); Hwang et al, Proc. Natl. Acad. Sci. U.S.A., 77: 4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641 ; Japanese Pat. Appln. 83-1 18008; U.S. Patent Nos. 4,485,045 and 4,544,545; and EP 102,324. Composition and size of liposomes are well known or able to be readily determined empirically by one skilled in the art. Some examples of liposomes asdescribed in, e.g., Park JW, et al., Proc. Natl Acad. Sci. USA 92: 1327-1331 (1995); Lasic D and Papahadjopoulos D (eds): MEDICAL APPLICATIONS OF LIPOSOMES (1998); Drummond DC, et al , Liposomal drug delivery systems for cancer therapy, in Teicher B (ed): CANCER DRUG DISCOVERY AND DEVELOPMENT (2002); Park JW, et al , Clin. Cancer Res. 8: 1 172- 1 181 (2002); Nielsen UB, et al, Biochim. Biophys. Acta 1591(1-3): 109-1 18 (2002); Mamot C, et al, Cancer Res. 63: 3154-3161 (2003). All references and patents cited are incorporated by reference herein.
[00572] The dose administered to a patient in the context of the present invention should be sufficient to cause a beneficial response in the subject over time. Generally, the total pharmaceutically effective amount of the PSMC of the present invention administered parenterally per dose is in the range of about 0.01 μg/kg/day to about 100 μg kg, or about 0.05 mg/kg to about 1 mg/kg, of patient body weight, although this is subject to therapeutic discretion. The frequency of dosing is also subject to therapeutic discretion, and may be more frequent or less frequent than the commercially available PSMC products approved for use in humans. Generally, a PEGylated antigen-binding polypeptide of the invention can be administered by any of the routes of administration described above.
XV. Therapeutic Uses of Antigen-Binding Polypeptides of the Invention
[00573] The PSMC polypeptides of the invention are useful for treating a wide range of disorders. The pharmaceutical compositions containing the PSMC may be formulated at a strength effective for administration by various means to a human patient experiencing disorders that may be affected by PSMC agonists or antagonists, such as but not limited to,
anti-proliferatives, anti-inflammatory, or anti-virals are used, either alone or as part of a condition or disease. Average quantities of PSMC may vary and in particular should be based upon the recommendations and prescription of a qualified physician. The exact amount of PSMC is a matter of preference subject to such factors as the exact type of condition being treated, the condition of the patient being treated, as well as the other ingredients in the composition. The invention also provides for administration of a therapeutically effective amount of another active agent such as an anti-cancer chemotherapeutic agent. The amount to be given may be readily determined by one skilled in the art based upon therapy with PSMC. EXAMPLES
[00574] The following examples are offered to illustrate, but not to limit the claimed invention.
Example 1
[00575] This example describes one of the many potential sets of criteria for the selection of preferred sites of incorporation of non-naturally encoded amino acids into PSMC.
[00576] This example demonstrates how preferred sites within the antigen-binding polypeptide were selected for introduction of a non-naturally encoded amino acid. The three dimensional structure composed of two molecules of PSMC, or the secondary, tertiary, or quaternary structure of PSMC was used to determine preferred positions into which one or more non-naturally encoded amino acids could be introduced.
[00577] The following criteria were used to evaluate each position of PSMC for the introduction of a non-naturally encoded amino acid: the residue (a) should not interfere with binding of either PSMC based on structural analysis of three dimensional structures, or the secondary, tertiary, or quaternary structure of PSMC, b) should not be affected by alanine or homolog scanning mutagenesis (c) should be surface exposed and exhibit minimal van der Waals or hydrogen bonding interactions with surrounding residues, (d) may be on one or more of the exposed faces of PSMC, (e) may be a site or sites of PSMC that are juxtaposed to a second PSMC, or other molecule or fragment thereof, (f) should be either deleted or variable in PSMC variants, (g) would result in conservative changes upon substitution with a non-naturally encoded amino acid, (h) may modulate the conformation of the PSMC itself or a dimer or multimer comprising one or more PSMC, by altering the flexibility or rigidity of the complete structure as desired, (i) could be found in either highly flexible regions or
structurally rigid regions and (j) are found in complementarity determining regions (CDR) or not. In addition, further calculations were performed on the PSMC molecule, utilizing the Cx program (Pintar et al. Bioinformatics, 18, pp 980) to evaluate the extent of protrusion for each protein atom. As a result, in some embodiments, the non-naturally encoded encoded amino acid is substituted at, but not limited to, one or more positions of PSMC.
Example 2
[00578] This example details cloning and expression of PSMC including a non- naturally encoded amino acid in E. coli.
[00579] An introduced translation system that comprises an orthogonal tRNA (O- tRNA) and an orthogonal aminoacyl tRNA synthetase (O-RS) is used to express PSMC containing a non-naturally encoded amino acid. The O-RS preferentially aminoacylates the O-tRNA with a non-naturally encoded amino acid. In turn the translation system inserts the non-naturally encoded amino acid into PSMC, in response to an encoded selector codon. Table 2: O-RS and O-tRNA sequences
[00580] The transformation of E. coli with plasmids containing the modified PSMC gene and the orthogonal aminoacyl tRNA synthetase/tRNA pair (specific for the desired non- naturally encoded amino acid) allows the site-specific incorporation of non-naturally encoded amino acid into the PSMC. The transformed E. coli, grown at 37° C in media containing between 0.01 - 100 mM of the particular non-naturally encoded amino acid, expresses modified PSMC with high fidelity and efficiency. The His-tagged PSMC containing a non- naturally encoded amino acid is produced by the Ε. coli host cells as inclusion bodies or aggregates. The aggregates are solubilized and affinity purified under denaturing conditions in 6M guanidine HC1. Refolding is performed by dialysis at 4°C overnight in 50mM TRIS- HC1, pH8.0, 40μΜ CuS04, and 2% (w/v) Sarkosyl. The material is then dialyzed against 20mM TRIS-HCl, pH 8.0, lOOmM NaCl, 2mM CaCl2, followed by removal of the His-tag. See Boissel et al., (1993) 268: 15983-93. Methods for purification of PSMC are well known in the art and are confirmed by SDS-PAGE, Western Blot analyses, or electrospray-ionization ion trap mass spectrometry and the like.
Expression Constructs
[00581] Periplasmic scFv-108: The variable regions (VL and VH) of the EGFR- specific monoclonal antibody mAbl 08 (U.S. Patent Number 6,217,866 which is incorporated by reference herein) were cloned as a scFv fragment with (GGGGS)4 linker sequence downstream of a yeast BGL2 (C7) periplasmic leader sequence (Humphreys, DP et al. Protein Expr Purif. 2000 Nov;20(2):252-64). An epitope sequence recognized by the c-myc antibody as well as a 6X-His tag were cloned downstream of the VL domain. The wild type scFv-108 construct, as well as variants containing the amber stop codon (TAG) in the VL domain (see Figure 2, Panel A) were cloned into an E. coli expression vector under the control of an inducible promoter. This plasmid also constitutively expressed an amber suppressor tyrosyl tRNATyr CUA from Methanococcus jannaschii {Mj tRNATyr CUA). Locations of the amber stop codons are indicated. The construct made is shown Tables 3 and 4.
Table 3:
Myc 843-887
His 888-905
TAA 906-908
Table 4:
[00582] Cytoplasmic scFv-108: VH-linker-VL (VH-GlySer-VL) sequences containing an N-terminal MetGly- sequence and a 6X-His sequence were cloned into an expression vector under control of the T7 promoter (see Figure 2, Panel B). Location of the amber stop codons and PEGylated residues are indicated. The construct made is in Table 5.
Table 5:
[00583] Fab-108: The VL and VH sequences of mAbl08 were cloned into pFT3, a plasmid encoding the g3 (VL) and STII (VH) periplasmic leader sequences, as well as the human κ constant and CHI domains. The C-terminus of the CHI domain contained a 6-His tag to facilitate purification. Amber mutations were introduced into the CHI domain, and the entire bicistronic cassette was cloned into the expression plasmid that constitutively expressed an amber suppressor tyrosyl tRNATyr CUA from Methanococcus jannaschii {Mj tR ATyr CUA) (see Figure 2, Panel C). The two Shine Delgarno sequences (SD) driving
translation of the VL and VH domains of the Fab fragment are shown. The construct made is shown a translated protein sequence of VL Kappa chain of Fab 108 and VH-CH1 chain of Fab 108 and is described in Table 6. Table 6:
[00584] Periplasmic scFv-4D5: The variable regions (VL and VH) of the HER2- specific monoclonal antibody mAb-4D5 (Carter, P., et. ah, Biotechnology (N Y). 1992 Feb; 10(2): 163-7) were cloned as scFv fragments downstream of a yeast BGL2 (C7) periplasmic leader sequence. A 6X-His tag was cloned either at the C-terminus of the VL sequence (scFv-4D5-His; Figure 2, Panel D), or at the N-terminus of the VH domain (His- scFv-4D5; Figure 2, Panel E). The wild type scFv-4D5 constructs, as well as a variant containing the amber stop codon (TAG) in the GlySer linker domain were cloned into the E. coli expression vector that constitutively expressed an amber suppressor tyrosyl tRNATyr CUA from Methanococcus jannaschii (Mj tRNATyr/CUA). The 6X-His C terminal construct made is shown as SEQ ID NO: 25 (nucleotide sequence) and SEQ ID NO: 26 (translated protein sequence). The 6X-His N terminal construct made is shown in the tables below. The 6X-His C terminal construct is described in Table 7, and the 6X-His N terminal construct is described in Table 8.
Table 7:
VL 504-824
His 825-848
Table 8:
[00585] Fab-4D5: The VL and VH sequences of mAb 4D5 were subcloned into pFT3, a plasmid encoding the g3 and STII periplasmic leader sequences, as well as the human κ constant and CHI domains, and then were cloned into the expression plasmid that constitutively expressed an amber suppressor tyrosyl tRNATyr CUA from Methanococcus jannaschii (Mj tRNATyr/CUA). Figure 2, Panel F shows the cistron used for expression of Fab- 4D5. An amber mutation was introduced into the CHI domain of Fab 4D5 at lysine 139. This lysine corresponds to K142 in Fab 108. A Fab-4D5 construct containing an extra cysteine residue (THTCAA) at the C-terminus of the CHI domain was made by overlapping PCR (Fab-4D5-cys). The construct made is shown as translated protein sequence of VL Kappa chain of Fab 4D5; VH-CH1 chain of Fab 4D5 and described in Table 9. Table 9:
Expression/Suppression
[00586] Suppression with para-acetyl-phenylalanine (pAcF): Suppression of the amber mutations in E. coli was achieved using standard protocols known in the art. Briefly, for the
periplasmic suppression of antibody fragments in E. coli (scFv and Fab), the expression vector construct was transformed into E. coli host cells with a plasmid encoding the orthogonal tyrosyl-tRNA-synthetase from M. jannaschii (jW/TyrRS). Overnight bacterial cultures were diluted 1 : 100 into shake flasks containing either LB media (Luria-Bertani) or Superbroth, and grown at 37°C to an OD of approximately 0.8. Fab and scFv expression was induced while suppression of the amber codon was achieved by the addition of /?am-acetyl- phenylalanine (pAcF) to a final concentration of 4 mM. Cultures were incubated at 25°C overnight. Expression of wild type (lacking amber codon) scFv and Fab fragments (including Fab-4D5-cys) was performed under identical conditions. Expression/suppression of cytoplasmic scFv fragments (Figure 2, Panel B) was achieved in a similar manner.
[00587] Suppression with aa9.2: Suppression of amber mutations with a derivative of pAcF (aa 9.2) was achieved in a similar manner as pAcF, except that the orthogonal tyrosyl- tRNA-synthetase from M. jannaschii (MjTyrRS) used was specific for this amino acid. Suppression was achieved by the addition of aa9.2 (4 mM) at the time of induction.
Protein Extraction and Purification
[00588] Cells were harvested by centrifugation and resuspended in periplasmic release buffer (50 mM NaP04, 20% sucrose, ImM EDTA, pH 8.0) supplemented with 100 ug/ml of lysozyme and incubated on ice for 30 minutes. After centrifugation, antibody fragments in the supernatant were immobilized on ProBind beads (Invitrogen; Carlsbad, CA) by virtue of their His tag, the beads washed extensively with binding buffer and then the bound fragments eluted from the beads with 0.5 M imidazole. Purified fragments were dialyzed in storage buffer (50 mM HEPES, 150 mM NaCl, 10% glycerol, 5% sucrose, pH 7.8). For small scale analysis of scFv fragments expressed in the cytoplasm, E. coli from 15 ml of culture were collected by centrifugation and re-suspended in 1 ml of lysis buffer (B-PER, Pierce Biotechnology; Rockford, IL) supplemented with 10 ug/ml of DNase. The mixture was incubated at 37°C for 30 minutes, diluted to IX in Protein Loading buffer (Invitrogen; Carlsbad, CA) and analyzed by SDS-PAGE.
