WO2014177459A2 - Fc-receptor binding modified asymmetric antibodies and methods of use - Google Patents
Fc-receptor binding modified asymmetric antibodies and methods of use Download PDFInfo
- Publication number
- WO2014177459A2 WO2014177459A2 PCT/EP2014/058416 EP2014058416W WO2014177459A2 WO 2014177459 A2 WO2014177459 A2 WO 2014177459A2 EP 2014058416 W EP2014058416 W EP 2014058416W WO 2014177459 A2 WO2014177459 A2 WO 2014177459A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- region
- region polypeptide
- mutations
- igg class
- human
- Prior art date
Links
- 102000009109 Fc receptors Human genes 0.000 title claims abstract description 28
- 108010087819 Fc receptors Proteins 0.000 title claims abstract description 26
- 230000027455 binding Effects 0.000 title claims description 232
- 238000009739 binding Methods 0.000 title claims description 229
- 238000000034 method Methods 0.000 title claims description 85
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 709
- 229920001184 polypeptide Polymers 0.000 claims abstract description 706
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 706
- 241000282414 Homo sapiens Species 0.000 claims abstract description 419
- 125000000539 amino acid group Chemical group 0.000 claims abstract description 104
- 230000035772 mutation Effects 0.000 claims description 548
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 290
- 102220535093 Gamma-aminobutyric acid type B receptor subunit 2_H310A_mutation Human genes 0.000 claims description 132
- 102100026120 IgG receptor FcRn large subunit p51 Human genes 0.000 claims description 117
- 239000000427 antigen Substances 0.000 claims description 99
- 108091007433 antigens Proteins 0.000 claims description 97
- 102000036639 antigens Human genes 0.000 claims description 97
- 102220521272 Protein phosphatase 1 regulatory subunit 3C_H435Q_mutation Human genes 0.000 claims description 78
- 150000001413 amino acids Chemical class 0.000 claims description 73
- 102220562703 Protein Tob2_L234A_mutation Human genes 0.000 claims description 69
- 230000004927 fusion Effects 0.000 claims description 59
- 108090000623 proteins and genes Proteins 0.000 claims description 59
- 102000004169 proteins and genes Human genes 0.000 claims description 55
- 102200072304 rs1057519530 Human genes 0.000 claims description 54
- 108010068617 neonatal Fc receptor Proteins 0.000 claims description 49
- 230000002829 reductive effect Effects 0.000 claims description 38
- 238000011282 treatment Methods 0.000 claims description 38
- 102100034608 Angiopoietin-2 Human genes 0.000 claims description 36
- 101000924533 Homo sapiens Angiopoietin-2 Proteins 0.000 claims description 34
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 33
- 238000004519 manufacturing process Methods 0.000 claims description 33
- 239000003814 drug Substances 0.000 claims description 30
- 239000008194 pharmaceutical composition Substances 0.000 claims description 28
- 108010048036 Angiopoietin-2 Proteins 0.000 claims description 26
- 101000808011 Homo sapiens Vascular endothelial growth factor A Proteins 0.000 claims description 24
- 102000058223 human VEGFA Human genes 0.000 claims description 24
- 230000004075 alteration Effects 0.000 claims description 22
- 208000014245 Ocular vascular disease Diseases 0.000 claims description 19
- 102000005962 receptors Human genes 0.000 claims description 19
- 108020003175 receptors Proteins 0.000 claims description 19
- 230000015572 biosynthetic process Effects 0.000 claims description 17
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 claims description 16
- 102100035359 Cerebellar degeneration-related protein 2-like Human genes 0.000 claims description 6
- 101000737792 Homo sapiens Cerebellar degeneration-related protein 2-like Proteins 0.000 claims description 6
- 241000191940 Staphylococcus Species 0.000 claims description 5
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 162
- 235000001014 amino acid Nutrition 0.000 description 93
- 210000004027 cell Anatomy 0.000 description 87
- 229940024606 amino acid Drugs 0.000 description 73
- 102220542962 Polyunsaturated fatty acid 5-lipoxygenase_H433A_mutation Human genes 0.000 description 59
- 235000018102 proteins Nutrition 0.000 description 53
- 238000006467 substitution reaction Methods 0.000 description 49
- 239000000203 mixture Substances 0.000 description 45
- 238000009472 formulation Methods 0.000 description 40
- 150000007523 nucleic acids Chemical class 0.000 description 40
- 102000039446 nucleic acids Human genes 0.000 description 39
- 108020004707 nucleic acids Proteins 0.000 description 39
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 description 32
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 32
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical compound COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 27
- 230000000694 effects Effects 0.000 description 27
- 238000002347 injection Methods 0.000 description 23
- 239000007924 injection Substances 0.000 description 23
- 238000003556 assay Methods 0.000 description 22
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 21
- 230000003993 interaction Effects 0.000 description 21
- 230000009261 transgenic effect Effects 0.000 description 21
- 241000699666 Mus <mouse, genus> Species 0.000 description 20
- 238000005734 heterodimerization reaction Methods 0.000 description 18
- 210000002966 serum Anatomy 0.000 description 18
- 239000013598 vector Substances 0.000 description 18
- 238000013459 approach Methods 0.000 description 17
- 238000012986 modification Methods 0.000 description 17
- 238000005516 engineering process Methods 0.000 description 16
- 108060003951 Immunoglobulin Proteins 0.000 description 15
- 241000699670 Mus sp. Species 0.000 description 15
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 15
- 102000018358 immunoglobulin Human genes 0.000 description 15
- 230000004048 modification Effects 0.000 description 15
- 102220516627 Kynurenine-oxoglutarate transaminase 1_T256E_mutation Human genes 0.000 description 14
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 14
- 230000002950 deficient Effects 0.000 description 14
- 201000010099 disease Diseases 0.000 description 14
- 230000014509 gene expression Effects 0.000 description 14
- 230000006870 function Effects 0.000 description 13
- 239000000833 heterodimer Substances 0.000 description 13
- 238000001727 in vivo Methods 0.000 description 13
- 241001529936 Murinae Species 0.000 description 12
- 102220470812 Proteasome assembly chaperone 2_S254T_mutation Human genes 0.000 description 12
- -1 mannitol or sorbitol Chemical class 0.000 description 12
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 11
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 11
- 238000001042 affinity chromatography Methods 0.000 description 11
- 229940079593 drug Drugs 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 239000006166 lysate Substances 0.000 description 11
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 10
- 230000004071 biological effect Effects 0.000 description 10
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 10
- 238000003780 insertion Methods 0.000 description 10
- 230000037431 insertion Effects 0.000 description 10
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 9
- 101000955962 Homo sapiens Vacuolar protein sorting-associated protein 51 homolog Proteins 0.000 description 9
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 9
- 241001465754 Metazoa Species 0.000 description 9
- 206010028980 Neoplasm Diseases 0.000 description 9
- 239000003795 chemical substances by application Substances 0.000 description 9
- 230000036541 health Effects 0.000 description 9
- 230000001900 immune effect Effects 0.000 description 9
- 229940127121 immunoconjugate Drugs 0.000 description 9
- 230000014759 maintenance of location Effects 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- 241000282693 Cercopithecidae Species 0.000 description 8
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 8
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 8
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 201000011510 cancer Diseases 0.000 description 8
- 239000003937 drug carrier Substances 0.000 description 8
- 210000004408 hybridoma Anatomy 0.000 description 8
- 239000003446 ligand Substances 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 229920000642 polymer Polymers 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 230000005180 public health Effects 0.000 description 8
- 230000002285 radioactive effect Effects 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 7
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 7
- 239000004480 active ingredient Substances 0.000 description 7
- 235000004279 alanine Nutrition 0.000 description 7
- 239000003153 chemical reaction reagent Substances 0.000 description 7
- 230000004087 circulation Effects 0.000 description 7
- 150000001875 compounds Chemical class 0.000 description 7
- 235000018417 cysteine Nutrition 0.000 description 7
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 7
- 238000012217 deletion Methods 0.000 description 7
- 230000037430 deletion Effects 0.000 description 7
- 208000035475 disorder Diseases 0.000 description 7
- 239000012636 effector Substances 0.000 description 7
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 7
- 238000001990 intravenous administration Methods 0.000 description 7
- 150000002482 oligosaccharides Chemical class 0.000 description 7
- 239000004475 Arginine Substances 0.000 description 6
- SHZGCJCMOBCMKK-UHFFFAOYSA-N D-mannomethylose Natural products CC1OC(O)C(O)C(O)C1O SHZGCJCMOBCMKK-UHFFFAOYSA-N 0.000 description 6
- PNNNRSAQSRJVSB-SLPGGIOYSA-N Fucose Natural products C[C@H](O)[C@@H](O)[C@H](O)[C@H](O)C=O PNNNRSAQSRJVSB-SLPGGIOYSA-N 0.000 description 6
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 6
- SHZGCJCMOBCMKK-DHVFOXMCSA-N L-fucopyranose Chemical compound C[C@@H]1OC(O)[C@@H](O)[C@H](O)[C@@H]1O SHZGCJCMOBCMKK-DHVFOXMCSA-N 0.000 description 6
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 6
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 6
- 239000004472 Lysine Substances 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 6
- 239000004473 Threonine Substances 0.000 description 6
- 239000013543 active substance Substances 0.000 description 6
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 6
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 6
- 238000012258 culturing Methods 0.000 description 6
- 239000013604 expression vector Substances 0.000 description 6
- 230000013595 glycosylation Effects 0.000 description 6
- 238000006206 glycosylation reaction Methods 0.000 description 6
- 229920001542 oligosaccharide Polymers 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 210000001519 tissue Anatomy 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 5
- 108010088160 Staphylococcal Protein A Proteins 0.000 description 5
- 230000002776 aggregation Effects 0.000 description 5
- 238000004220 aggregation Methods 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 239000000562 conjugate Substances 0.000 description 5
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 5
- 229940127089 cytotoxic agent Drugs 0.000 description 5
- 238000010494 dissociation reaction Methods 0.000 description 5
- 230000005593 dissociations Effects 0.000 description 5
- 238000010828 elution Methods 0.000 description 5
- 235000013922 glutamic acid Nutrition 0.000 description 5
- 239000004220 glutamic acid Substances 0.000 description 5
- 230000007935 neutral effect Effects 0.000 description 5
- 238000002823 phage display Methods 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 230000009885 systemic effect Effects 0.000 description 5
- 102100033402 Angiopoietin-4 Human genes 0.000 description 4
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical compound NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 4
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 4
- 241000124008 Mammalia Species 0.000 description 4
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 4
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 4
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 108010069801 angiopoietin 4 Proteins 0.000 description 4
- 229940049595 antibody-drug conjugate Drugs 0.000 description 4
- 235000003704 aspartic acid Nutrition 0.000 description 4
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 4
- 229960000397 bevacizumab Drugs 0.000 description 4
- 230000017531 blood circulation Effects 0.000 description 4
- 150000001720 carbohydrates Chemical group 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 239000002254 cytotoxic agent Substances 0.000 description 4
- 230000007423 decrease Effects 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 239000006185 dispersion Substances 0.000 description 4
- 102000047825 human ANGPT2 Human genes 0.000 description 4
- 210000003292 kidney cell Anatomy 0.000 description 4
- 229930182817 methionine Natural products 0.000 description 4
- 239000003094 microcapsule Substances 0.000 description 4
- 238000003752 polymerase chain reaction Methods 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 210000001525 retina Anatomy 0.000 description 4
- 238000012552 review Methods 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000010561 standard procedure Methods 0.000 description 4
- 235000000346 sugar Nutrition 0.000 description 4
- 108700012359 toxins Proteins 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 108010048154 Angiopoietin-1 Proteins 0.000 description 3
- 102100034594 Angiopoietin-1 Human genes 0.000 description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 3
- 241000894006 Bacteria Species 0.000 description 3
- WVDDGKGOMKODPV-UHFFFAOYSA-N Benzyl alcohol Chemical compound OCC1=CC=CC=C1 WVDDGKGOMKODPV-UHFFFAOYSA-N 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 241000287828 Gallus gallus Species 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102000003886 Glycoproteins Human genes 0.000 description 3
- 108090000288 Glycoproteins Proteins 0.000 description 3
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 3
- 102000009490 IgG Receptors Human genes 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 3
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 3
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 241000700159 Rattus Species 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 229920002684 Sepharose Polymers 0.000 description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 3
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 230000009824 affinity maturation Effects 0.000 description 3
- 239000000611 antibody drug conjugate Substances 0.000 description 3
- 210000001742 aqueous humor Anatomy 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 230000004888 barrier function Effects 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000004590 computer program Methods 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 231100000599 cytotoxic agent Toxicity 0.000 description 3
- 238000002784 cytotoxicity assay Methods 0.000 description 3
- 231100000263 cytotoxicity test Toxicity 0.000 description 3
- 238000009792 diffusion process Methods 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 230000033581 fucosylation Effects 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 208000002780 macular degeneration Diseases 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 238000005259 measurement Methods 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 3
- 239000002953 phosphate buffered saline Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000002265 prevention Effects 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 238000000159 protein binding assay Methods 0.000 description 3
- 239000011347 resin Substances 0.000 description 3
- 229920005989 resin Polymers 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 238000002741 site-directed mutagenesis Methods 0.000 description 3
- 238000001542 size-exclusion chromatography Methods 0.000 description 3
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 3
- 150000008163 sugars Chemical class 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 239000003053 toxin Substances 0.000 description 3
- 231100000765 toxin Toxicity 0.000 description 3
- 238000012384 transportation and delivery Methods 0.000 description 3
- 239000004474 valine Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- VPFUWHKTPYPNGT-UHFFFAOYSA-N 3-(3,4-dihydroxyphenyl)-1-(5-hydroxy-2,2-dimethylchromen-6-yl)propan-1-one Chemical compound OC1=C2C=CC(C)(C)OC2=CC=C1C(=O)CCC1=CC=C(O)C(O)=C1 VPFUWHKTPYPNGT-UHFFFAOYSA-N 0.000 description 2
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 2
- 102000009840 Angiopoietins Human genes 0.000 description 2
- 108010009906 Angiopoietins Proteins 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- 241000699802 Cricetulus griseus Species 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 2
- 101100481408 Danio rerio tie2 gene Proteins 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108700025474 F 372 Proteins 0.000 description 2
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 2
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 108010010803 Gelatin Proteins 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 108010073807 IgG Receptors Proteins 0.000 description 2
- 108010058683 Immobilized Proteins Proteins 0.000 description 2
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 2
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 102000043129 MHC class I family Human genes 0.000 description 2
- 108091054437 MHC class I family Proteins 0.000 description 2
- 229920000057 Mannan Polymers 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 101100481410 Mus musculus Tek gene Proteins 0.000 description 2
- CHJJGSNFBQVOTG-UHFFFAOYSA-N N-methyl-guanidine Natural products CNC(N)=N CHJJGSNFBQVOTG-UHFFFAOYSA-N 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 206010029113 Neovascularisation Diseases 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 102000004316 Oxidoreductases Human genes 0.000 description 2
- 108090000854 Oxidoreductases Proteins 0.000 description 2
- 206010057249 Phagocytosis Diseases 0.000 description 2
- 239000001825 Polyoxyethene (8) stearate Substances 0.000 description 2
- 239000004372 Polyvinyl alcohol Substances 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- NBBJYMSMWIIQGU-UHFFFAOYSA-N Propionic aldehyde Chemical compound CCC=O NBBJYMSMWIIQGU-UHFFFAOYSA-N 0.000 description 2