[00589] Figure 3, Panel A shows the suppression of amber mutations in the second serine of the GlySer linker (S 131 Am), and purification of the corresponding pAcF-containing scFv is shown (Figure 3, Panel B). The Western blot analysis shown as Figure 3, Panel A demonstrates that pAcF is required to suppress the amber stop mutation when the cells are grown either in LB or Superbroth media. The presence of pAcF does not affect expression of a scFv lacking the TAG stop codon (WT scFv-108). Figure 3, Panel B shows the purification
of pAcF-scFv 108-(S131) by immobilized metal affinity chromatography (IMAC). Estimated yield of the pAcF-containing scFv was 1.5 mg/L. Position of the scFv fragment is indicated by the arrowhead. The Coomassie gel was loaded as follows: lane 1— scFv control (1.7 ug); lane 2— IMAC pre-bind (20 ul/70 ml); lane 3— IMAC void (20 ul/70 ml); lane 4— IMAC elution (5 ul/1.3 ml); lane 5— NAP 10 buffer exchange (10 ul/1.5 ml); lane 6— IMAC beads post-elution; lane 7— scFv control (3.4 ug).
[00590] Suppression of an amber mutation in the VL chain (LI 56) during cytoplasmic expression of a scFv is shown in Figure 4. Yields were >100 mg/L of E. coli culture, and suppression of the stop codon was absolutely dependent on the presence of pAcF. Full length scFv is indicated by the arrowhead. Products truncated at the amber codon are indicated by a filled circle.
PEGylation/Dimerization of antibody fragments (1)
[00591] PEGylation: Approximately 1 mg of pAcF-scFv-108 protein was concentrated in reaction buffer (100 mM NaOAc, 150 mM NaCl, 1 mM EDTA, pH 4.0) to a final volume of 50 ul. The reaction mixture was incubated at 28°C for 32 hours with a 100-fold molar excess of mono-functional (hydroxylamine) 5K PEG (equilibrated in reaction buffer) in a final volume of 100 ul. PEGylated material was evaluated following gel electrophoresis and used directly in cell binding assays.
[00592] Dimerization: A similar procedure was used to dimerize pAcF-containing scFv-108 fragments. Briefly, the starting pAcF containing scFv fragments were concentrated to a concentration of > 5 ug/ul in reaction buffer and then incubated with a bi-functional hydroxylamine-conjugated PEG linker (364 Da). Unreactive PEG was removed by dialysis, and a fresh aliquot of pAcF-scFv fragment (1 molar protein:protein equivalence) was added to the mixture. The mixture was then incubated at 28°C for another 32 hours. The dimer was loaded onto a cation ion exchange column (SP-5PW) equilibrated with 20 mM sodium acetate (pH 4.0) and eluted over a NaCl gradient (0- 0.4M).
[00593] PEGylation and dimerization of pAcF-scFv-108 fragments is shown in Figure
5. Figure 5, Panel A shows PEGylation (5K) of pAcF-scFv-108-(L156) and pAcF-scFv-108- (S136) and dimerization of pAcF-scFv-108-(S136). The gel was loaded as follows: lane 1— pAcF-scFv-108-(L156) (5K PEG); lane 2— pAcF-scFv-108-(S 136) (5K PEG); lane 3— dimerization of pAcF-scFv-108-(S 136) (364 da PEG) linker; lane 4— dimerization of pAcF- scFv-108-(S 136); linker was not removed following the first PEGylation reaction. Position of the mono-PEGylated scFv fragments and the scFv-108-(S136) dimer are indicated by the
single and double arrowheads, respectively. The absence of dimerization in lane 4 demonstrates that scFv were not coupled through inter-molecular disulfide bond formation. Figure 5, Panel C shows that the conjugation of PEG to scFv fragments is absolutely dependent on the presence of pAcF. No PEGylation of WT scFv fragments was observed. The gel was loaded as follows: lane 1— WT scFv 108 control; lane 2— scFv WT, in reaction buffer, no PEG, 16 hours; lane 3— scFv WT + 5K PEG, in reaction buffer, 16 hours.
[00594] Figure 6 shows SDS PAGE analysis of fractions taken during cation exchange chromatography of scFv homodimers. pAcF-scFvl08-(S 131) fragments were homodimerized using a bifunctional hydroxylamine 364 dalton PEG linker. Fractions were taken at different points in the NaCl gradient (0 - 0.4 M) during cation exchange chromatography. The gel was loaded as follows: lane 1— marker, lane 2— pAcF- scFvl08(S 131)-X-pAcF-scFvl08(S 131) Fraction #1 , lane 3— pAcF-scFvl08(S131)-X-pAcF- scFvl 08(S 131) Fraction #2, lane 4— pAcF-scFvl 08(S 131)-X-pAcF-scFvl 08(S131) Fraction #3.
[00595] Figure 8, Panel A shows SDS PAGE analysis of pAcF and pAcF-PEGylated
Fab fragments. Fab- 108 fragments modified at K142, T204, and K219 are shown, and the efficiency of PEGylation is site specific. PEGylation of pAcF-containing Fab fragments was performed using hydroxylamine conjugated 5K PEG.
[00596] Figure 10, Panel A and B show suppression of an amber mutation in the second serine of the GlySer linker of the C-terminal (pAcF-scFv-4D5-His (SI 33); Figure 10, Panel A) or N-terminal (pAcF-His-scFv-4D5(S 139); Figure 10, Panel B) scFv-4D5 fragments. Expression of the scFv proteins was induced by the addition of 0.02% arabinose for either 5 hours or overnight (16 hours). Suppression of the amber mutation was achieved by the concomitant addition of aa9.2 (4 mM). The suppressed product is indicated by the arrowhead, and the truncated protein by the filled-in circle. Suppression yields of greater than 50% were achieved (1.5 mg/L). The control lane loaded with scFv 108, which runs slightly higher than scFv-4D5, is indicated (C).
[00597] Fab fragments pAcF-Fab-4D5-(K139) and Fab-4D5-cys were expressed and purified in the same manner. Figure 1 1 , Panel A shows samples resolved by SDS-PAGE under both reducing and non-reducing conditions. Fab fragment yields were as follows: pAcF-Fab-4D5-(K139), 0.37 mg/L/OD (final OD600 = 3.14) and Fab-4D5-cys 0.23 mg/L/OD (final OD6oo = 3.26). Figure 1 1, Panel B shows a Western blot of samples (5 ul) shown in Figure 1 1, Panel A using an anti-His antibody. The samples were run under non-reducing
conditions. Multimeric VH-CH1 complexes from the Fab-4D5-cys construct are indicated with arrows. No multimeric complexes were seen with pAcF-Fab-4D5-(K139).
PEGylation/Dimerization of antibody fragments (2)
[00598] PEGylation: Approximately 1 mg of pAcF-scFv-108 protein was concentrated in native reaction buffer (20 mM NaOAc, 150 mM NaCl, 1 mM EDTA, pH 4.0) and denaturing reaction buffer (20 mM NaOAc, 150 mM NaCl, 1 mM EDTA, 8 M Urea, pH 4.0) to a final volume of 50 ul. The reaction mixture was incubated at 28 °C for 32 hours with a 100-fold molar excess of mono-functional (hydroxylamine) 5K PEG (equilibrated in corresponding reaction buffers) in a final volume of 100 ul. After 16 hours, the reaction mixture was evaluated by SDS-PAGE and used directly in cell binding assays.
[00599] Conjugation of a polypeptide with a linker, polymer, biologically active molecule, or other molecule under denaturing conditions may have one or more advantages. Such advantages include, but are not limited to, easier conjugation due to the improved accessibility of the reactive group, easier refolding of the conjugated polypeptide compared to non-conjugated polypeptide, and the ability to use polypeptide at a higher concentration for conjugation than the polypeptide concentration usable under non-denaturing conditions. Denaturing conditions may be desired, for example, if the polypeptide is unstable and cannot be highly concentrated for the conjugation reaction. However, conjugation of polypeptides under denaturing conditions may result in undesirable and/or unintended sites of conjugation in polypeptides with one or more cysteines, lysines, or other amino acids upon reaction with standard cysteine-based conjugation chemistries such as maleimide chemistries, or lysine- based chemistries such as maleimide chemistries. Such undesirable and/or unintended sites of conjugation may have an impact on the activity of the conjugated polypeptide. On the other hand, polypeptides such as PSMC comprising one or more non-naturally encoded amino acids may be conjugated in a site-specific manner under denaturing conditions since the reactive groups involved in the conjugation reaction are part of a non-naturally encoded amino acid. Thus, any advantages obtained from conjugation under denaturing conditions may be exploited with the use of polypeptides comprising one or more non-naturally encoded amino acids.
[00600] Figure 5B shows SDS-PAGE analysis of PEGylated pAcF-scFv-(S 136) and control samples. The gel was loaded as follows: lane 1— pAcF-scFv-(S 136); lane 2— pAcF- scFv-(S136), incubated at 28 °C for 16 hours; lane 3-pAcF-scFv-(S136), 5 K PEG, incubated at 28°C for 16 hours, native condition; lane 4-pAcF-scFv-(S 136), 5 K PEG, incubated at 28
°C for 16 hours, denaturing condition. Arrows indicate scFv and PEGylated scFv. Figure 5C shows that the conjugation of PEG to scFv fragments is absolutely dependent on the presence of pAcF. No PEGylation of WT scFv fragments was observed. The gel was loaded as follows: lane — WT scFv 108 control; lane 2— scFv WT, in reaction buffer, no PEG, 16 hours; lane 3— scFv WT + 5K PEG, in reaction buffer, 16 hours.
[00601] Sequential dimerization: Briefly, the starting pAcF containing scFv fragments were concentrated to a concentration of 10 mg/ml in reaction buffer and then incubated with 100 fold excess of a bi-functional hydroxylamine-conjugated PEG linker (364 Da). The reaction mixture was incubated for 16 hours at 28°C. Unreactive PEG was removed by dialysis, and a fresh aliquot of pAcF-scFv fragment (1 molar protein:protein equivalence) was added to the mixture. The mixture was then incubated at 28 °C for another 32 hours. See Figure 13. The dimer was loaded onto a cation ion exchange column (SP-5PW, 20 micron) equilibrated with 20 mM sodium acetate (pH 4.0) and eluted over a NaCl gradient (0- 0.4M).
[00602] Figure 14, Panel A and B show non-reducing and reducing SDS PAGE analysis of dimerization samples. The gels were loaded as follows: lane 1— final scFv dimerization reaction mixture with 364 Da PEG bifunctional linker; lane 2— final scFv dimerization reaction control without 364 Da PEG bifunctional linker; lane3— scFv. Arrows indicate scFv dimers and scFv monomers. scFv dimers were synthesized only in the presence of the bifunctional linker. The absence of dimerization in lane 2 demonstrates that the scFv were not coupled through inter-molecular disulfide bond formation. Since no difference was observed between samples analyzed on reducing and non-reducing SDS PAGE gels, the presence of the bifunctional linker did not facilitate inter-molecular disulfide bond formation.
[00603] Dimer purification: The dimerization reaction mixture was purified using strong cation exchange column (SP-5PW, 20 micron). Buffer A: 20 mM NaOAc, pH 4.0; buffer B: 20 mM NaOAc, 1 M NaCl, pH 4.0. scFv dimer eluted at 40% B. SDS PAGE analysis (Figure 15) of the purified dimer showed that, after one column purification, the purity of the dimer was approximately 90%.
[00604] An example of a hetero-bifunctional PSMC of the present invention is shown in Figure 9. Based on the known crystal structure determined for two different antibody molecules (for example Herceptin and Omnitarg) that bind to different epitopes of the same antigen (for example ErbB2), specific amino acid positions are identified such that they fit within a certain desired selection criteria. Desired selection criteria for amino acid position in
this example include the relative proximity of one or more specific amino acid positions on each molecule. Such amino acid positions may be desired to form the hetero-bifunctional molecule shown in Figure 9 using a linker molecule. Specific amino acid positions on each molecule that fit the criteria are shown in Table 10 below, as is a linker molecule that may be used to form a hetero-bifunctional PSMC. Those of ordinary skill in the art will recognize that the list is by no means exhaustive and is merely illustrative, and that all amino acid positions that fit a certain desired selection criteria are contemplated to be suitable for use in the present invention. A non-natural amino acid of the present invention may be substituted at one or more of these positions in each molecule to provide the chemical functional groups utilized for linker attachment. A wide variety of other selection criteria may also be utilized to identify amino acid positions to fit the desired criteria, including but not limited to, proximity between the same or different molecules, conformation change modulation, distance modulation between PSMC's or molecules linked to a PSMC, linker length or shape, surface exposure, modulation of ligand binding characteristics, modulation of receptor dimerization, etc.
[00605] Based on the interaction of HIV-1 neutralizing human Fab 4E10 with HIV gp41 env protein, specific amino acid positions are identified such that they fit within a certain desired selection criteria. Desired selection criteria for amino acid position in this example include residues that would be used for conjugation of T-20 peptide to the Fab such that the binding of T-20 to gp41 occurs without a negative effect to the binding and recognition of the complementarity determining regions (CDR) of 4E10 to gp41. T-20, also
known as DP- 178, inhibits entry of HIV into cells by acting as a viral fusion inhibitor. Figure 12 shows HIV neutralizing human Fab 4E10 with a mimic g41 peptide. Potential residues for attachment of T-20 peptide are shown. Potential residues for incorporation of non-naturally encoded amino acids include, but are not limited to, Gln64~heavy chain of the Fab; Glul— light chain of the Fab, and Gln27— light chain of the Fab. Those of ordinary skill in the art will recognize that the list is by no means exhaustive and is merely illustrative, and that all amino acid positions that fit a certain desired selection criteria are contemplated to be suitable for use in the present invention. A wide variety of other selection criteria may also be utilized to identify amino acid positions to fit the desired criteria, including but not limited to, proximity between the same or different molecules, conformation change modulation, distance modulation between PSMC's or molecules linked to a PSMC, inclusion of a linker, linker length or shape, surface exposure, modulation of ligand binding characteristics, modulation of receptor dimerization, etc. Example 3
[00606] This example details introduction of a carbonyl-containing amino acid and subsequent reaction with an aminooxy-containing PEG.