- 108010029485 Protein Isoforms Proteins 0.000 description 2
- 102000001708 Protein Isoforms Human genes 0.000 description 2
- 108010039491 Ricin Proteins 0.000 description 2
- 241000283984 Rodentia Species 0.000 description 2
- 239000004268 Sodium erythorbin Substances 0.000 description 2
- 239000003490 Thiodipropionic acid Substances 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 238000012867 alanine scanning Methods 0.000 description 2
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 2
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 108010044540 auristatin Proteins 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 239000008228 bacteriostatic water for injection Substances 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 239000012472 biological sample Substances 0.000 description 2
- 230000004378 blood-retinal barrier Effects 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- AIYUHDOJVYHVIT-UHFFFAOYSA-M caesium chloride Chemical compound [Cl-].[Cs+] AIYUHDOJVYHVIT-UHFFFAOYSA-M 0.000 description 2
- 238000005251 capillar electrophoresis Methods 0.000 description 2
- YCIMNLLNPGFGHC-UHFFFAOYSA-N catechol Chemical compound OC1=CC=CC=C1O YCIMNLLNPGFGHC-UHFFFAOYSA-N 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 230000002759 chromosomal effect Effects 0.000 description 2
- 238000004440 column chromatography Methods 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 210000004087 cornea Anatomy 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 239000003405 delayed action preparation Substances 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- SWSQBOPZIKWTGO-UHFFFAOYSA-N dimethylaminoamidine Natural products CN(C)C(N)=N SWSQBOPZIKWTGO-UHFFFAOYSA-N 0.000 description 2
- 230000003292 diminished effect Effects 0.000 description 2
- 238000002330 electrospray ionisation mass spectrometry Methods 0.000 description 2
- 210000001163 endosome Anatomy 0.000 description 2
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 239000008273 gelatin Substances 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- 235000011852 gelatine desserts Nutrition 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 230000016784 immunoglobulin production Effects 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 230000006872 improvement Effects 0.000 description 2
- 238000000099 in vitro assay Methods 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- 238000001155 isoelectric focusing Methods 0.000 description 2
- 238000002955 isolation Methods 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 239000007951 isotonicity adjuster Substances 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 210000005229 liver cell Anatomy 0.000 description 2
- 125000003588 lysine group Chemical class [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 230000006655 lysosomal degradation pathway Effects 0.000 description 2
- 239000004337 magnesium citrate Substances 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 210000004962 mammalian cell Anatomy 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 238000002703 mutagenesis Methods 0.000 description 2
- 231100000350 mutagenesis Toxicity 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- AQIXEPGDORPWBJ-UHFFFAOYSA-N pentan-3-ol Chemical compound CCC(O)CC AQIXEPGDORPWBJ-UHFFFAOYSA-N 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 230000008782 phagocytosis Effects 0.000 description 2
- 229920002451 polyvinyl alcohol Polymers 0.000 description 2
- 239000004331 potassium propionate Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 210000001236 prokaryotic cell Anatomy 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- GHMLBKRAJCXXBS-UHFFFAOYSA-N resorcinol Chemical compound OC1=CC=CC(O)=C1 GHMLBKRAJCXXBS-UHFFFAOYSA-N 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 208000004644 retinal vein occlusion Diseases 0.000 description 2
- 230000000392 somatic effect Effects 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 230000001839 systemic circulation Effects 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- 239000001393 triammonium citrate Substances 0.000 description 2
- 208000019553 vascular disease Diseases 0.000 description 2
- 210000003556 vascular endothelial cell Anatomy 0.000 description 2
- 229920003169 water-soluble polymer Polymers 0.000 description 2
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 1
- JKHVDAUOODACDU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCN1C(=O)C=CC1=O JKHVDAUOODACDU-UHFFFAOYSA-N 0.000 description 1
- PVGATNRYUYNBHO-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-(2,5-dioxopyrrol-1-yl)butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCN1C(=O)C=CC1=O PVGATNRYUYNBHO-UHFFFAOYSA-N 0.000 description 1
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 description 1
- PMJWDPGOWBRILU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(C=C1)=CC=C1N1C(=O)C=CC1=O PMJWDPGOWBRILU-UHFFFAOYSA-N 0.000 description 1
- VLARLSIGSPVYHX-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-(2,5-dioxopyrrol-1-yl)hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O VLARLSIGSPVYHX-UHFFFAOYSA-N 0.000 description 1
- WCMOHMXWOOBVMZ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(2,5-dioxopyrrol-1-yl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCN1C(=O)C=CC1=O WCMOHMXWOOBVMZ-UHFFFAOYSA-N 0.000 description 1
- IHVODYOQUSEYJJ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]amino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)C(CC1)CCC1CN1C(=O)C=CC1=O IHVODYOQUSEYJJ-UHFFFAOYSA-N 0.000 description 1
- MFRNYXJJRJQHNW-DEMKXPNLSA-N (2s)-2-[[(2r,3r)-3-methoxy-3-[(2s)-1-[(3r,4s,5s)-3-methoxy-5-methyl-4-[methyl-[(2s)-3-methyl-2-[[(2s)-3-methyl-2-(methylamino)butanoyl]amino]butanoyl]amino]heptanoyl]pyrrolidin-2-yl]-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MFRNYXJJRJQHNW-DEMKXPNLSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- DIYPCWKHSODVAP-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=CC(N2C(C=CC2=O)=O)=C1 DIYPCWKHSODVAP-UHFFFAOYSA-N 0.000 description 1
- CULQNACJHGHAER-UHFFFAOYSA-N 1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 CULQNACJHGHAER-UHFFFAOYSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- PNDPGZBMCMUPRI-HVTJNCQCSA-N 10043-66-0 Chemical compound [131I][131I] PNDPGZBMCMUPRI-HVTJNCQCSA-N 0.000 description 1
- YBBNVCVOACOHIG-UHFFFAOYSA-N 2,2-diamino-1,4-bis(4-azidophenyl)-3-butylbutane-1,4-dione Chemical compound C=1C=C(N=[N+]=[N-])C=CC=1C(=O)C(N)(N)C(CCCC)C(=O)C1=CC=C(N=[N+]=[N-])C=C1 YBBNVCVOACOHIG-UHFFFAOYSA-N 0.000 description 1
- KGLPWQKSKUVKMJ-UHFFFAOYSA-N 2,3-dihydrophthalazine-1,4-dione Chemical class C1=CC=C2C(=O)NNC(=O)C2=C1 KGLPWQKSKUVKMJ-UHFFFAOYSA-N 0.000 description 1
- FZDFGHZZPBUTGP-UHFFFAOYSA-N 2-[[2-[bis(carboxymethyl)amino]-3-(4-isothiocyanatophenyl)propyl]-[2-[bis(carboxymethyl)amino]propyl]amino]acetic acid Chemical compound OC(=O)CN(CC(O)=O)C(C)CN(CC(O)=O)CC(N(CC(O)=O)CC(O)=O)CC1=CC=C(N=C=S)C=C1 FZDFGHZZPBUTGP-UHFFFAOYSA-N 0.000 description 1
- FBUTXZSKZCQABC-UHFFFAOYSA-N 2-amino-1-methyl-7h-purine-6-thione Chemical compound S=C1N(C)C(N)=NC2=C1NC=N2 FBUTXZSKZCQABC-UHFFFAOYSA-N 0.000 description 1
- 125000000022 2-aminoethyl group Chemical group [H]C([*])([H])C([H])([H])N([H])[H] 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- XKTYXVDYIKIYJP-UHFFFAOYSA-N 3h-dioxole Chemical compound C1OOC=C1 XKTYXVDYIKIYJP-UHFFFAOYSA-N 0.000 description 1
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 1
- FJKROLUGYXJWQN-UHFFFAOYSA-N 4-hydroxybenzoic acid Chemical compound OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 1
- 102100031126 6-phosphogluconolactonase Human genes 0.000 description 1
- 108010029731 6-phosphogluconolactonase Proteins 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- CJIJXIFQYOPWTF-UHFFFAOYSA-N 7-hydroxycoumarin Natural products O1C(=O)C=CC2=CC(O)=CC=C21 CJIJXIFQYOPWTF-UHFFFAOYSA-N 0.000 description 1
- 108010066676 Abrin Proteins 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102100027211 Albumin Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100021266 Alpha-(1,6)-fucosyltransferase Human genes 0.000 description 1
- QGZKDVFQNNGYKY-OUBTZVSYSA-N Ammonia-15N Chemical compound [15NH3] QGZKDVFQNNGYKY-OUBTZVSYSA-N 0.000 description 1
- 101000669426 Aspergillus restrictus Ribonuclease mitogillin Proteins 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 230000003844 B-cell-activation Effects 0.000 description 1
- 108090000363 Bacterial Luciferases Proteins 0.000 description 1
- 108700004676 Bence Jones Proteins 0.000 description 1
- 102100027314 Beta-2-microglobulin Human genes 0.000 description 1
- 102100026189 Beta-galactosidase Human genes 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 238000011746 C57BL/6J (JAX™ mouse strain) Methods 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 101710158575 Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase Proteins 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-OUBTZVSYSA-N Carbon-13 Chemical compound [13C] OKTJSMMVPCPJKN-OUBTZVSYSA-N 0.000 description 1
- OKTJSMMVPCPJKN-NJFSPNSNSA-N Carbon-14 Chemical compound [14C] OKTJSMMVPCPJKN-NJFSPNSNSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 102000011413 Chondroitinases and Chondroitin Lyases Human genes 0.000 description 1
- 108010023736 Chondroitinases and Chondroitin Lyases Proteins 0.000 description 1