[00607] This Example demonstrates a method for the generation of an antigen-binding polypeptide that incorporates a ketone-containing non-naturally encoded amino acid that is subsequently reacted with an aminooxy-containing PEG of approximately 5,000 MW. Each of the residues identified according to the criteria of Example 1 is separately substituted with a non-naturally encoded amino acid having the following structure:
[00608] The sequences utilized for site-specific incorporation of p-acetyl- phenylalanine into PSMC are SEQ ID NO: 1 (muttRNA, M. jannaschii mtRNA¾A ), and 13, 14 or 15 (TyrRS LW1 , 5, or 6) described in Example 2 above.
[00609] Once modified, the PSMC variant comprising the carbonyl-containing amino acid is reacted with an aminooxy-containing PEG derivative of the form:
R-PEG(N)-0-(CH2)n-0-NH2
where R is methyl, n is 3 and N is approximately 5,000 MW. The purified PSMC containing /?-acetylphenylalanine dissolved at 10 mg/mL in 25 mM MES (Sigma Chemical, St. Louis, MO) pH 6.0, 25 mM Hepes (Sigma Chemical, St. Louis, MO) pH 7.0, or in 10 mM Sodium Acetate (Sigma Chemical, St. Louis, MO) pH 4.5, is reacted with a 10 to 100-fold excess of aminooxy-containing PEG, and then stirred for 10 - 16 hours at room temperature (Jencks, W. J. Am. Chem. Soc. 1959, 81 , pp 475). The PEG-PSMC is then diluted into appropriate buffer for immediate purification and analysis.
Example 4
[00610] Conjugation with a PEG consisting of a hydroxylamine group linked to the
PEG via an amide linkage.
[00611] A PEG reagent having the following structure is coupled to a ketone- containing non-naturally encoded amino acid using the procedure described in Example 3: R-PEG(N)-0-(CH2)2-NH-C(0)(CH2)n-0-NH2
where R = methyl, n=4 and N is approximately 20,000 MW. The reaction, purification, and analysis conditions are as described in Example 3.
Example 5
[00612] This example details the introduction of two distinct non-naturally encoded amino acids into PSMC.
[00613] This example demonstrates a method for the generation of an antigen-binding polypeptide that incorporates non-naturally encoded amino acid comprising a ketone functionality at two positions identified according to Example 1, wherein X* represents a non-naturally encoded amino acid. The antigen-binding polypeptide is prepared as described in Examples 1 and 2, except that the suppressor codon is introduced at two distinct sites within the nucleic acid.
Example 6
[00614] This example details conjugation of antigen-binding polypeptide to a hydrazide-containing PEG and subsequent in situ reduction.
[00615] An antigen-binding polypeptide incorporating a carbonyl-containing amino acid is prepared according to the procedure described in Examples 2 and 3. Once modified, a hydrazide-containing PEG having the following structure is conjugated to the PSMC:
R-PEG(N)-0-(CH2)2-NH-C(0)(CH2)n-X-NH-NH2
where R = methyl, n=2 and N = 10,000 MW and X is a carbonyl (C=0) group. The purified PSMC containing ?-acetylphenylalanine is dissolved at between 0.1 -10 mg/mL in 25 mM MES (Sigma Chemical, St. Louis, MO) pH 6.0, 25 mM Hepes (Sigma Chemical, St. Louis, MO) pH 7.0, or in 10 mM Sodium Acetate (Sigma Chemical, St. Louis, MO) pH 4.5, is reacted with a 1 to 100-fold excess of hydrazide-containing PEG, and the corresponding hydrazone is reduced in situ by addition of stock 1M NaCNBH3 (Sigma Chemical, St. Louis, MO), dissolved in H20, to a final concentration of 10-50 mM. Reactions are carried out in the dark at 4 °C to RT for 18-24 hours. Reactions are stopped by addition of 1 M Tris (Sigma Chemical, St. Louis, MO) at about pH 7.6 to a final Tris concentration of 50 mM or diluted into appropriate buffer for immediate purification.
Example 7
[00616] This example details introduction of an alkyne-containing amino acid into a PSMC and derivatization with mPEG-azide.
[00617] Any of the residues identified according to Example 1 are substituted with the following non-naturally encoded amino acid:
[00618] The sequences utilized for site-specific incorporation of p-propargyl-tyrosine are SEQ ID NO: 1 (muttRNA, M. jannaschii mtRNA ), and 6, 7 or 8 described in
Example 2 above. The antigen-binding polypeptide containing the propargyl tyrosine is expressed in E. coli and purified using the conditions described in Example 3.
[00619] The purified PSMC containing propargyl-tyrosine dissolved at between 0.1-10 mg/mL in PB buffer (100 mM sodium phosphate, 0.15 M NaCl, pH = 8) and a 10 to 1000- fold excess of an azide-containing PEG is added to the reaction mixture. A catalytic amount of CuS04 and Cu wire are then added to the reaction mixture. After the mixture is incubated (including but not limited to, about 4 hours at room temperature or 37° C, or overnight at 4°C), H20 is added and the mixture is filtered through a dialysis membrane. The sample can
be analyzed for the addition, including but not limited to, by similar procedures described in Example 3.
[00620] In this Example, the PEG will have the following structure:
R-PEG(N)-0-(CH2)2-NH-C(0)(CH2)n-N3
where R is methyl, n is 4 and N is 10,000 MW.
Example 8
[00621] This example details substitution of a large, hydrophobic amino acid in PSMC with propargyl tyrosine.
[00622] A Phe, Trp or Tyr residue present within the sequence of PSMC is substituted with the following non-naturally encoded amino acid as described in Example 7:
[00623] Once modified, a PEG is attached to the PSMC variant comprising the alkyne- containing amino acid. The PEG will have the following structure:
Me-PEG(N)-0-(CH2)2-N3
and coupling procedures would follow those in Example 7. This will generate a PSMC variant comprising a non-naturally encoded amino acid that is approximately isosteric with one of the naturally-occurring, large hydrophobic amino acids and which is modified with a PEG derivative at a distinct site within the polypeptide.
Example 9
[00624] This example details generation of a PSMC homodimer, heterodimer, homomultimer, or heteromultimer separated by one or more PEG linkers.
[00625] The alkyne-containing PSMC variant produced in Example 7 is reacted with a bifunctional PEG derivative of the form:
N3-(CH2)n-C(0)-NH-(CH2)2-0-PEG(N)-0-(CH2)2-NH-C(0)-(C.H2)n-N3
where n is 4 and the PEG has an average MW of approximately 5,000, to generate the corresponding PSMC homodimer where the two PSMC molecules are physically separated by PEG. In an analogous manner an antigen-binding polypeptide may be coupled to one or
more other polypeptides to form heterodimers, homomultimers, or heteromultimers. Coupling, purification, and analyses will be performed as in Examples 7 and 3.
Example 10
[00626] This example details coupling of a saccharide moiety to PSMC.
[00627] One or more amino acid residues of the PSMC is substituted with the non- naturally encoded amino acid below, as described in Example 3.
[00628] Once modified, the PSMC variant comprising the carbonyl-containing amino acid is reacted with a β-linked aminooxy analogue of N-acetylglucosamine (GlcNAc). The PSMC variant (10 mg/mL) and the aminooxy saccharide (21 mM) are mixed in aqueous 100 mM sodium acetate buffer (pH 5.5) and incubated at 37°C for 7 to 26 hours. A second saccharide is coupled to the first enzymatically by incubating the saccharide-conjugated PSMC (5 mg/mL) with UDP-galactose (16 mM) and -l ,4-galacytosyltransferase (0.4 units/mL) in 150 mM HEPES buffer (pH 7.4) for 48 hours at ambient temperature (Schanbacher et al. J. Biol. Chem. 1970, 245, 5057-5061).
Example 1 1
[00629] This example details generation of a PEGylated PSMC antagonist.
[00630] One or more of the PSMC amino acid residues is substituted with the following non-naturally encoded amino acid as described in Example 3.
[00631] Once modified, the PSMC variant comprising the carbonyl-containing acid will be reacted with an aminooxy-containing PEG derivative of the form:
R-PEG(N)-0-(CH2)n-0-NH2
where R is methyl, n is 4 and N is 20,000 MW to generate a PSMC antagonist comprising a non-naturally encoded amino acid that is modified with a PEG derivative at a single site within the polypeptide. Coupling, purification, and analyses are performed as in Example 3. Example 12
Generation of a PSMC homodimer, heterodimer, homomultimer, or heteromultimer in which the PSMC Molecules are Linked Directly
[00632] A PSMC variant comprising the alkyne-containing amino acid can be directly coupled to another PSMC variant comprising the azido-containing amino acid, each of which comprise non-naturally encoded amino acid substitutions at the sites described in, but not limited to, Example 10. This will generate the corresponding PSMC homodimer where the two PSMC variants are physically joined. In an analogous manner an antigen-binding polypeptide may be coupled to one or more other polypeptides to form heterodimers, homomultimers, or heteromultimer s. Coupling, purification, and analyses are performed as in Examples 3, 6, and 7.
Example 13
PEG-OH + Br-(CH2)n-C≡CR' PEG-0-(CH2)n-C≡CR'
A B
[00633] The polyalkylene glycol (P-OH) is reacted with the alkyl halide (A) to form the ether (B). In these compounds, n is an integer from one to nine and R' can be a straight- or branched-chain, saturated or unsaturated CI , to C20 alkyl or heteroalkyl group. R' can also be a C3 to C7 saturated or unsaturated cyclic alkyl or cyclic heteroalkyl, a substituted or unsubstituted aryl or heteroaryl group, or a substituted or unsubstituted alkaryl (the alkyl is a CI to C20 saturated or unsaturated alkyl) or heteroalkaryl group. Typically, PEG-OH is polyethylene glycol (PEG) or monomethoxy polyethylene glycol (mPEG) having a molecular weight of 800 to 40,000 Daltons (Da).
Example 14
mPEG-OH + Br-CH2 -C≡CH -» mPEG-0-CH2-C≡CH
[00634] mPEG-OH with a molecular weight of 20,000 Da (mPEG-OH 20 kDa; 2.0 g,
0.1 mmol, Sunbio) was treated with NaH (12 mg, 0.5 mmol) in THF (35 mL). A solution of propargyl bromide, dissolved as an 80% weight solution in xylene (0.56 mL, 5 mmol, 50
equiv., Aldrich), and a catalytic amount of KI were then added to the solution and the resulting mixture was heated to reflux for 2 hours. Water (1 mL) was then added and the solvent was removed under vacuum. To the residue was added CH2C12 (25 mL) and the organic layer was separated, dried over anhydrous Na2S04, and the volume was reduced to approximately 2 mL. This CH2C12 solution was added to diethyl ether (150 mL) drop-wise. The resulting precipitate was collected, washed with several portions of cold diethyl ether, and dried to afford propargyl-O-PEG.
Example 15
mPEG-OH + Br-(CH2)3-C≡CH mPEG-0-(CH2)3-C≡CH
[00635] The mPEG-OH with a molecular weight of 20,000 Da (mPEG-OH 20 kDa;
2.0 g, 0.1 mmol, Sunbio) was treated with NaH (12 mg, 0.5 mmol) in THF (35 mL). Fifty equivalents of 5-bromo-l-pentyne (0.53 mL, 5 mmol, Aldrich) and a catalytic amount of KI were then added to the mixture. The resulting mixture was heated to reflux for 16 hours. Water (1 mL) was then added and the solvent was removed under vacuum. To the residue was added CH2C12 (25 mL) and the organic layer was separated, dried over anhydrous Na2S04, and the volume was reduced to approximately 2 mL. This CH2C12 solution was added to diethyl ether (150 mL) drop-wise. The resulting precipitate was collected, washed with several portions of cold diethyl ether, and dried to afford the corresponding alkyne. 5- chloro- 1 -pentyne may be used in a similar reaction.
Example 16
( 1 ) m-HOCH2C6H4OH + NaOH + Br- CH2-C≡CH m-HOCH2C6H40-CH2-C≡CH
(2) w-HOCH2C6H40-CH2-C≡CH + MsCl + N(Et) 3 w-MsOCH2C6H40-CH2-C≡CH (3) m-MsOCH2C6H40-CH2-C≡CH + LiBr -> m-Br-CH2C6H40-CH2-C≡CH
(4) mPEG-OH + m-Br-CH2C6H40-CH2-C≡CH -» mPEG-0-CH2-C6H40-CH2-C≡CH
[00636] To a solution of 3-hydroxybenzylalcohol (2.4 g, 20 mmol) in THF (50 mL) and water (2.5 mL) was first added powdered sodium hydroxide (1.5 g, 37.5 mmol) and then a solution of propargyl bromide, dissolved as an 80% weight solution in xylene (3.36 mL, 30 mmol). The reaction mixture was heated at reflux for 6 hours. To the mixture was added 10% citric acid (2.5 mL) and the solvent was removed under vacuum. The residue was extracted with ethyl acetate (3 x 15 mL) and the combined organic layers were washed with
saturated NaCl solution (10 mL), dried over MgSC>4 and concentrated to give the 3- propargyloxybenzyl alcohol.
[00637] Methanesulfonyl chloride (2.5 g, 15.7 mmol) and triethylamine (2.8 mL, 20 mmol) were added to a solution of compound 3 (2.0 g, 1 1.0 mmol) in CH2C12 at 0°C and the reaction was placed in the refrigerator for 16 hours. A usual work-up afforded the mesylate as a pale yellow oil. This oil (2.4 g, 9.2 mmol) was dissolved in THF (20 mL) and LiBr (2.0 g, 23.0 mmol) was added. The reaction mixture was heated to reflux for 1 hour and was then cooled to room temperature. To the mixture was added water (2.5 mL) and the solvent was removed under vacuum. The residue was extracted with ethyl acetate (3 x 15 mL) and the combined organic layers were washed with saturated NaCl solution (10 mL), dried over anhydrous Na2S04, and concentrated to give the desired bromide.
[00638] mPEG-OH 20 kDa (1.0 g, 0.05 mmol, Sunbio) was dissolved in THF (20 mL) and the solution was cooled in an ice bath. NaH (6 mg, 0.25 mmol) was added with vigorous stirring over a period of several minutes followed by addition of the bromide obtained from above (2.55 g, 1 1.4 mmol) and a catalytic amount of KI. The cooling bath was removed and the resulting mixture was heated to reflux for 12 hours. Water (1.0 mL) was added to the mixture and the solvent was removed under vacuum. To the residue was added CH2C12 (25 mL) and the organic layer was separated, dried over anhydrous Na2S04, and the volume was reduced to approximately 2 mL. Dropwise addition to an ether solution (150 mL) resulted in a white precipitate, which was collected to yield the PEG derivative.
Example 17
mPEG-NH2 + X-C(0)-(CH2) n-C≡CR' -= mPEG-NH-C(0)-(CH2)n-C≡CR'
[00639] The terminal alkyne-containing poly(ethylene glycol) polymers can also be obtained by coupling a poly(ethylene glycol) polymer containing a terminal functional group to a reactive molecule containing the alkyne functionality as shown above, n is between 1 and 10. R' can be H or a small alkyl group from CI to C4.
Example 18
(1) H02C-(CH2)2-C≡CH + NHS +DCC^ NHSO-C(0)-(CH2)2-C≡CH
(2) mPEG-NH2 + NHSO-C(0)-(CH2) 2-C≡CH -» mPEG-NH-C(0)-(CH2)2-C≡CH
[00640] 4-pentynoic acid (2.943 g, 3.0 mmol) was dissolved in CH2C12 (25 mL). N- hydroxysuccinimide (3.80 g, 3.3 mmol) and DCC (4.66 g, 3.0 mmol) were added and the
solution was stirred overnight at room temperature. The resulting crude NHS ester 7 was used in the following reaction without further purification.
[00641] mPEG-NH2 with a molecular weight of 5,000 Da (mPEG-NH2, 1 g, Sunbio) was dissolved in THF (50 mL) and the mixture was cooled to 4 °C. NHS ester 7 (400 mg, 0.4 mmol) was added portion-wise with vigorous stirring. The mixture was allowed to stir for 3 hours while warming to room temperature. Water (2 mL) was then added and the solvent was removed under vacuum. To the residue was added CH2C12 (50 mL) and the organic layer was separated, dried over anhydrous Na2S04, and the volume was reduced to approximately 2 mL. This CH2C12 solution was added to ether (150 mL) drop-wise. The resulting precipitate was collected and dried in vacuo.
Example 19
[00642] This Example represents the preparation of the methane sulfonyl ester of poly(ethylene glycol), which can also be referred to as the methanesulfonate or mesylate of poly(ethylene glycol). The corresponding tosylate and the halides can be prepared by similar procedures.
mPEG-OH + CH3S02C1 + N(Et) 3 - mPEG-0-S02CH3 mPEG-N3
[00643] The mPEG-OH (MW = 3,400, 25 g, 10 mmol) in 150 mL of toluene was azeotropically distilled for 2 hours under nitrogen and the solution was cooled to room temperature. 40 mL of dry CH2C12 and 2.1 mL of dry triethylamine (15 mmol) were added to the solution. The solution was cooled in an ice bath and 1.2 mL of distilled methanesulfonyl chloride (15 mmol) was added dropwise. The solution was stirred at room temperature under nitrogen overnight, and the reaction was quenched by adding 2 mL of absolute ethanol. The mixture was evaporated under vacuum to remove solvents, primarily those other than toluene, filtered, concentrated again under vacuum, and then precipitated into 100 mL of diethyl ether. The filtrate was washed with several portions of cold diethyl ether and dried in vacuo to afford the mesylate.
[00644] The mesylate (20 g, 8 mmol) was dissolved in 75 ml of THF and the solution was cooled to 4 °C. To the cooled solution was added sodium azide (1.56 g, 24 mmol). The reaction was heated to reflux under nitrogen for 2 hours. The solvents were then evaporated and the residue diluted with CH2C12 (50 mL). The organic fraction was washed with NaCl solution and dried over anhydrous MgS04. The volume was reduced to 20 ml and the product was precipitated by addition to 150 ml of cold dry ether.
Example 20
(1 ) N3-C6H4-C02H N3-C6H4CH2OH
(2) N3-C6H4CH2OH -> Br-CH2-C6H4-N3
(3) mPEG-OH + Br-CH2-C6H4-N3 -» mPEG-0-CH2-C6H4-N3
[00645] 4-azidobenzyl alcohol can be produced using the method described in U.S. Patent 5,998,595, which is incorporated by reference herein. Methanesulfonyl chloride (2.5 g, 15.7 mmol) and triethylamine (2.8 mL, 20 mmol) were added to a solution of 4- azidobenzyl alcohol (1.75 g, 1 1.0 mmol) in CH2C12 at 0 °C and the reaction was placed in the refrigerator for 16 hours. A usual work-up afforded the mesylate as a pale yellow oil. This oil (9.2 mmol) was dissolved in THF (20 mL) and LiBr (2.0 g, 23.0 mmol) was added. The reaction mixture was heated to reflux for 1 hour and was then cooled to room temperature. To the mixture was added water (2.5 mL) and the solvent was removed under vacuum. The residue was extracted with ethyl acetate (3 x 15 mL) and the combined organic layers were washed with saturated NaCl solution (10 mL), dried over anhydrous Na2S04, and concentrated to give the desired bromide.
[00646] mPEG-OH 20 kDa (2.0 g, 0.1 mmol, Sunbio) was treated with NaH (12 mg, 0.5 mmol) in THF (35 mL) and the bromide (3.32 g, 15 mmol) was added to the mixture along with a catalytic amount of KI. The resulting mixture was heated to reflux for 12 hours. Water (1.0 mL) was added to the mixture and the solvent was removed under vacuum. To the residue was added CH2C12 (25 mL) and the organic layer was separated, dried over anhydrous Na2S04, and the volume was reduced to approximately 2 mL. Dropwise addition to an ether solution (150 mL) resulted in a precipitate, which was collected to yield mPEG-O- CH2-C6H4-N3. Example 21
NH2-PEG-0-CH2CH2C02H + N3-CH2CH2C02-NHS N3-CH2CH2-C(0)NH-PEG-0- CH2CH2C02H
[00647] NH2-PEG-0-CH2CH2C02H (MW 3,400 Da, 2.0 g) was dissolved in a saturated aqueous solution of NaHC03 (10 mL) and the solution was cooled to 0°C. 3-azido- 1-N-hydroxysuccinimido propionate (5 equiv.) was added with vigorous stirring. After 3 hours, 20 mL of H20 was added and the mixture was stirred for an additional 45 minutes at room temperature. The pH was adjusted to 3 with 0.5 N H2S04 and NaCl was added to a concentration of approximately 15 wt%. The reaction mixture was extracted with CH2C12
(100 mL x 3), dried over Na2S04 and concentrated. After precipitation with cold diethyl ether, the product was collected by filtration and dried under vacuum to yield the omega- carboxy-azide PEG derivative. Example 22
mPEG-OMs + HC≡CLi -» mPEG-0-CH2-CH2-C≡C-H
[00648] To a solution of lithium acetylide (4 equiv.), prepared as known in the art and cooled to -78°C in THF, is added dropwise a solution of mPEG-OMs dissolved in THF with vigorous stirring. After 3 hours, the reaction is permitted to warm to room temperature and quenched with the addition of 1 mL of butanol. 20 mL of H20 is then added and the mixture was stirred for an additional 45 minutes at room temperature. The pH was adjusted to 3 with 0.5 N H2S04 and NaCl was added to a concentration of approximately 15 wt%. The reaction mixture was extracted with CH2C12 (100 mL x 3), dried over Na2S04 and concentrated. After precipitation with cold diethyl ether, the product was collected by filtration and dried under vacuum to yield the l-(but-3-ynyloxy)-methoxypolyethylene glycol (mPEG).
Example 23
[00649] The azide- and acetylene-containing amino acids were incorporated site- selectively into proteins using the methods described in L. Wang, et al., (2001), Science 292:498-500, J.W. Chin et al., Science 301 :964-7 (2003)), J. W. Chin et al., (2002), Journal of the American Chemical Society 124:9026-9027; J. W. Chin, & P. G. Schultz, (2002), Chem Bio Chem 1 1 : 1 135-1 137; J. W. Chin, et al., (2002), PNAS United States of America 99: 1 1020-1 1024: and, L. Wang, & P. G. Schultz, (2002), Chem. Comm., 1 -10. Once the amino acids were incorporated, the cycloaddition reaction was carried out with 0.01 mM protein in phosphate buffer (PB), pH 8, in the presence of 2 mM PEG derivative, 1 mM CuS04, and ~1 mg Cu-wire for 4 hours at 37 °C.
Example 24
[00650] This example describes methods to measure in vitro and in vivo activity of PSMC comprising a non-naturally encoded amino acid and PEGylated PSMC.
Cell Binding Assays
[00651] Cells (3xl06) are incubated in duplicate in PBS/1% BSA (100 μΐ) in the absence or presence of various concentrations (volume: 10 μΐ) of unlabeled PSMC, PSMC or
a negative control and in the presence of 125 I- PSMC (approx. 100,000 cpm or 1 ng) at 0°C for 90 minutes (total volume: 120 μΐ). Cells are then resuspended and layered over 200 μΐ ice cold FCS in a 350 μΐ plastic centrifuge tube and centrifuged (1000 g; 1 minute). The pellet is collected by cutting off the end of the tube and pellet and supernatant counted separately in a gamma counter (Packard).
[00652] Specific binding (cpm) is determined as total binding in the absence of a competitor (mean of duplicates) minus binding (cpm) in the presence of 100-fold excess of unlabeled PSMC (non-specific binding). The non-specific binding is measured for each of the cell types used. Experiments are run on separate days using the same preparation of 125I- PSMC and should display internal consistency. The binding is inhibited in a dose dependent manner by unlabeled natural PSMC or PSMC, but not by the negative control. The ability of PSMC to compete for the binding of natural 125I-PSMC suggests that the receptors recognize both forms equally well.
[00653] For binding assays with scFv-108, A431 cells were collected following treatment with trypsin, re-suspended in FACS buffer (PBS, 2% FBS, 0.01% NaN3), and then seeded into 96-well round bottom microtiter plates (3 X 105 cell/well). Cells were incubated with different concentrations of wild type or pAcF-containing scFv-108 fragments for 30 minutes on ice. Unbound scFv proteins were removed by washing following centrifugation (repeated 2-3 times). Cells were then incubated with the mAb-108 (ATCC # HB 9764) at a concentration of 7.5 nM (ECgo) for 30 minutes. After two washes, the cells were incubated with an APC-labeled (allophycocyanin) anti-mouse antibody (10 ug/ml) for 30 minutes on ice. After washing the cells two times to remove the secondary antibody, the cells were re- suspended in FACS buffer supplemented with propidium iodine (0.5 ug/ml), and analyzed by flow cytometry. For binding assays with Fab- 108, cells were incubated with increasing amounts of Fab- 108 under the same conditions as used for the scFv-108 assays. Fab binding was detected using an anti-His antibody followed by an APC-labeled anti-mouse secondary antibody.
[00654] Figure 7, Panels A-C shows competition binding curves of the scFv proteins containing p-acetyl-phenylalanine (pAcF) or pAcF with PEG and WT scFv to A431 cells expressing EGF receptors. Cells were incubated with the scFv proteins at various concentrations after washing to remove unbound scFv's, and the cells were treated with the mA 08 as described above. All proteins were expressed in the periplasm. Table 1 1
summarizes the binding of the modified scFv's (pAcF and pAcF with PEG) relative to the wild type scFv:
[00655] Figure 8, Panels B-D show binding of pAcF or pAcF-PEG-containing Fab- 108 fragments and WT Fab to A431 cells expressing EGF receptors. PEGylation of the Fab fragments results in a minimal decrease in the affinity of the fragments to the EGF receptors. Binding of modified Fab fragments relative to that of the wild type Fab is shown in Table 12. Binding conditions were as described previously.