- 208000005590 Choroidal Neovascularization Diseases 0.000 description 1
- 206010060823 Choroidal neovascularisation Diseases 0.000 description 1
- VYZAMTAEIAYCRO-UHFFFAOYSA-N Chromium Chemical compound [Cr] VYZAMTAEIAYCRO-UHFFFAOYSA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 206010055665 Corneal neovascularisation Diseases 0.000 description 1
- 239000004971 Cross linker Substances 0.000 description 1
- 108700032819 Croton tiglium crotin II Proteins 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- 206010012688 Diabetic retinal oedema Diseases 0.000 description 1
- 206010012689 Diabetic retinopathy Diseases 0.000 description 1
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 101710082714 Exotoxin A Proteins 0.000 description 1
- 206010073306 Exposure to radiation Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 108090000331 Firefly luciferases Proteins 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical compound FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- 229910052688 Gadolinium Inorganic materials 0.000 description 1
- 108010015133 Galactose oxidase Proteins 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 208000010412 Glaucoma Diseases 0.000 description 1
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 description 1
- 102100022624 Glucoamylase Human genes 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 108010018962 Glucosephosphate Dehydrogenase Proteins 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 241001272567 Hominoidea Species 0.000 description 1
- 101000819490 Homo sapiens Alpha-(1,6)-fucosyltransferase Proteins 0.000 description 1
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 1
- 101001041117 Homo sapiens Hyaluronidase PH-20 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101000611183 Homo sapiens Tumor necrosis factor Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 108010003272 Hyaluronate lyase Proteins 0.000 description 1
- 102000001974 Hyaluronidases Human genes 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical class C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 108700005091 Immunoglobulin Genes Proteins 0.000 description 1
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 1
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 1
- 238000012695 Interfacial polymerization Methods 0.000 description 1
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 1
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 1
- ZCYVEMRRCGMTRW-AHCXROLUSA-N Iodine-123 Chemical compound [123I] ZCYVEMRRCGMTRW-AHCXROLUSA-N 0.000 description 1
- 206010065630 Iris neovascularisation Diseases 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- 102100038609 Lactoperoxidase Human genes 0.000 description 1
- 108010023244 Lactoperoxidase Proteins 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 description 1
- 101710099301 Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 239000004907 Macro-emulsion Substances 0.000 description 1
- PWHULOQIROXLJO-UHFFFAOYSA-N Manganese Chemical compound [Mn] PWHULOQIROXLJO-UHFFFAOYSA-N 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 244000302512 Momordica charantia Species 0.000 description 1
- 235000009811 Momordica charantia Nutrition 0.000 description 1
- 102000016943 Muramidase Human genes 0.000 description 1
- 108010014251 Muramidase Proteins 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- WTBIAPVQQBCLFP-UHFFFAOYSA-N N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O Chemical compound N.N.N.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O.CC(O)=O WTBIAPVQQBCLFP-UHFFFAOYSA-N 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 241000238413 Octopus Species 0.000 description 1
- 208000022873 Ocular disease Diseases 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000000447 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Human genes 0.000 description 1
- 108010055817 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Proteins 0.000 description 1
- 101100413173 Phytolacca americana PAP2 gene Proteins 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 1
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 1
- 241000700157 Rattus norvegicus Species 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 208000007135 Retinal Neovascularization Diseases 0.000 description 1
- 201000007737 Retinal degeneration Diseases 0.000 description 1
- 208000017442 Retinal disease Diseases 0.000 description 1
- 208000007014 Retinitis pigmentosa Diseases 0.000 description 1
- 206010038923 Retinopathy Diseases 0.000 description 1
- 206010038933 Retinopathy of prematurity Diseases 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 201000004283 Shwachman-Diamond syndrome Diseases 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 241000256251 Spodoptera frugiperda Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 108010092464 Urate Oxidase Proteins 0.000 description 1
- 101150117115 V gene Proteins 0.000 description 1
- 108091008605 VEGF receptors Proteins 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 240000001866 Vernicia fordii Species 0.000 description 1
- 108010093894 Xanthine oxidase Proteins 0.000 description 1
- 102100033220 Xanthine oxidase Human genes 0.000 description 1
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- 239000011149 active material Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000005377 adsorption chromatography Methods 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 206010064930 age-related macular degeneration Diseases 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 1
- 108010001818 alpha-sarcin Proteins 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 210000002159 anterior chamber Anatomy 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 238000010913 antigen-directed enzyme pro-drug therapy Methods 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 239000012062 aqueous buffer Substances 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- 229960001950 benzethonium chloride Drugs 0.000 description 1
- UREZNYTWGJKWBI-UHFFFAOYSA-M benzethonium chloride Chemical compound [Cl-].C1=CC(C(C)(C)CC(C)(C)C)=CC=C1OCCOCC[N+](C)(C)CC1=CC=CC=C1 UREZNYTWGJKWBI-UHFFFAOYSA-M 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- 235000019445 benzyl alcohol Nutrition 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 238000013357 binding ELISA Methods 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- HUTDDBSSHVOYJR-UHFFFAOYSA-H bis[(2-oxo-1,3,2$l^{5},4$l^{2}-dioxaphosphaplumbetan-2-yl)oxy]lead Chemical compound [Pb+2].[Pb+2].[Pb+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O HUTDDBSSHVOYJR-UHFFFAOYSA-H 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- LRHPLDYGYMQRHN-UHFFFAOYSA-N butyl alcohol Substances CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 1
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- ZTQSAGDEMFDKMZ-UHFFFAOYSA-N butyric aldehyde Natural products CCCC=O ZTQSAGDEMFDKMZ-UHFFFAOYSA-N 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 201000005667 central retinal vein occlusion Diseases 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 239000013522 chelant Substances 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 229940044683 chemotherapy drug Drugs 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 210000003161 choroid Anatomy 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 210000004240 ciliary body Anatomy 0.000 description 1
- 230000004186 co-expression Effects 0.000 description 1
- 238000005354 coacervation Methods 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000024203 complement activation Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 210000000795 conjunctiva Anatomy 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 201000000159 corneal neovascularization Diseases 0.000 description 1
- 239000007822 coupling agent Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 210000000695 crystalline len Anatomy 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- HPXRVTGHNJAIIH-UHFFFAOYSA-N cyclohexanol Chemical compound OC1CCCCC1 HPXRVTGHNJAIIH-UHFFFAOYSA-N 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 125000001295 dansyl group Chemical group [H]C1=C([H])C(N(C([H])([H])[H])C([H])([H])[H])=C2C([H])=C([H])C([H])=C(C2=C1[H])S(*)(=O)=O 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 201000011190 diabetic macular edema Diseases 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 229930191339 dianthin Natural products 0.000 description 1
- 108020001096 dihydrofolate reductase Proteins 0.000 description 1
- UGMCXQCYOVCMTB-UHFFFAOYSA-K dihydroxy(stearato)aluminium Chemical compound CCCCCCCCCCCCCCCCCC(=O)O[Al](O)O UGMCXQCYOVCMTB-UHFFFAOYSA-K 0.000 description 1
- 125000005442 diisocyanate group Chemical group 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- ZLFRJHOBQVVTOJ-UHFFFAOYSA-N dimethyl hexanediimidate Chemical compound COC(=N)CCCCC(=N)OC ZLFRJHOBQVVTOJ-UHFFFAOYSA-N 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000008393 encapsulating agent Substances 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 210000003989 endothelium vascular Anatomy 0.000 description 1
- 108010028531 enomycin Proteins 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 208000030533 eye disease Diseases 0.000 description 1