[00656] PEG- PSMC, unmodified PSMC and buffer solution are administered to mice or rats. The results will show superior activity and prolonged half life of the PEGylated PSMC of the present invention compared to unmodified PSMC.
Measurement of the in vivo Half-life of Conjugated and Non-conjugated PSMC and Variants Thereof.
[00657] Male Sprague Dawley rats (about 7 weeks old) are used. On the day of administration, the weight of each animal is measured. 100 μg per kg body weight of the non-conjugated and conjugated PSMC samples are each injected intravenously into the tail
vein of three rats. At 1 minute, 30 minutes, 1 , 2, 4, 6, and 24 hours after the injection, 500 μΐ of blood is withdrawn from each rat while under C02 -anesthesia. The blood samples are stored at room temperature for 1.5 hours followed by isolation of serum by centrifugation (4° C, 18000xg for 5 minutes). The serum samples are stored at -80° C until the day of analysis. The amount of active PSMC in the serum samples is quantified by the PSMC in vitro activity assay after thawing the samples on ice.
Example 31
[00658] Human Clinical Trial of the Safety and/or Efficacy of PEGylated PSMC Comprising a Non-Naturally Encoded Amino Acid.
[00659] Objective To compare the safety and pharmacokinetics of subcutaneously administered PEGylated recombinant huma PSMC comprising a non-naturally encoded amino acid with a commercially available product specific for the same target antigen (e.g. Herceptin®, Bexxar®, Campath®, CEA-Scan®, Enbrel®, Erbitux®, Humira®, Myoscint®, Prostascint®, Raptiva®, Remicade®, ReoPro®, Rituxan®, Simulect®, Synagis®, Verluma®, Xolair®, Zenapax®, Zevalin®, or Avastin®.
[00660] Patients Eighteen healthy volunteers ranging between 20-40 years of age and weighing between 60-90 kg are enrolled in the study. The subjects will have no clinically significant abnormal laboratory values for hematology or serum chemistry, and a negative urine toxicology screen, HIV screen, and hepatitis B surface antigen. They should not have any evidence of the following: hypertension; a history of any primary hematologic disease; history of significant hepatic, renal, cardiovascular, gastrointestinal, genitourinary, metabolic, neurologic disease; a history of anemia or seizure disorder; a known sensitivity to bacterial or mammalian-derived products, PEG, or human serum albumin; habitual and heavy consumer to beverages containing caffeine; participation in any other clinical trial or had blood transfused or donated within 30 days of study entry; had exposure to PSMC within three months of study entry; had an illness within seven days of study entry; and have significant abnormalities on the pre-study physical examination or the clinical laboratory evaluations within 14 days of study entry. All subjects are evaluable for safety and all blood collections for pharmacokinetic analysis are collected as scheduled. All studies are performed with institutional ethics committee approval and patient consent.
[00661] Study Design This will be a Phase I, single-center, open-label, randomized, two-period crossover study in healthy male volunteers. Eighteen subjects are randomly
assigned to one of two treatment sequence groups (nine subjects/group). PSMC is administered over two separate dosing periods as a bolus s.c. injection in the upper thigh using equivalent doses of the PEGylated PSMC comprising a non-naturally encoded amino acid and the commercially available product chosen. The dose and frequency of administration of the commercially available product is as instructed in the package label. Additional dosing, dosing frequency, or other parameter as desired, using the commercially available products may be added to the study by including additional groups of subjects. Each dosing period is separated by a 14-day washout period. Subjects are confined to the study center at least 12 hours prior to and 72 hours following dosing for each of the two dosing periods, but not between dosing periods. Additional groups of subjects may be added if there are to be additional dosing, frequency, or other parameter, to be tested for the PEGylated PSMC as well. The experimental formulation of PSMC is the PEGylated PSMC comprising a non-naturally encoded amino acid.
[00662] Blood Sampling Serial blood is drawn by direct vein puncture before and after administration of PSMC. Venous blood samples (5 mL) for determination of serum
PSMC concentrations are obtained at about 30, 20, and 10 minutes prior to dosing (3 baseline samples) and at approximately the following times after dosing: 30 minutes and at 1, 2, 5, 8,
12, 15, 18, 24, 30, 36, 48, 60 and 72 hours. Each serum sample is divided into two aliquots.
All serum samples are stored at -20°C. Serum samples are shipped on dry ice. Fasting clinical laboratory tests (hematology, serum chemistry, and urinalysis) are performed immediately prior to the initial dose on day 1 , the morning of day 4, immediately prior to dosing on day
16, and the morning of day 19.
[00663] Bioanalvtical Methods A radioimmunoassay (RA) or ELISA kit procedure is used for the determination of serum PSMC concentrations.
[00664] Safety Determinations Vital signs are recorded immediately prior to each dosing (Days 1 and 16), and at 6, 24, 48, and 72 hours after each dosing. Safety determinations are based on the incidence and type of adverse events and the changes in clinical laboratory tests from baseline. In addition, changes from pre-study in vital sign measurements, including blood pressure, and physical examination results are evaluated.
[00665] Data Analysis Post-dose serum concentration values are corrected for pre- dose baseline PSMC concentrations by subtracting from each of the post-dose values the mean baseline PSMC concentration determined from averaging the PSMC levels from the three samples collected at 30, 20, and 10 minutes before dosing. Pre-dose serum PSMC
concentrations are not included in the calculation of the mean value if they are below the quantification level of the assay. Pharmacokinetic parameters are determined from serum concentration data corrected for baseline PSMC concentrations. Pharmacokinetic parameters are calculated by model independent methods on a Digital Equipment Corporation VAX 8600 computer system using the latest version of the BIOAVL software. The following pharmacokinetics parameters are determined: peak serum concentration (Cmax); time to peak serum concentration (tmax); area under the concentration-time curve (AUC) from time zero to the last blood sampling time (AUC0-72) calculated with the use of the linear trapezoidal rule; and terminal elimination half-life (ti/2), computed from the elimination rate constant. The elimination rate constant is estimated by linear regression of consecutive data points in the terminal linear region of the log-linear concentration-time plot. The mean, standard deviation (SD), and coefficient of variation (CV) of the pharmacokinetic parameters are calculated for each treatment. The ratio of the parameter means (preserved formulation/non-preserved formulation) is calculated.
[00666] Safety Results The incidence of adverse events is equally distributed across the treatment groups. There are no clinically significant changes from baseline or pre-study clinical laboratory tests or blood pressures, and no notable changes from pre-study in physical examination results and vital sign measurements. The safety profiles for the two treatment groups should appear similar.
[00667] Pharmacokinetic Results Mean serum PSMC concentration-time profiles (uncorrected for baseline PSMC levels) in all 18 subjects after receiving a single dose of one or more of commercially available products specific for the same target antigen are compared to the PEGylated PSMC comprising a non-naturally encoded amino acid at each time point measured. All subjects should have pre-dose baseline PSMC concentrations within the normal physiologic range. Pharmacokinetic parameters are determined from serum data corrected for pre-dose mean baseline PSMC concentrations and the Cmax and tmax are determined. The mean tmax for the clinical comparator(s) chosen is significantly shorter than the tmax for the PEGylated PSMC comprising the non-naturally encoded amino acid. Terminal half-life values are significantly shorter for the commerically available PSMC products tested compared with the terminal half-life for the PEGylated PSMC comprising a non-naturally encoded amino acid.
[00668] Although the present study is conducted in healthy male subjects, similar absorption characteristics and safety profiles would be anticipated in other patient
populations; such as male or female patients with cancer or chronic renal failure, pediatric renal failure patients, patients in autologous predeposit programs, or patients scheduled for elective surgery.
[00669] In conclusion, subcutaneously administered single doses of PEGylated PSMC comprising non-naturally encoded amino acid will be safe and well tolerated by healthy male subjects. Based on a comparative incidence of adverse events, clinical laboratory values, vital signs, and physical examination results, the safety profiles of the commercially available forms of PSMC and PEGylated PSMC comprising non-naturally encoded amino acid will be equivalent. The PEGylated PSMC comprising non-naturally encoded amino acid potentially provides large clinical utility to patients and health care providers.
Example 32
[00670] The affinity and specificity of the anti-CD3 Fab-folate conjugate were evaluated using FR+ and FR" cell lines. After culture in folate deficient media, FR was overexpressed in nasopharyngeal (KB) and ovarian (OV-90, SKOV-3) cancer cell lines as determined by flow cytometry. A kidney cancer cell line CAKI-1 and an alveolar basal epithelial cell carcinoma A549 that did not express FR were used as negative controls. The anti-CD3 Fab-folate conjugate was able to bind to KB cells (FR+) with affinity similar to free folate indicating minimal loss of binding to the folate receptor as a result of conjugation with the anti-CD3 Fab. Likewise, the anti- CD3 Fab-folate bound to Jurkat cells (CD3+) with similar affinity to anti-CD3; no binding was observed to A549 cells (FR").
Example 33
[00671] We next tested the activity of the anti-CD3 Fab-folate conjugate in an in vitro cytotoxicity assay with KB and OV-90 cells (FR+) and CAKI-1 and A549 cells (FR") as controls. Cells were co-cultured with activated human peripheral blood mononuclear cells (PBMCs; ratio 1 : 10 of target: effector cells) and treated with various concentrations of anti- CD3 Fab-folate or anti-CD3 Fab alone. Cytotoxicity was quantitated by measuring released LDH levels from lysed cells, and with CellTiter-Glo and FACS based toxicity assays. The anti-CD3 Fab-folate conjugate demonstrated efficient killing of KB and OV-90 cells in the presence of PBMCs with EC5o's 10 pM and 100 pM respectively (Figure 2A, Supplemental Figure 4), while CAKI-1 cells (Figure 2A) and A549 cells (Supplemental Figure 4) were unaffected at 100 nM of conjugate. Treatment with anti-CD3 Fab alone induced negligible
toxicity on all cell lines tested (Figure 2A). Furthermore, incubation (16 hrs) of SKOV-3 cells (Figure 2B) or KB cells (Supplemental Figure 5) with activated PBMCs (ratio 1 : 10 of target: effector cells) in folate deficient media in the presence of the anti-CD3 Fab-folate conjugate resulted in the formation of rosettes, providing additional evidence for T cell targeting. In contrast, the anti-CD3 Fab had no effect on T cell engagement and clusters were not observed in the absence of PBMCs or KB cells (Supplemental Figure 5).
Example 34
[00672] We next examined the pharmacokinetics of the anti-CD3 Fab-folate conjugate and the unconjugated anti-CD3 Fab in rodents. A single dose of 1 mg/kg or 5 mg/kg of anti- CD3 Fab-folate in PBS or 1 mg/kg unconjugated anti-CD3 Fab was injected intravenously in three rats, and serum collected at regular intervals was analyzed by ELISA. The serum concentration decreased for both anti-CD3 Fab-folate and the corresponding unconjugated mutant anti-CD3 Fab at the same rate with a serum half-life of 60 mins (Figure 3D). Thus, the anti-CD3 Fab-folate has similar pharmacokinetics to the unconjugated anti-CD3 Fab indicating that PK profile of the conjugate was not affected by folate derivatization.
Example 35
[00673] The in vivo efficacy of the anti-CD3 Fab-folate bispecific agent was then assessed in a xenograft model using female NOD-SCID mice. Animals were maintained on a low-folate diet to reduce circulating serum levels of folate that might compete with the bispecific agent. KB (FR+) or A549 (FR") cells were able to form tumors when mixed with non-activated human PBMCs (ratio 1 : 100 of target: effector cells) or activated human PBMCs (ratio 1 : 10 of target: effector cells) and injected subcutaneously into mice. We therefore implanted KB cells mixed with activated human PBMCs (ratio 1 : 10 of target: effector cells) into mice and injected the mice intravenously with 1.5mg/kg of anti-CD3 Fab- folate or PBS daily for 10 days starting on the same day as tumor cell implantation. This dosing regimen was chosen based on the pharmokinetic properties of the anti-CD3 Fab-folate conjugate and previous studies with bispecific antibodies10. Tumor volumes showed a rapid increase in PBS treated mice with a doubling time of approximately 5 days. In contrast, tumors in mice treated with anti-CD3 Fab-folate were barely detectable throughout the duration of the study (Figure 3A). In a parallel study, mice were implanted with KB cells mixed with unactivated human PBMCs (ratio 1 : 100 of target: effector cells) and treated
intravenously with 1.5mg/kg of anti-CD3 Fab-folate or PBS daily for 10 days starting on the same day as tumor cell implantation. Tumor volumes for both groups of mice decreased for the first 30 days of the study possibly due to the high burden of PBMCs at the injection site. The rate of decease of the tumors was, however, higher in anti-CD3 Fab-folate treated mice. After day 35 of the study, the tumors in PBS treated mice steadily increased in volume while tumors in the anti-CD3 Fab-folate treated mice decreased to barely detectable levels indicating the engagement of cytotoxic T cells for the elimination of the tumors by the anti- CD3 Fab-folate conjugate even in the absence of activated T cells. To test the in vivo selectivity of the anti-CD3 Fab-folate conjugate for FR expressing tumors, A549 cells (FR") were mixed with unactivated human PBMCs (ratio 1 : 100 of target: effector cells) and implanted in mice. Mice were treated in a similar manner with 10 daily intravenous doses of 1.5mg/kg anti-CD3 Fab-folate and showed no significant difference from PBS treated tumors 20 days after treatment. Throughout all these studies no weight loss or other overt toxicity was observed in both anti-CD3 Fab-folate and PBS treated mice (Figure 3C, Supplemental Figure 6B). We further performed histopathological analysis of the mice both with and without anti-CD3 Fab-folate injection. Staining of kidneys from mice treated with anti-CD3 Fab-folate or PBS showed no infiltration of T cells; no obvious pathological differences in Hematoxylin and Eosin (H&E) staining between treatment and control groups were observed for other tissues such as spleen, lung and liver.
Example 36
[00674] Solid phase peptide synthesis (SPPS) was performed using a standard peptide synthesis apparatus. All peptides and peptide conjugates were purified using a preparative reverse phase-high performance liquid chromatography (RP-HPLC) instrument (Waters, xTerra CI 8 10 μπι; 19 x 250 mm) and analyzed by analytical RP-HPLC (Waters, X-Bridge CI 8 5 μπι; 3.0 x 50 mm) and Liquid chromatography/mass spectrometry (LC/MS). 1H spectra were acquired using a Varian 400 MHz NMR spectrometer. Samples were run in DMSO-d6/D20; all 1H signals are recorded in ppm with reference to residual or DMSO (2.50 ppm), and data reported as s = singlet, d = doublet, t = triplet, q = quartet, and m = multiplet or unresolved, b = broad, with coupling constants in Hz. Protein masses were obtained at Ambrx mass spectrometry facilities (La Jolla, CA).
Example 37
Construction of the expression plasmid, E. coli cell line W3110B60, protein production
[00675] The expression plasmid (AXID) was constructed from pET-20b (+) and pET-
24 (+) plasmids (EMD4Biosciences). The amber suppression cassette consisting of the modified M. jannaschii tR A synthetase (specific for pAcPhe) was cloned into the BamHI site (type II cloning) of AXID. The UCHT1 Version.2 Fab CD3 sequence was obtained from the literature1'2 and sub-cloned into AXID vector downstream of the phoA promoter within the open reading frame. Lysine 136 of the heavy chain (HC-Lysl 36) was quickchanged (Stratagene) to the TAG amber nonsense codon. Wild-type E. coli K-12 W31 10 cell line (ATCC) was engineered by homologous recombination3 to have the following genotype: F- ΓΝ (rrnD-rrnE) lambda- araB::g\ tetA fliuA: dhfr proSW375R; :cat. The temperature sensitive phenotype of proS in the W31 10B60 genome was complemented by the wild-type, functional copy of the proS in this expression plasmid. The vector was transformed into W31 1B60 cells and cells were grown in defined media (2.1 L) supplemented with kanamycin sulfate (50 ug/mL) at 37 °C, pH 7, and 480 - 1200 rpm (cascade) in a fermentor. At OD600 = 30, the pH was shifted to 6.8 for the production phase and defined media was added. pAcPhe dissolved in water (100 g/L) was then added to the fermentor. The dissolved oxygen was set point to maintain 30% with the primary agitation (480 - 1200 rpm). After 24 h, cells were harvested and UCHT1 was extracted from cells by osmotic shock by incubating with TES buffer [0.2 M Tris pH 8.0, 0.5 mM EDTA, 0.5 M sucrose) at a ratio of 4: 1 (v/w) at 4 °C. Extract was clarified by centrifugation (18000rpm, 20 min, and 4 °C), filtered through a 0.22micron filter, and loaded onto a Protein G column (GE healthcare). The column was washed with 5 bed volumes of PBS at pH 7.4, and protein was eluted with 10 bed volumes of 0.1 M glycine-HCl, pH 3.0. Fractions were collected into tubes containing 10 % of 1 M Tris- HCl, pH 8. Pooled fractions were further purified by cation exchange [column: SP650S (Tosoh Bioscience), buffer A: 0.02 M phosphate (pH 6.0), buffer B: 0.02 M phosphate (pH 6.0) with 0.5M NaCl] and analyzed by SDS-PAGE gel and mass spectrometry.
Table 13:
nucleotide ccagggaaagcccctaagctcctgatctattatacctcccgcctggagtctggggtccc sequence atcaaggttcagtggctctggatctgggacagattacactctgaccatcagcagtctgc aacctgaagattttgcaacttactactgtcaacagggtaatactctgccgtggacgttcg gccaaggtaccaaggtggagatcaaa
20 UCHT V2 Evqlvesggglvqpggslrlscaasgysftgytmnwvrqapgkglewvalinpyk
VH amino gvttyadsvkgrftisvdkskntaylqmnslraedtavyycarsgyygdsdwyfdv acidsequence wgqgtlvtvss
21 UCHT V2 Gaggtgcagctggtggagtctggaggaggcttggtccagcctggggggtccctgag
VH actctcctgtgcagcctctgggtactcctttaccggctacactatgaactgggtccgcca nucleotide ggctccagggaaggggctggagtgggtcgcactgattaatccttataaaggtgttacta sequence cctatgccgactccgtgaagggccgattcaccatctccgtagataaatccaaaaacac ggcgtatcttcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgct agaagcggatactacggcgatagtgactggtattttgacgtctggggccaaggaaccc tggtcaccgtctcctca
Expression/Suppression
[00676] Suppression with para-acetyl-phenylalanine (pAcF): Suppression of the amber mutations in E. coli was achieved using standard protocols
Example 38
Synthesis of Folate- N10(TFA)-Lys Linker (1)
[00677]
was synthesized using standard solid phase peptide synthesis starting from H-Lys-(Boc)-2-ClTrt-Resin resin (Peptide international).4 Briefly, H-Lys-(Boc)-2-ClTrt-Resin resin (500 mg, 0.89 mM) was swollen with DCM (5 mL) followed by (dimethyl formamide) (DMF, 5 mL). A solution of Fmoc-L-Glu(OtBu)-OH (1.5 equiv), HATU (1.5 equiv), and DIPEA (4.0 equiv) in DMF (3 mL) was added. Argon was bubbled for 2 h, and resin was washed with DMF (3 x 3 mL) and i-PrOH (3 x 3 mL). The coupling efficiency was assessed by the Kaiser Test. After swelling the resin in DMF (3 mL), a solution of pteroic acid (1.5 equiv), HATU (1.5 equiv), and DIPEA (4.0 equiv) in DMF (3 mL) was added. Argon was bubbled for 2 h, and resin was washed with DMF (3 x 3 mL) and i-PrOH (3 3 mL). The coupling efficiency was assessed by the Kaiser Test. After swelling the resin in DCM (3 mL) followed by drying under argon, final compound was cleaved from the resin using a trifluoroacetic acid (TFA):H20:triisopropylsilane (95.5:2.5:2.5) cocktail (3 x 5 mL) directly to round bottom flask containing diethyl ether (300 mL) to obtain precipitated crude product. After filtering
and drying, the crude product was purified using preparative reversed phase (RP)-HPLC (CI 8 column, 0% B - 50%B in 25 min, buffer A: 0.1 TFA in water, buffer B: 0.1 TFA in acetonitrile, λ = 280 nm). ACN was removed under vacuum, and pure fractions were freeze- dried to yield 1 as pale yellow solid. Ή NMR (DMSO-d6/D20): δ 1.18 (m, 2H, Pep-H); 1.45 (m, 1H, Pep-H); 1.54 (m, 3H, Pep-H); 1.81 (m, 1H, Pep-H); 1.95 (m, 1H, Pep-H); 2.1 1 (m, 2H, Pep-H); 2.88 (m, 2H, Pep-H); 3.94 (m, 1H, Lys-aH); 4.12 (m, 1H, Glu-aH); 4.46 (s, 2H, Pte-H); 6.61 (d, J = 8.5 Hz, 2H, Pte-Ar-H); 7.56 (d, J = 8.5 Hz, 2H, Pte-Ar-H); 8.60 (s, 1H, Pte-Ar-H). LC-MS (M + H)+: calcd for C27H30F3N9O8 = 665.6; found = 666.0 g/mol.
Example 39
Synthesis of Phthalimide-PEG4-COOH
[00678]
a solution of triphenylphosphine (TPP, 216.7 mg, 0.826 mmol) and diethyl azodicarboxylate (DEAD, 143.9 mg, 0.826 mmol) in anhydrous THF (0.50 mL) at 0 °C under argon, tBuOOC-PEG4-OH (200.0 mg, 0.751 mmol), in anhydrous THF was added. After stirring the reaction for 15 min, a solution of N-hydroxy phthalimide (134.8 mg, 0.826 mmol) in anhydrous THF was added over 10 min. The reaction mixture was stirred at room temperature for 12 h under argon. After removing solvents under vacuum, TFA:triisopropylsilane:water (95:2.5:2.5; 5 mL) was added to the crude product and stirred at room temperature for 1 h to deprotect tert-butyl group. The final product was purified by flash chromatography (hexane:EtOAc = 1 : 1). Solvent of the combined pure fractions was evaporated under vacuum to yield final product as oily liquid. 1HNMR (CDC13): δ 2.63 (m, 2H); 3.59-3.65 (m, 14H); 3.88 (m, 2H); 4.38 (m, 2H); 7.75 (m, 2H), 7.84 (m, 2H) LC/MS (ESI) (m/z): (M + H )+ calcd. for C19H25N09, 41 1.4, found, 41 1.4 g/mol.
Example 40
[00679] To a solution of HOOC-PEG4-0-N-phthalimide
(50 mg, 0.122 mmol), N-hydroxysuccinimide (NHS, 15.4 mg, 0.134 mmol), and 4- dimethylaminopyridine (DMAP, 1.5 mg, 0.0122 mmol) in anhydrous DCM (0.5 mL) under
argon, ethyl(dimethylaminopropyl) carbodiimide (EDC, 20.8 mg, 0.134 mmol) in anhydrous DCM (0.5 mL) followed was added. The reaction mixture was stirred at room temperature for 4 h under argon and purified using flash chromatography (hexane:DCM = 1 : 1) to yield NHS- PEG4-0-N-phthalimide. Solvent of the combined pure fractions was removed under vacuum to yield final product as oily liquid. 1 HNMR: δ 2.90 (t, J=6.4, 2H); 2.75 (bs, 4H); 3.56-3.63 (m, 12H), 3.83-3.87 (m, 4H), 4.37 (t, J=4.5, 2H); 7.75 (m, 2H), 7.83 (m, 2H).LC/MS (ESI) (m/z): (M + H)+ calcd. for C23H28N201 1, 508.5, found, 509.0 g/mol.
Example 41
[00680] a solution of NHS-
OC-PEG4-0-N-phthalimide (21 mg, 0.041 mmol) and folate-N10(TFA)-Lys (25 mg, 0.037 mmol) in anhydrous DMSO (300 μΐ.) under argon, DIPEA (101.4 μΕ, 0.601 mmol) was added. The reaction mixture was continued to stir at room temperature for 2 h and progression of the reaction was followed by LC/MS. The final product was purified using RP preparative HPLC (CI 8 column, 0% B - 50%B in 25 min, buffer A: 0.1 TFA in water, buffer B: 0.1 TFA in acetonitrile, λ = 280 nm). After removing ACN under vacuum, pure fractions were freeze-dried to yield pale yellow solid. LC/MS (ESI) (m/z): (M + H )+ calcd. for C46H53F3N10O16, 1058.9, found, 1059.0 g/mol.
Example 42
Synthesis of Folate- Lys-PEG4-aminooxy Linker (4)
N10(TFA)-Lys-PEG-phthalimide (30 mg, 0.028 mmol) in DMSO (1 mL), hydrazine (13 μί, 0.42 mmol) was added and pH of the reaction was maintained at 9.35. Deprotection of phthalimide and TFA groups was monitored using LC/MS. Folate-Lys-PEG4-aminooxy linker was purified using reverse-phase preparative HPLC (CI 8 column, 0% B - 50%B in 25 min, buffer A: 0.1 TFA in water, buffer B: 0.1 TFA in acetonitrile, λ = 280 nm). After removing ACN under vacuum, pure fractions were freeze-dried to furnish yellow solid. Ή
NMR (DMSO-d6/ D20) δ 1.88 (m, 1H, Pep-H); 2.03 (m, 1H, Pep-H); 2.15 (t, J = 7.4, 2H); 2.28 (t, J = 6.4, 2H); 3.05 (m, 4H); 3.20-3.60 (m, xH ); 3.94 (m, 1H, Lys-aH); 4.23 (m, 1H, Glu-aH); 4.48 (s, 2H, Ptc-H); 6.64 (d, J = 8.8 Hz, 2H, Ptc-Ar-H); 7.64 (d, J = 8.8 Hz, 2H, Ptc-Ar-H); 8.63 (s, 1H, Pte-Ar-H); LC/MS (ESI) (m/z): (M + H )+ calcd. for C36H52N10O13, 832.9 g/mol, found, 833.0 g/mol.