- 239000003889 eye drop Substances 0.000 description 1
- 229940012356 eye drops Drugs 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 150000002222 fluorine compounds Chemical class 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- UIWYJDYFSGRHKR-UHFFFAOYSA-N gadolinium atom Chemical compound [Gd] UIWYJDYFSGRHKR-UHFFFAOYSA-N 0.000 description 1
- 229930182830 galactose Natural products 0.000 description 1
- 108010074605 gamma-Globulins Proteins 0.000 description 1
- 238000007429 general method Methods 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 125000000623 heterocyclic group Chemical group 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 102000050995 human FLT1 Human genes 0.000 description 1
- 102000057041 human TNF Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 229960002773 hyaluronidase Drugs 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 229940031574 hydroxymethyl cellulose Drugs 0.000 description 1
- 229920003063 hydroxymethyl cellulose Polymers 0.000 description 1
- 229940044700 hylenex Drugs 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 230000002637 immunotoxin Effects 0.000 description 1
- 229940051026 immunotoxin Drugs 0.000 description 1
- 239000002596 immunotoxin Substances 0.000 description 1
- 231100000608 immunotoxin Toxicity 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 102000014909 interleukin-1 receptor activity proteins Human genes 0.000 description 1
- 108040006732 interleukin-1 receptor activity proteins Proteins 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 230000010039 intracellular degradation Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 210000000554 iris Anatomy 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 229940057428 lactoperoxidase Drugs 0.000 description 1
- 229950005692 larotaxel Drugs 0.000 description 1
- SEFGUGYLLVNFIJ-QDRLFVHASA-N larotaxel dihydrate Chemical compound O.O.O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@@]23[C@H]1[C@@]1(CO[C@@H]1C[C@@H]2C3)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 SEFGUGYLLVNFIJ-QDRLFVHASA-N 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 239000012669 liquid formulation Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 210000005265 lung cell Anatomy 0.000 description 1
- 210000001365 lymphatic vessel Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000004325 lysozyme Substances 0.000 description 1
- 235000010335 lysozyme Nutrition 0.000 description 1
- 229960000274 lysozyme Drugs 0.000 description 1
- JMZFEHDNIAQMNB-UHFFFAOYSA-N m-aminophenylboronic acid Chemical compound NC1=CC=CC(B(O)O)=C1 JMZFEHDNIAQMNB-UHFFFAOYSA-N 0.000 description 1
- RLSSMJSEOOYNOY-UHFFFAOYSA-N m-cresol Chemical compound CC1=CC=CC(O)=C1 RLSSMJSEOOYNOY-UHFFFAOYSA-N 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 229910052748 manganese Inorganic materials 0.000 description 1
- 239000011572 manganese Substances 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 230000008774 maternal effect Effects 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000008384 membrane barrier Effects 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 239000004530 micro-emulsion Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 108010029942 microperoxidase Proteins 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 108010010621 modeccin Proteins 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 230000004001 molecular interaction Effects 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- 239000002088 nanocapsule Substances 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 210000000822 natural killer cell Anatomy 0.000 description 1
- 201000003142 neovascular glaucoma Diseases 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 210000001328 optic nerve Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- BWKDAMBGCPRVPI-ZQRPHVBESA-N ortataxel Chemical compound O([C@@H]1[C@]23OC(=O)O[C@H]2[C@@H](C(=C([C@@H](OC(C)=O)C(=O)[C@]2(C)[C@@H](O)C[C@H]4OC[C@]4([C@H]21)OC(C)=O)C3(C)C)C)OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)CC(C)C)C(=O)C1=CC=CC=C1 BWKDAMBGCPRVPI-ZQRPHVBESA-N 0.000 description 1
- 229950001094 ortataxel Drugs 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000035515 penetration Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 229960003742 phenol Drugs 0.000 description 1
- 108010076042 phenomycin Proteins 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920000191 poly(N-vinyl pyrrolidone) Polymers 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920001583 poly(oxyethylated polyols) Polymers 0.000 description 1
- 108010054442 polyalanine Proteins 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000001608 potassium adipate Substances 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000001902 propagating effect Effects 0.000 description 1
- 230000000069 prophylactic effect Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 231100000654 protein toxin Toxicity 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 238000010791 quenching Methods 0.000 description 1
- 230000000171 quenching effect Effects 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 150000003254 radicals Chemical class 0.000 description 1
- 238000007420 radioactive assay Methods 0.000 description 1
- 229920005604 random copolymer Polymers 0.000 description 1
- 229910052761 rare earth metal Inorganic materials 0.000 description 1
- 150000002910 rare earth metals Chemical class 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 238000004064 recycling Methods 0.000 description 1
- 230000004258 retinal degeneration Effects 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 239000000790 retinal pigment Substances 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 210000000717 sertoli cell Anatomy 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- 239000001601 sodium adipate Substances 0.000 description 1
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 1
- 239000012064 sodium phosphate buffer Substances 0.000 description 1
- MKNJJMHQBYVHRS-UHFFFAOYSA-M sodium;1-[11-(2,5-dioxopyrrol-1-yl)undecanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCCCCCCN1C(=O)C=CC1=O MKNJJMHQBYVHRS-UHFFFAOYSA-M 0.000 description 1
- ULARYIUTHAWJMU-UHFFFAOYSA-M sodium;1-[4-(2,5-dioxopyrrol-1-yl)butanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCN1C(=O)C=CC1=O ULARYIUTHAWJMU-UHFFFAOYSA-M 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- MIDXXTLMKGZDPV-UHFFFAOYSA-M sodium;1-[6-(2,5-dioxopyrrol-1-yl)hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O MIDXXTLMKGZDPV-UHFFFAOYSA-M 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 238000001179 sorption measurement Methods 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- SFVFIFLLYFPGHH-UHFFFAOYSA-M stearalkonium chloride Chemical compound [Cl-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CC1=CC=CC=C1 SFVFIFLLYFPGHH-UHFFFAOYSA-M 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000011146 sterile filtration Methods 0.000 description 1
- 238000012414 sterilization procedure Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 150000005846 sugar alcohols Polymers 0.000 description 1
- 239000006228 supernatant Substances 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- MODVSQKJJIBWPZ-VLLPJHQWSA-N tesetaxel Chemical compound O([C@H]1[C@@H]2[C@]3(OC(C)=O)CO[C@@H]3CC[C@@]2(C)[C@H]2[C@@H](C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C(=CC=CN=4)F)C[C@]1(O)C3(C)C)O[C@H](O2)CN(C)C)C(=O)C1=CC=CC=C1 MODVSQKJJIBWPZ-VLLPJHQWSA-N 0.000 description 1
- 229950009016 tesetaxel Drugs 0.000 description 1
- 230000004797 therapeutic response Effects 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- RUELTTOHQODFPA-UHFFFAOYSA-N toluene 2,6-diisocyanate Chemical compound CC1=C(N=C=O)C=CC=C1N=C=O RUELTTOHQODFPA-UHFFFAOYSA-N 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000011830 transgenic mouse model Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- LZAJKCZTKKKZNT-PMNGPLLRSA-N trichothecene Chemical compound C12([C@@]3(CC[C@H]2OC2C=C(CCC23C)C)C)CO1 LZAJKCZTKKKZNT-PMNGPLLRSA-N 0.000 description 1
- 229930013292 trichothecene Natural products 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- ORHBXUUXSCNDEV-UHFFFAOYSA-N umbelliferone Chemical compound C1=CC(=O)OC2=CC(O)=CC=C21 ORHBXUUXSCNDEV-UHFFFAOYSA-N 0.000 description 1
- HFTAFOQKODTIJY-UHFFFAOYSA-N umbelliferone Natural products Cc1cc2C=CC(=O)Oc2cc1OCC=CC(C)(C)O HFTAFOQKODTIJY-UHFFFAOYSA-N 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- 239000011800 void material Substances 0.000 description 1
- XLYOFNOQVPJJNP-OUBTZVSYSA-N water-17o Chemical compound [17OH2] XLYOFNOQVPJJNP-OUBTZVSYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to antibodies and Fc-region fusion polypeptides which are asymmetrically modified with respect to their Fc-receptor, especially their FcRn, interaction and methods of using the same.
- Fc-receptors bind to the symmetrical Fc-region of antibodies asymmetrically.
- the human Fcy-receptor IIIA interacts with different amino acids residues on the two Fc-region polypeptide chains.
- asymmetrically introduced mutations e.g. in the lower hinge region at residues 233 to 238 have to be used to either increase or decrease the interaction of the antibody with the human Fey receptor IIIA.