Example 43
Folate-anti-CD3 conjugation
[00682]
A solution of anti-CD3 Fab containing pAcPhe (10 mg, 0.21 μηιοΐ) in PBS pH 7.4 (1 mL) was buffer exchanged into 50mM sodium acetate pH 4.0 (900 μί,). After adding 1M acetic hydrazide (100 μί), folate-Lys-PEG4-aminooxy linker (1.7 mg, 2.10 μηιοΐ) was added to the reaction mixture and incubated at 28 °C for 48 hrs with shaking (50 rpm). Progress of the reaction was monitored by RP-HPLC (Zorbax 300SB C3 column, 4.6x150mm; Agilent). Conjugates were eluted with a linear gradient from 30% B to 90%B (A, water, 0.1% TFA; B, Acetonitrile, 0.1% TFA). An Agilent 1 100 series HPLC system and Chemstation software were used to resolve and quantify percentage of Fab conjugated with folate-linker. The reaction was completed within 48 h with >95% conversion efficiency. The final conjugate was purified using cation exchange column (SP 650S, Tosoh Biosciences), buffer exchanged into PBS, and stored at 4°C until use. Expected MS: 48539.64 Da, Observed MS: 48538.89 Da.
Example 44
In vitro efficacy studies
[00683] Target cells- KB, OVCAR-3, SKOV-3, and OV-90 cells, were maintained in folate-free RPMI-1640 supplemented with 10% FBS and 100 units/ml of penicillin and 100 μg/ml of streptomycin for at least five passages before they were used for the assays. Jurkat and A549 cells were maintained in RPMI-1640 supplemented with 10% FBS and 100 units/ml of penicillin and 100 μg/ml of streptomycin. All the cells were grown as monolayers in a 5% carbon dioxide, 95% air-humidified atmosphere at 37°C.
[00684] For FR expression, cells were incubated with anti-FR-PE antibody (blue) and
IgGl-Isotype-PE control (red) from R&D systems at 4 °C for 1 hrs and binding was assayed by flow cytometry. KB or A549 cells were seeded into a T75 flask and allowed to form a monolayer over 48 h. After trypsin digestion, cells were transferred into centrifuge tubes (1 χ 106 cells/tube) and centrifuged. The medium was replaced with fresh medium containing increasing concentration of folate-FITC and incubated for 30 min at 4 °C. After rinsing with fresh medium (2χ 1.0 mL) and PBS ( l x 1.0 mL), cells were resuspended in PBS (1.0 mL) and cell bound fluorescence was analyzed (30,000 cells/sample) using a flow cytometer. KB cells were plated into a T75 flask and allowed to form a monolayer over 48 h. After trypsin digestion, release cells were transferred into centrifuge tubes (1 χ 106 cells/tube) and centrifuged. Spent medium in each tube was replaced with 100 nM FA-FITC in the presence of increasing concentration (0.1 nM - 0.8 nM) of anti-CD3 Fab-folate in fresh medium (0.5 mL). After incubating for 30 min at 4°C, cells were rinsed with culture medium (2 x 1.0 mL) and PBS (1 x 1.0 mL) to remove any unbound radioactivity. Cells were then re-suspended in PBS (0.5 mL) and cell bound fluorescence was counted using a flow cytometer.
[00685] Human peripheral blood mononuclear cells (PBMC) were isolated from buffy coat (San Diego Blood Bank) using Ficoll Hypaque Plus (GE Heathcare) gradient centrifugation. In the event there were not enough cells from a single donor, several donors were used, but each were be kept separate (i.e., not mixed together) when used either in vitro or in vivo. PBMCs were activated with aCD3/aCD28 supramagnetic beads (Life Technologies) in the presence of rhIL-2 (100 ng/ml) and GMCSF (100 ng/ml).
[00686] For cytotoxicity assays, target cells were detached from the flasks with Accutase and seeded into U bottom 96-well plates. Activated PBMCs (effector cells) or non- activated PBMCs (effector cells) were added to the targeted cells at specified target: effector cells ratios. Anti-CD3 folate was diluted in complete culture medium added to the co-culture and after a brief centrifugation the plates were incubatated at 5% C02 and at 37 °C for 24hrs. For cytotoxicity by LDH release, LDH was measured using a kit from Promega as per manufacturer's instructions. For cytotoxicity by flow cytometry, cells were labeled with DIO (green plasma membrane stain) and propidium iodide was added to a final concentration of 1 μg/mL.9 For cytotoxicity by ATP content, PBMCs were washed off after 24hrs and ATP content of KB cells was measured using Cell Titer Glo (Promega).
Example 45
Pharmacokinetic study
[00687] Anti-CD3 Fab-folate and unconjugated CD3 Fab were administered to Sprague-Dawley rats (Charles River Laboratories) as a single bolus intravenous injection. Blood was collected at regular intervals and anti-CD3 Fab-folate was quantified in rat serum by ELISA. The pharmacokinetic properties of the conjugates were measured as time vs. serum concentration.
Example 46
In Vivo Efficacy studies
[00688] 6- to 8-wk-old female NOD-SCID mice were purchased from either from TSRI animal facilities or from The Jackson Laboratory and maintained on gamma-irradiated folate-deficient special diet (Teklad) for at least 2 weeks before the start of the study. Animals were housed 5/cage in a barrier, pathogen-free cloaked rack. Autoclaved tap water and food were given ad libitum. Mice were identified individually by tattoo at the base of the tail or ear punch. All animal procedures were approved by The Scripps Research Institute Animal Care and Use Committee and Ambrx, Inc. Animal Care and Use Committee and were performed according to national and international guidelines for the humane treatment of animals.
[00689] Tumor cells (KB cells at 5 x lOVmouse) were mixed with activated or non- activated PBMCs (in the specified target: effector cells ratios) and implanted sub-cutaneous in the left flank as 200ul injections. Animals were treated IV with 1.5 mg/kg anti-CD3 Fab- folate or PBS daily for 10 injections (black arrows) starting on the same day as tumor cell implantation, with an occasional 2-day break in dosing to accommodate for weekends. Tumor growth was monitored biweekly by measuring in two perpendicular directions and the volumes were estimated using the formula V = (L x W x W)/2 where V = volume, W = shortest diameter, and L = longest diameter. Body weight was determined by weighing the mice on an electronic weighing machine. The experiments were terminated when group average tumor size reached approximately 1,000 mm3 or 35 days after start of dosing, whichever occurs first.
[00690] For immunohistochemical analysis, animals were sacrificed using Isoflurane and tumors as well as various organs were isolated and fixed in Formalin-Zinc overnight. Tissues were embedded in paraffin and sectioned for staining. Hematoxylin and Eosin (H&E)
staining was performed as per standard protocols and slides were scanned using a Leica Scanner.
Example 47
[00691] The cytotoxicity of an anti-CD3-Folate with activated PBMC and FOLR expressing cells was measured in NCI-H838 cells and KB cells as shown in Figures 22 and 23. Administering an excess of folic acid was shown to modulate the toxicity of an anti-CD3-folate ADC with 2nM folic acid. The percent cytotoxicity in each of theFOLR expressing cells (Group 1: NCI-H1651; Group 2: NCI-H2405; Group 3: NCI-H838; Group 4: NCI-H2347; Group 5: KB). The cytotoxicity was measured at varying concentrations of conjugated UCHTi-folate (in this example comprising SEQ ID NO: 18 and/or 20) measured in ng/mL. The EC50 for each of the respective test groups was: Group 1: NCI-H1651 EC50 0.22 ng/mL; Group 2: NCI-H2405 EC50 1.48 ng/mL; Group 3: NCI-H838 EC50 0.36 ng/mL; Group 4: NCI-H2347 EC50 .30 ng/mL; Group 5: KB EC50 0.024 ng/mL.
[00692] It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference herein in their entirety for all purposes.
ADDITIONAL AND ALTERNATE EMBODIMENTS OF THE INVENTION
1. A polypeptide small molecule conjugate (PSMC) comprising one or more non- naturally encoded amino acids.
2. The PSMC of claim 1 , wherein the antigen-binding polypeptide comprises one or more post-translational modifications.
3. The PSMC of claim 1, wherein the antigen-binding polypeptide is linked to a linker, polymer, or biologically active molecule.
4. The PSMC of claim 3, wherein the polypeptide is linked to a water soluble polymer.
5. The PSMC of claim 1, wherein the polypeptide is linked to a bifunctional polymer, bifunctional linker, or at least one additional antigen-binding polypeptide.
6. The PSMC of claim 5, wherein the bifunctional linker or polymer is linked to a second polypeptide.
7. The PSMC of claim 6, wherein the second polypeptide is an antigen-binding polypeptide.
8. The PSMC of claim 6, wherein the second polypeptide is a non-antigen-binding polypeptide.
9. The PSMC of claim 4, wherein the water soluble polymer comprises a poly(ethylene glycol) moiety.
10. The PSMC of claim 5, wherein the Afunctional polymer is a poly(ethylene glycol) moiety.
1 1. The PSMC of claim 4, wherein said water soluble polymer is linked to a non- naturally encoded amino acid present in said antigen-binding polypeptide.
12. The PSMC of claim 1 , comprising at least two amino acids linked to a water soluble polymer comprising a poly(ethylene glycol) moiety.
13. The PSMC of claim 12, wherein at least one amino acid linked to said water soluble polymer is a non-naturally encoded amino acid.
14. The PSMC of claim 1 , wherein the antigen-binding polypeptide comprises one or more amino acid substitution, addition or deletion that modulates affinity of the antigen- binding polypeptide for a PSMC receptor or antigen.
15. The PSMC of claim 1 , wherein the antigen-binding polypeptide comprises one or more amino acid substitution, addition or deletion that modulates the stability, expression level in a recombinant host cell or synthesized in vitro, immunogenicity, protease resistance, tissue or organ specificity, or solubility of the antigen-binding polypeptide.
16. The PSMC of claim 1, wherein the non-naturally encoded amino acid is reactive toward a linker, polymer, or biologically active molecule that is otherwise unreactive toward any of the 20 common amino acids in the polypeptide.
17. The PSMC of claim 1, wherein the non-naturally encoded amino acid comprises a carbonyl group, an aminooxy group, a hydrazine group, a hydrazide group, a semicarbazide group, an azide group, or an alkyne group.
18. The PSMC of claim 17, wherein the non-naturally encoded amino acid comprises a carbonyl group.
wherein n is 0-10; Rl is an alkyl, aryl, substituted alkyl, or substituted aryl; R2 is H, an alkyl, aryl, substituted alkyl, and substituted aryl; and R3 is H, an amino acid, a polypeptide, or an
amino terminus modification group, and R4 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
20. The PSMC of claim 17, wherein the non-naturally encoded amino acid comprises an aminooxy group.
21. The PSMC of claim 17, wherein the non-naturally encoded amino acid comprises a hydrazide group.
22. The PSMC of claim 17, wherein the non-naturally encoded amino acid comprises a hydrazine group.
23. The PSMC of claim 17, wherein the non-naturally encoded amino acid comprises a semicarbazide group.
24. The PSMC of claim 17, wherein the non-naturally encoded amino acid comprises an azide group.
wherein n is 0-10; Rl is an alkyl, aryl, substituted alkyl, substituted aryl or not present; X is O, N, S or not present; m is 0-10; R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
26. The PSMC of claim 17, wherein the non-naturally encoded amino acid comprises an alkyne group.
wherein n is 0-10; Rl is an alkyl, aryl, substituted alkyl, or substituted aryl; X is O, N, S or not present; m is 0-10, R2 is H, an amino acid, a polypeptide, or an amino terminus modification group, and R3 is H, an amino acid, a polypeptide, or a carboxy terminus modification group.
28. The PSMC of claim 4, wherein the water soluble polymer has a molecular weight of between about 0.1 kDa and about 100 kDa.
29. The PSMC of claim 28, wherein the water soluble polymer has a molecular weight of between about 0.1 kDa and about 50 kDa.
30. The PSMC of claim 4, which is made by reacting an antigen-binding polypeptide comprising a carbonyl-containing amino acid with a water soluble polymer comprising an aminooxy, a hydrazine, hydrazide or semicarbazide group.
31. The PSMC of claim 30, wherein the aminooxy, hydrazine, hydrazide or semicarbazide group is linked to the water soluble polymer through an amide linkage.
32. The PSMC of claim 4, which is made by reacting a water soluble polymer comprising a carbonyl group with a polypeptide comprising a non-naturally encoded amino acid that comprises an aminooxy, a hydrazine, a hydrazide or a semicarbazide group.
33. The PSMC of claim 4, which is made by reacting an antigen-binding polypeptide comprising an alkyne-containing amino acid with a water soluble polymer comprising an azide moiety.
34. The PSMC of claim 4, which is made by reacting an PSMC comprising an azide- containing amino acid with a water soluble polymer comprising an alkyne moiety.
35. The PSMC of claim 17, wherein the azide or alkyne group is linked to a water soluble polymer through an amide linkage.
36. The PSMC of claim 4, wherein the water soluble polymer is a branched or multiarmed polymer.
37. The PSMC of claim 36, wherein each branch of the water soluble polymer has a molecular weight of between about 1 kDa and 100 kDa.
38. The PSMC of claim 1 , wherein the polypeptide is an antagonist.
39. The PSMC of claim 38, wherein the polypeptide comprises one or more post- translational modification, linker, polymer, or biologically active molecule.
40. The PSMC of claim 39, wherein the polymer comprises a moiety selected from a group consisting of a water soluble polymer and poly(ethylene glycol).
41. The PSMC of claim 1, wherein the non-naturally encoded amino acid comprises a saccharide moiety.
42. The PSMC of claim 3, wherein the linker, polymer, or biologically active molecule is linked to the polypeptide via a saccharide moiety.