- the interaction between the human neonatal Fc-receptor FcRn is symmetrical: two FcRn molecules can bind to a single IgG with a 2: 1 stoichiometry (see. e.g. Huber, A.W., et al, J. Mol. Biol. 230 (1993) 1077-1083).
- asymmetrically introduced mutations reduce the binding to/by one FcRn but not to/by both.
- asymmetric IgG-like molecules include but are not limited to those obtained with the following technologies or using the following formats: Triomab/Quadroma, Knobs-into-Holes, CrossMabs, electrostatically-matched antibodies, LUZ-Y, Strand Exchange Engineered Domain body, Biclonic and DuoBody.
- heterodimer Fc-region comprises a variant CH3 domain comprising amino acid mutations to promote heterodimer formation with increased stability, wherein the heterodimer Fc-region further comprises a variant CH2 domain comprising asymmetric amino acid modifications to promote selective binding of an Fcgamma receptor are reported.
- Kim et al. (Kim, H., et al, Invest. Ophthalmol. Vis. Sci. 49 (2008) 2025-2029) report that, except for the retinal pigment epithelial and choroid tissue, ocular tissues, including the ciliary body and iris, retina, conjunctiva, cornea, lens, and optic nerve bundle, showed the presence of FcRn transcript at the predicted size.
- the blood-ocular barrier showed FcRn receptor expression, indicating that IgG transport from ocular tissues to the blood system may use this receptor. Since the inner ocular tissues such as the retina are separated from the blood system by the blood-ocular barrier, one would not expect to detect a full-length antibody in the blood system only a short time after intravitreous injection. However, recent pharmacokinetic data from monkey and humans all indicate that intravitreous bevacizumab appears in the blood within hours after intravitreous injection. Therefore, it may be that the function of the FcRn receptor in the conjunctival lymphatic vessels is to act as an efflux receptor for the efficient elimination of antigen-antibody IgG complexes from the conjunctival space.
- IgG 150 kDa
- IgA 160 kDa
- the discrepancy between IgG and IgA penetration from the serum into the aqueous humor may be explained by the presence of the FcRn receptors, which are selective for IgGs.
- Kim et al. further report (Kim, H., et al, Mol. Vis. 15 (2009) 2803-2812) that direct intra vitreal injection has become a common approach for delivering therapeutic antibodies to the posterior segment of the eye for retina disorders.
- the blood-ocular barrier manifests a specific mechanism for transporting and clearing full-length IgGs into the systemic circulation.
- Kim's current study confirms the hypothesis that this mechanism is the neonatal Fc-receptor.
- US 201 1/054151 compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens is reported.
- Firan, M., et al. report that the MHC class I-related receptor, FcRn, plays an essential role in the maternofetal transfer of gamma-globulin in humans (Int. Immunol. 13 (2001) 993-1002).
- Vidarsson, G., et al. report that FcRn is an IgG receptor on phagocytes with a novel role in phagocytosis (Blood 108 (2006) 3573-3579).
- FcRn-binding of an antibody or Fc-region fusion polypeptide can be modified by altering amino acid residues at non-corresponding positions in the individual Fc-region polypeptides as these alterations act together in the modification of the FcRn-binding.
- Antibodies and Fc-region fusion polypeptides as reported herein are useful, e.g., for the treatment of diseases in which tailor-made systemic retention times are required.
- variant (human) IgG class Fc-region comprising a first Fc-region polypeptide and a second Fc-region polypeptide, wherein a) the first Fc-region polypeptide and the second Fc-region polypeptide are derived from the same parent (human) IgG class Fc-region polypeptide, and b) the first Fc-region polypeptide has an amino acid sequence that differs from the second Fc-region polypeptide amino acid sequence at least at one corresponding position according to the Kabat EU index numbering system, whereby the variant (human) IgG class Fc-region has a different affinity to a human Fc-receptor compared to a (human) IgG class Fc-region that has the same amino acid residues (as the (parent) human Fc-region polypeptide of a)) at corresponding positions according to the Kabat EU index numbering system in the first Fc-region polypeptide and the second Fc-region polypeptide.
- variant (human) IgG class Fc-region comprising a first Fc-region polypeptide and a second Fc-region polypeptide, wherein a) the first Fc-region polypeptide has an amino acid sequence that differs from the second Fc-region polypeptide amino acid sequence at least at one corresponding position according to the Kabat EU index numbering system, whereby the variant (human) IgG class Fc-region has a different affinity to a human Fc-receptor compared to an IgG class Fc-region that has the same amino acid residue (as in a corresponding human Fc-region) in the first and the second Fc-region polypeptide at the corresponding position.
- variant (human) IgG class Fc-region comprising a first Fc-region polypeptide and a second Fc-region polypeptide, wherein a) the amino acid sequence of the first Fc-region polypeptide differs from the amino acid sequence of a first parent IgG class Fc-region polypeptide in one or more amino acid residues, and the amino acid sequence of the second Fc-region polypeptide differs from the amino acid sequence of a second parent IgG class Fc-region polypeptide in one or more amino acid residues, and b) the first Fc-region polypeptide has an amino acid sequence that differs from the second Fc-region polypeptide amino acid sequence at least at one corresponding position according to the Kabat EU index numbering system, whereby the variant (human) IgG class Fc-region has a different affinity to a human Fc-receptor compared to a parent IgG class Fc-region comprising the first and the second parent IgG class Fc-region
- variant (human) IgG class Fc-region comprising a first Fc-region polypeptide and a second Fc-region polypeptide
- a) the amino acid sequence of the first Fc-region polypeptide is derived from a first parent IgG class Fc-region polypeptide and the amino acid sequence of the second Fc-region polypeptide is derived from a second parent IgG class Fc-region polypeptide
- b) in the first Fc-region polypeptide and/or in the second Fc-region polypeptide one or more mutations are introduced so that the first Fc- region polypeptide has an amino acid sequence that differs from the second Fc-region polypeptide amino acid sequence at least at one corresponding position according to the Kabat EU index numbering system, whereby the variant (human) IgG class Fc-region has a different affinity to a human Fc-receptor compared to an IgG class Fc-region comprising the first and the second parent IgG
- the variant (human) IgG class Fc-region is a variant (human) IgG class heterodimeric Fc-region.
- the first parent IgG class Fc-region polypeptide and the second parent IgG class Fc-region polypeptide are non-human IgG class Fc-region polypeptides.
- first parent IgG class Fc-region polypeptide and the second parent IgG class Fc-region polypeptide are the same IgG class Fc- region polypeptide.
- the pairing of the first Fc-region polypeptide and the second Fc-region polypeptide to form a dimeric (functional) Fc-region results in the formation of a heterodimer.
- the first and the second Fc-region polypeptide differ independently of each other in at least one amino acid residue from the respective parent IgG class Fc-region polypeptide.
- the IgG class is selected from the subclasses IgGl, IgG2, IgG3 and IgG4.
- the human Fc-receptor is selected from the human neonatal Fc-receptor and the human Fey receptor.
- the first Fc-region polypeptide differs in 1 or 2 or 3 or 4 or 5 or 6 or 7 or 8 or 9 or 10 or 11 or 12 amino acid residues at corresponding position according to the Kabat EU index numbering system from the second Fc-region polypeptide.
- the variant (human) IgG class Fc-region has reduced binding to Staphylococcus protein A as the corresponding parent human IgG class Fc-region.
- the variant (human) IgG class Fc-region has the same binding to Staphylococcus protein A as the corresponding parent human IgG class Fc- region.