43. An isolated nucleic acid comprising a polynucleotide that hybridizes under stringent conditions to an PSMC-encoding polynucleotide, wherein the polynucleotide comprises at least one selector codon.
44. The isolated nucleic acid of claim 43, wherein the selector codon is selected from the group consisting of an amber codon, ochre codon, opal codon, a unique codon, a rare codon, and a four-base codon.
45. A method of making the PSMC of claim 3, the method comprising contacting an isolated PSMC comprising a non-naturally encoded amino acid with a linker, polymer, or biologically active molecule comprising a moiety that reacts with the non-naturally encoded amino acid.
46. The method of claim 45, wherein the polymer comprises a moiety selected from a group consisting of a water soluble polymer and poly(ethylene glycol).
47. The method of claim 45, wherein the non-naturally encoded amino acid comprises a carbonyl group, an aminooxy group, a hydrazide group, a hydrazine group, a semicarbazide group, an azide group, or an alkyne group.
48. The method of claim 45, wherein the non-naturally encoded amino acid comprises a carbonyl moiety and the linker, polymer, or biologically active molecule comprises an aminooxy, a hydrazine, a hydrazide, or a semicarbazide moiety.
49. The method of claim 48, wherein the aminooxy, hydrazine, hydrazide, or semicarbazide moiety is linked to the linker, polymer, or biologically active molecule through an amide linkage.
50. The method of claim 45, wherein the non-naturally encoded amino acid comprises an alkyne moiety and the linker, polymer, or biologically active molecule comprises an azide moiety.
51. The method of claim 45, wherein the non-naturally encoded amino acid comprises an azide moiety and the linker, polymer, or biologically active molecule comprises an alkyne moiety.
52. The method of claim 47, wherein the azide or alkyne moiety is linked to a linker, polymer, or biologically active molecule through an amide linkage.
53. The method of claim 46, wherein the poly(ethylene glycol) moiety has an average molecular weight of between about 0.1 kDa and about 100 kDa.
54. The method of claim 46, wherein the poly(ethylene glycol) moiety is a branched or multiarmed polymer.
55. A composition comprising the PSMC of claim 1 and a pharmaceutically acceptable carrier.
56. The composition of claim 55, wherein the non-naturally encoded amino acid is linked to a water soluble polymer.
57. A method of treating a patient having a disorder modulated by PSMC comprising administering to the patient a therapeutically-effective amount of the composition of claim 55.
58. A cell comprising the nucleic acid of claim 43.
59. The cell of claim 58, wherein the cell comprises an orthogonal tRNA synthetase or an orthogonal tRNA.
60. A method of making an PSMC comprising a non-naturally encoded amino acid, the method comprising, culturing cells comprising a polynucleotide or polynucleotides encoding an PSMC comprising a selector codon, an orthogonal RNA synthetase and an orthogonal tRNA under conditions to permit expression of the PSMC comprising a non-naturally encoded amino acid; and purifying the PSMC.
61. A method of modulating serum half-life or circulation time of an PSMC, the method comprising substituting one or more non-naturally encoded amino acids for any one or more naturally occurring amino acids in the PSMC.
62. An PSMC encoded by a polynucleotide wherein said polynucleotide comprises a selector codon, and wherein said polypeptide comprises at least one non-naturally encoded amino acid.
63. The PSMC of claim 62, wherein the non-naturally encoded amino acid is linked to a linker, polymer, water soluble polymer, or biologically active molecule.
64. The PSMC of claim 63, wherein the water soluble polymer comprises a poly(ethylene glycol) moiety.
65. The PSMC of claim 62, wherein the non-naturally encoded amino acid comprises a carbonyl group, an aminooxy group, a hydrazide group, a hydrazine group, a semicarbazide group, an azide group, or an alkyne group.
66. The PSMC of claim 64, wherein the poly(ethylene glycol) moiety has a molecular weight of between about 0.1 kDa and about 100 kDa.
67. The PSMC of claim 64, wherein the poly(ethylene glycol) moiety is a branched or multiarmed polymer.
68. The PSMC of claim 67, wherein the poly(ethylene glycol) moiety has a molecular weight of between about 1 kDa and about 100 kDa.
69. A composition comprising the PSMC of claim 62 and a pharmaceutically acceptable carrier.
70. A bispecific PSMC comprising a first PSMC and a second PSMC joined to each other wherein said first PSMC and said second PSMC bind specifically to different epitopes wherein said first PSMC has binding specificity for at least one epitope on a first antigen, and the second PSMC has binding specificity for a second epitope on the first antigen or a second antigen which is different from said first epitope, and wherein said bispecific PSMC comprises at least one non-naturally encoded amino acid.
71. The bispecific PSMC of claim 70, wherein said first PSMC and said second PSMC are joined by a linker.
72. The bispecific PSMC of claim 71, wherein said linker is a peptide linker.
73. The bispecific PSMC of claim 72, wherein said linker is a peptide linker that lacks a proteolytic cleavage site.
74. The bispecific PSMC of claim 70, wherein said first PSMC is a single chain PSMC and said second PSMC is a single chain PSMC and said first PSMC is coupled to said second
PSMC by a peptide linker.
75. A composition comprising a bispecific PSMC of claim 70 and a pharmaceutically acceptable carrier.
76. A method for treating a disease or condition, said method comprising administering to a patient in need thereof a therapeutically effective amount of the composition of claim 75.
77. A PSMC comprising the bispecific PSMC of claim 70, coupled to a biologically active molecule.
78. The PSMC of claim 77, wherein said biologically active molecule is selected from the group consisting of a cytotoxin, a label, a radionuclide, a drug, a liposome, a ligand, and a PSMC.
79. The PSMC of claim 77, wherein said PSMC is a fusion protein.
80. A method of detecting a cell or tissue expressing one or more antigens, said method comprising: contacting a cell or tissue with a PSMC of claim 70 attached to a detectable label; and detecting said label wherein detection of said label in association with a cell or tissue indicates the presence of a cell or tissue expressing one or more antigens bound by the PSMC.
81. The method of claim 80, wherein said detectable label is selected from the group consisting of a gamma emitter, a positron emitter, an MRI label, and a fluorescent label.
82. The method of claim 80, wherein said detectable label is a gamma emitter and said detecting comprises imaging with a gamma camera.
83. The method of claim 80, wherein said detectable label is a positron emitter and said detecting comprises imaging with positron emission tomography (PET).
84. The method of claim 80, wherein said detectable label is an MRI label and said detecting comprises detecting with magnetic resonance imaging.
85. An PSMC comprising a water soluble polymer linked by a covalent bond to the PSMC at a single amino acid.
86. The PSMC of claim 85, wherein the water soluble polymer comprises a poly(ethylene glycol) moiety.
87. The PSMC of claim 85, wherein the amino acid covalently linked to the water soluble polymer is a non-naturally encoded amino acid.
88. An PSMC comprising at least one linker, polymer, or biologically active molecule, wherein said linker, polymer, or biologically active molecule is attached to the polypeptide through a functional group of a non-naturally encoded amino acid ribosomally incorporated into the polypeptide.
89. The PSMC of claim 88, wherein said PSMC is monoPEGylated.
90. An PSMC comprising a linker, polymer, or biologically active molecule that is attached to one or more non-naturally encoded amino acids wherein said non-naturally encoded amino acid is ribosomally incorporated into the polypeptide at pre-selected sites.
91. The PSMC of claim 90, wherein the PSMC comprises one said linker, polymer, or biologically active molecule.
92. The PSMC of claim 1 , wherein the PSMC comprises one or more amino acid substitution, addition, or deletion that modulates serum half-life or circulation time of the PSMC.
93. A method of modulating immunogenicity of an PSMC, the method comprising substituting one or more non-naturally encoded amino acids for any one or more naturally occurring amino acids in the PSMC.
94. The isolated nucleic acid of claim 43, wherein the sequence of the isolated nucleic acid is selected from the group consisting of SEQ ID NO: 19, 21 or fragment thereof.
95. An antigen-binding polypeptide wherein the polypeptide is selected from the group consisting of SEQ ID NO: 18, 20, or fragment thereof.
96. The antigen-binding polypeptide of claim 3, wherein the antigen-binding polypeptide is linked to the linker, polymer, or biologically active molecule under denaturing conditions.
Claims
1. A polypeptide small molecule conjugate (PSMC) comprising one or more non-naturally encoded amino acids.
2. The PSMC of claim 1 , wherein the antigen-binding polypeptide comprises one or more post-translational modifications.
3. The PSMC of claim 1, wherein the antigen-binding polypeptide is linked to a linker, polymer, or biologically active molecule.
4. The PSMC of claim 3, wherein the polypeptide is linked to a water soluble polymer.
5. The PSMC of claim 1, wherein the polypeptide is linked to a bifunctional polymer, bifunctional linker, or at least one additional antigen-binding polypeptide.
6. The PSMC of claim 5, wherein the bifunctional linker or polymer is linked to a second polypeptide.
7. The PSMC of claim 1 , wherein the antigen-binding polypeptide comprises
SEQ ID NO: 18 or SEQ ID NO: 20.
8. The PSMC of cairn 1 , wherein the antigen-binding polypeptide comprises SEQ ID NO: 18 and SEQ ID NO: 20.
9. The PSMC of claim 1 wherein the PSMC is an anti-CD3 -Folate Fab.
10. The PSMC of claim 1, wherein the conjugate has the formula (A)-(L)-(C), wherein: (A) comprises the antibody or antigen binding fragment of claim 1 ; (L) comprises a linker; and (C) comprises a cytotoxic agent, wherein said linker (L) links (A) to (C) and wherein (A) comprises an antibody comprising the heavy chain of SEQ ID NO:20 and the light chain of SEQ ID NO: 18.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361823373P | 2013-05-14 | 2013-05-14 | |
US61/823,373 | 2013-05-14 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014185985A1 true WO2014185985A1 (en) | 2014-11-20 |
Family
ID=51898759
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2014/000123 WO2014185985A1 (en) | 2013-05-14 | 2014-05-14 | Novel polypeptide small molecule conjugates and their uses |
Country Status (2)
Country | Link |
---|---|
TW (1) | TW201446804A (en) |
WO (1) | WO2014185985A1 (en) |
Cited By (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10351626B2 (en) | 2013-03-14 | 2019-07-16 | The Scripps Research Institute | Targeting agent antibody conjugates and uses thereof |
CN111150844A (en) * | 2020-01-10 | 2020-05-15 | 康宏耀源(天津)科技有限公司 | Synthesis and application of anti-HER 2 affibody targeted photosensitizer |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20040236078A1 (en) * | 1991-06-14 | 2004-11-25 | Genentech, Inc. | Method for making humanized antibodies |
US20070148670A1 (en) * | 2005-12-28 | 2007-06-28 | O'malley Shawn M | Methods for detecting conformational changes in bioentities |
WO2009024771A2 (en) * | 2007-08-17 | 2009-02-26 | Biotransformations Limited | Materials and methods for treating cancers which express folate receptors |
-
2014
- 2014-05-14 WO PCT/US2014/000123 patent/WO2014185985A1/en active Application Filing
- 2014-05-14 TW TW103117030A patent/TW201446804A/en unknown
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20040236078A1 (en) * | 1991-06-14 | 2004-11-25 | Genentech, Inc. | Method for making humanized antibodies |
US20070148670A1 (en) * | 2005-12-28 | 2007-06-28 | O'malley Shawn M | Methods for detecting conformational changes in bioentities |
WO2009024771A2 (en) * | 2007-08-17 | 2009-02-26 | Biotransformations Limited | Materials and methods for treating cancers which express folate receptors |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10351626B2 (en) | 2013-03-14 | 2019-07-16 | The Scripps Research Institute | Targeting agent antibody conjugates and uses thereof |
US11377496B2 (en) | 2013-03-14 | 2022-07-05 | The Scripps Research Institute | Targeting agent antibody conjugates and uses thereof |
CN111150844A (en) * | 2020-01-10 | 2020-05-15 | 康宏耀源(天津)科技有限公司 | Synthesis and application of anti-HER 2 affibody targeted photosensitizer |
Also Published As
Publication number | Publication date |
---|---|
TW201446804A (en) | 2014-12-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2005265163B2 (en) | Novel antigen-binding polypeptides and their uses | |
JP5694171B2 (en) | Modified animal erythropoietin polypeptides and their use | |
JP5840345B2 (en) | Modified human plasma polypeptides or modified human Fc scaffold proteins and uses thereof | |
WO2010006214A1 (en) | Fgf-21 neutralizing antibodies and their uses | |
WO2010051056A2 (en) | ANTI-FcεRI POLYPEPTIDES AND THEIR USES | |
US20150018530A1 (en) | Novel Prodrug Containing Molecule Compositions and Their Uses | |
WO2011079293A1 (en) | Tumor necrosis factor-related apoptosis inducing ligand polypeptides and their uses | |
WO2009052435A1 (en) | Anti-tnfri polypeptides and their uses | |
WO2014185985A1 (en) | Novel polypeptide small molecule conjugates and their uses | |
CN1968712B (en) | Novel antigen-binding polypeptides and their uses | |
AU2012203737B2 (en) | Modified human plasma polypeptide or Fc scaffolds and their uses |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14798083 Country of ref document: EP Kind code of ref document: A1 |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
122 | Ep: pct application non-entry in european phase |
Ref document number: 14798083 Country of ref document: EP Kind code of ref document: A1 |