- the variant (human) IgG class Fc-region comprises a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (derived from human origin) which comprise one or two of the mutations selected from i) the group 1253 A, H310A and H435A, or ii) the group H310A, H433A and Y436A, or iii) the group L25 ID, L314D and L432D, or iv) the group L251S, L314S and L432S (numbering according to Kabat EU index numbering system) in the first Fc-region polypeptide and one or two of the mutations selected from the group comprising the mutations L251D, L251S, I253A, H310A, L3
- the variant (human) IgG class Fc-region comprises a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (derived from human origin), which comprise the mutations I253A/H310A/H435A or H310A/H433A/Y436A or L251D/L314D/L432D or L251S/L314S/L432S or combinations thereof in the Fc-region (numbering according to Kabat EU index numbering system), whereby i) all mutations are in the first or the second Fc-region polypeptide, or ii) one or two mutations are in the first Fc-region polypeptide and one or two mutations are in the second Fc-region polypeptide so that all of the mutations i) 1253 A, H310A and H435A, or ii) H310A, H433A and Y436A, or iii) L251D,
- the variant (human) IgG class Fc-region comprises a first and a second Fc-region polypeptide of human IgGl subclass wherein a) the first and the second Fc-region polypeptide both further comprise the mutations L234A and L235A (numbering according to Kabat EU index numbering system), or b) the first and the second Fc-region polypeptide both further comprise the mutation P329G (numbering according to Kabat EU index numbering system), or c) the first and the second Fc-region polypeptide both further comprise the mutations L234A and L235A and P329G (numbering according to Kabat EU index numbering system), or d) the first and the second Fc-region polypeptide both further comprise the mutations L234A and L235A (numbering according to Kabat EU index numbering system) and the first Fc-region polypeptide further comprises the mutation Y349C or S354C and the mutation T366W and the second Fc
- the variant (human) IgG class Fc-region comprises a first and a second Fc-region polypeptide of human IgG4 subclass wherein a) the first and the second Fc-region polypeptide both further comprise the mutations S228P and L235E (numbering according to Kabat EU index numbering system), or b) the first and the second Fc-region polypeptide both further comprise the mutation P329G (numbering according to Kabat EU index numbering system), or c) the first and the second Fc-region polypeptide both further comprise the mutations S228P and L235E and P329G (numbering according to Kabat EU index numbering system), or d) the first and the second Fc-region polypeptide both further comprise the mutations S228P and L235E (numbering according to Kabat EU index numbering system) and the first Fc-region polypeptide further comprises the mutation Y349C or S354C and the mutation T366W and the second Fc-region polypeptide
- One aspect as reported herein is an antibody or Fc-region fusion polypeptide comprising the variant (human) IgG class Fc-region as reported herein.
- the antibody is a monoclonal antibody. In one embodiment the antibody is a human, humanized, or chimeric antibody.
- One aspect as reported herein is a nucleic acid encoding the variant (human) IgG class Fc-region as reported herein.
- One aspect as reported herein is a nucleic acid encoding the antibody as reported herein.
- One aspect as reported herein is a nucleic acid encoding the Fc-region fusion polypeptide as reported herein.
- One aspect as reported herein is a host cell comprising the nucleic acid as reported herein.
- One aspect as reported herein is a method of producing the variant (human) IgG class Fc-region as reported herein comprising culturing the host cell as reported herein so that the variant (human) IgG class Fc-region is produced.
- One aspect as reported herein is a method of producing the antibody as reported herein comprising culturing the host cell as reported herein so that the antibody is produced.
- One aspect as reported herein is a method of producing the Fc-region fusion polypeptide as reported herein comprising culturing the host cell as reported herein so that the Fc-region fusion polypeptide is produced.
- One aspect as reported herein is a pharmaceutical formulation comprising the variant (human) IgG class Fc-region as reported herein or the antibody as reported herein or the Fc-region fusion polypeptide as reported herein.
- One aspect as reported herein is the variant (human) IgG class Fc-region as reported herein or the antibody as reported herein or the Fc-region fusion polypeptide as reported herein for use as a medicament.
- One aspect as reported herein is the use of the variant (human) IgG class Fc-region as reported herein or the antibody as reported herein or the Fc-region fusion polypeptide as reported herein in the manufacture of a medicament.
- the antibodies as reported herein can be used as e.g. T-cell recruiters, as Fc gamma receptor binder with high biological activity (potency) and fast clearance from the blood circulation (blood serum), as antibody-drug-conjugates with fast clearance in order to reduce systemic side effects, or as pre-targeting antibodies.
- Extrapolated viscosity at 150 mg/mL in 200 mM arginine/succinate, pH 5.5 (comparison of ⁇ VEGF-ANG-2> antibodies VEGFang2-0016 (with IHH- AAA mutation) with a reference antibody VEGFang2-0015
- IHH-AAA mutation IHH-AAA mutation
- B VEGFang2-0016 (with IHH- AAA mutation).
- Figure 6 FcgammaRIIIa interaction measurement of VEGFang2- 0015 without IHH-AAA mutation and VEGFang2-0016 with IHH-AAA mutation (both are IgGl subclass with P329G LALA mutations; as controls an anti-digoxigenin antibody (anti-Dig) of IgGl subclass and an IgG4 based antibody were used).
- FIG. 7A Schematic pharmacokinetic (PK)-ELISA assay principle for determination of concentrations of ⁇ VEGF-ANG-2> bispecific antibodies in serum and whole eye lysates.
- FIG. 7D Eye lysates concentration of VEGFang2-0016 (with IHH- AAA mutation) in right and left eye (after intravitreal application only into the right eye in comparison to intravenous application): significant concentrations could be detected only in the right eye after intravitreal application; after intravenous application no concentration in eye lysates could be detected due to the low serum half- life of VEGFang2-0016 (with IHH-AAA mutation).
- Figure 7E Eye lysates concentration of VEGFang2-0015 (without
- IHH-AAA mutation in right and left eye (after intravitreal application only into the right eye in comparison to intravenous application): in the right eye (and to some extent in the left eye) after intravitreal application concentrations of VEGFang2-0015 could be detected; this indicates the diffusion from the right eye into serum and from there into the left eye, which can be explained by the long half-life of VEGFang2-0015 (without IHH-AAA mutation); after intravenous application also significant concentrations in eye lysates of both eyes could be detected due to diffusion into the eyes of the serum-stable VEGFang2-0015 (without IHH-AAA mutation).
- FcRn display prolonged (YTE mutation) or shortened (IHH-AAA mutation) in vivo half-lives, enhanced (YTE mutation) or reduced binding (IHH-AAA mutation) compared to the reference wild-type (wt) antibody in SPR analysis as well as enhanced or reduced retention time in FcRn column chromatography; a) PK data after single i.v. bolus application of 10 mg/kg into huFcRn transgenic male
- C57BL/6J mice +/- 276 AUC data for wild-type IgG as well as YTE and IHH-AAA Fc-modified IgGs; b) BIAcore sensorgram; c) FcRn affinity column elution; wild-type anti-IGF-lR antibody (reference), YTE-mutant of anti-IGF- 1 R antibody, IHH- AAA-mutant of anti-IGF- 1 R antibody.
- Figure 9 Change of retention time in an FcRn affinity chromatography depending on the number of mutations introduced into the Fc-Region.
- FIG 11 Elution chromatogram of a bispecific ⁇ VEGF-ANG-2> antibody (VEGF/ANG2-0121) with the mutations H310A, H433A and Y436A in both heavy chains from two consecutive protein A affinity chromatography columns.
- Figure 12 Elution chromatogram of an anti-IGF- 1R antibody (IGF-
- Figure 14 Elution chromatogram of different ⁇ VEGF-ANG-2> antibodies on an FcRn affinity column.
- the term "about” denotes a range of +/- 20 % of the thereafter following numerical value. In one embodiment the term about denotes a range of +/- 10 % of the thereafter following numerical value. In one embodiment the term about denotes a range of +/- 5 % of the thereafter following numerical value.
- acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (VL) framework or a heavy chain variable domain (VH) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below.
- An acceptor human framework "derived from” a human immunoglobulin framework or a human consensus framework may comprise the same amino acid sequence thereof, or it may contain amino acid sequence alterations. In some embodiments, the number of amino acid alterations are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less.
- the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- an “affinity matured” antibody refers to an antibody with one or more alterations in one or more hypervariable regions (HVRs), compared to a parent antibody which does not possess such alterations, such alterations resulting in an improvement in the affinity of the antibody for antigen.
- HVRs hypervariable regions
- alteration denotes the mutation (substitution), insertion (addition), or deletion of one or more amino acid residues in a parent antibody or fusion polypeptide, e.g. a fusion polypeptide comprising at least an FcRn binding portion of an Fc-region, to obtain a modified antibody or fusion polypeptide.
- the termticianmutation denotes that the specified amino acid residue is substituted for a different amino acid residue.
- mutation L234A denotes that the amino acid residue lysine at position 234 in an antibody Fc-region (polypeptide) is substituted by the amino acid residue alanine (substitution of lysine with alanine)
- the replacing amino acid residue may be a "naturally occurring amino acid residues" and selected from the group consisting of alanine (three letter code: ala, one letter code: A), arginine (arg, R), asparagine (asn, N), aspartic acid (asp, D), cysteine (cys, C), glutamine (gin, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine
- the replacing amino acid residue may be a "non-naturally occurring amino acid residue". See e.g. US 6,586,207, WO 98/48032, WO 03/073238, US 2004/0214988, WO 2005/35727, WO 2005/74524, Chin, J.W., et al, J. Am. Chem. Soc. 124 (2002) 9026-9027;
- amino acid insertion denotes the (additional) incorporation of at least one amino acid residue at a predetermined position in an amino acid sequence. In one embodiment the insertion will be the insertion of one or two amino acid residues.
- the inserted amino acid residue(s) can be any naturally occurring or non- naturally occurring amino acid residue.
- amino acid deletion denotes the removal of at least one amino acid residue at a predetermined position in an amino acid sequence.
- ANG-2 refers to human angiopoietin-2 (ANG-2) (alternatively abbreviated with ANGPT2 or ANG2) (SEQ ID NO: 31) which is described e.g. in Maisonpierre, P.C., et al, Science 277 (1997) 55-60 and Cheung, A.H., et al, Genomics 48 (1998) 389-91.
- the angiopoietins-1 (SEQ ID NO: 32) and -2 were discovered as ligands for the Ties, a family of tyrosine kinases that is selectively expressed within the vascular endothelium (Yancopoulos, G.D., et al, Nature 407 (2000) 242-248).
- Angiopoietin-3 and -4 (ANG-3 and ANG-4) may represent widely diverged counterparts of the same gene locus in mouse and man (Kim, I., et al, FEBS Let, 443 (1999) 353-356; Kim, I., et al, J. Biol. Chem.
- ANG-1 and ANG-2 were originally identified in tissue culture experiments as agonist and antagonist, respectively (see for ANG-1 : Davis, S., et al, Cell 87 (1996) 1161-1169; and for ANG-2: Maisonpierre, P.C., et al, Science 277 (1997) 55-60). All of the known angiopoietins bind primarily to Tie2 (SEQ ID NO: 33), and both ANG-1 and -2 bind to Tie2 with an affinity of 3 nM (Kd) (Maisonpierre, P.C., et al, Science 277 (1997) 55-60).
- antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, multispecific antibodies (e.g. bispecific antibodies, trispecific antibodies), and antibody fragments so long as they exhibit the desired antigen- and/or protein A and/or FcRn-binding activity.
- an "antibody that binds to the same epitope” as a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50 % or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50 % or more.
- An exemplary competition assay is provided herein.
- asymmetric Fc-region denotes a pair of Fc-region polypeptides that have different amino acid residues at corresponding positions according to the Kabat EU index numbering system.
- asymmetric Fc-region with respect to FcRn binding denotes an Fc- region that consists of two polypeptide chains that have different amino acid residues at corresponding positions, whereby the positions are determined according to the Kabat EU index numbering system, whereby the different positions affect the binding of the Fc-region to the human neonatal Fc-receptor (FcRn).
- FcRn human neonatal Fc-receptor
- the differences between the two polypeptide chains of the Fc-region in an "asymmetric Fc-region with respect to FcRn binding" do not include differences that have been introduced to facilitate the formation of heterodimeric Fc-regions, e.g. for the production of bispecific antibodies. These differences can also be asymmetric, i.e.
- the two chains have differences at non corresponding amino acid residues according to the Kabat EU index numbering system. These differences facilitate heterodimerization and reduce homodimerization. Examples of such differences are the so-called "knobs into holes” substitutions (see, e.g., US 7,695,936 and US 2003/0078385).
- heterodimerization facilitating amino acid changes are the so-called "charge pair substitutions" (see, e.g., WO 2009/089004).
- the following charge pair substitutions in the individual polypeptide chains of an Fc-region of an IgG antibody of subclass IgGl have been found to increase heterodimer formation: 1) K409D or K409E in one chain and D399K or D399R in the other chain; 2) K392D or K392E in one chain and D399K or D399R in the other chain; 3) K439D or K439E in one chain and E356K or E356R in the other chain; 4) K370D or K370E in one chain and E357K or E357R in the other chain; 5) K409D and K360D in one chain plus D399K and E356K in the other chain; 6) K409D and K370D in one chain plus D399K and E357K in the other chain; 7) K
- binding denotes the binding of an antibody to its antigen in an in vitro assay, in one embodiment in a binding assay in which the antibody is bound to a surface and binding of the antigen to the antibody is measured by Surface Plasmon Resonance (SPR).
- Binding means a binding affinity (K D ) of 10 "8 M or less, in some embodiments of 10 ⁇ 13 to 10 ⁇ 8 M, in some embodiments of 10 ⁇ 13 to 10 "9 M.
- Binding can be investigated by a BIAcore assay (GE Healthcare Biosensor AB, Uppsala, Sweden).
- the affinity of the binding is defined by the terms k a (rate constant for the association of the antibody from the antibody/antigen complex), kj
- chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
- CH2 domain denotes the part of an antibody heavy chain polypeptide that extends approximately from EU position 231 to EU position 340 (EU numbering system according to Kabat).
- a CH2 domain has the amino acid sequence of SEQ ID NO: 09: APELLGG PSVFLFPPKP KDTLMISRTP EVTCVWDVS HEDPEVKFNW YVDGVEVHNA KTKPREEQ
- CH3 -domain denotes the part of an antibody heavy chain polypeptide that extends approximately from EU position 341 to EU position 446.
- the CH3 domain has the amino acid sequence of SEQ ID NO: 10: GQPREPQ VYTLPPSRDE LTKNQVSLTC LVKGFYPSDI AVEWESNGQP
- the "class” of an antibody refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses
- immunoglobulins e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgA ls and IgA 2 .
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called a, ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- the term "comparable length” denotes that two polypeptides comprise the identical number of amino acid residues or can be different in length by one or more and up to 10 amino acid residues at most.
- the Fc-region polypeptides comprise the identical number of amino acid residues or differ by a number of from 1 to 10 amino acid residues.
- the Fc-region polypeptides comprise the identical number of amino acid residues or differ by a number of from 1 to 5 amino acid residues.
- the Fc-region polypeptides comprise the identical number of amino acid residues or differ by a number of from 1 to 3 amino acid residues.
- derived from denotes that an amino acid sequence is derived from a parent amino acid sequence by introducing alterations at at least one position.
- a derived amino acid sequence differs from the corresponding parent amino acid sequence at at least one corresponding position (numbering according to Kabat EU index numbering system for antibody Fc-regions).
- an amino acid sequence derived from a parent amino acid sequence differs by one to fifteen amino acid residues at corresponding positions.
- an amino acid sequence derived from a parent amino acid sequence differs by one to ten amino acid residues at corresponding positions.
- an amino acid sequence derived from a parent amino acid sequence differs by one to six amino acid residues at corresponding positions.
- a derived amino acid sequence has a high amino acid sequence identity to its parent amino acid sequence.
- an amino acid sequence derived from a parent amino acid sequence has 80 % or more amino acid sequence identity.
- an amino acid sequence derived from a parent amino acid sequence has 90 % or more amino acid sequence identity.
- an amino acid sequence derived from a parent amino acid sequence has 95 % or more amino acid sequence identity.
- Antibody effector functions refer to those biological activities attributable to the Fc-region of an antibody, which vary with the antibody class. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. B-cell receptor); and B-cell activation.
- an "effective amount" of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- Fc-fusion polypeptide denotes a fusion of a binding domain (e.g. an antigen binding domain such as a single chain antibody, or a polypeptide such as a ligand of a receptor) with an antibody Fc-region that exhibits the desired target- and/or protein A and/or FcRn-binding activity.
- Fc-region of human origin denotes the C-terminal region of an immunoglobulin heavy chain of human origin that contains at least a part of the hinge region, the CH2 domain and the CH3 domain.
- a human IgG heavy chain Fc-region extends from Cys226, or from Pro230, to the carboxyl- terminus of the heavy chain.
- the Fc-region has the amino acid sequence of SEQ ID NO: 60.
- the C-terminal lysine (Lys447) of the Fc- region may or may not be present.
- numbering of amino acid residues in the Fc-region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat, E.A., et al, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service,
- the Fc-region is composed of two heavy chain Fc-region polypeptides, which can be covalently linked to each other via the hinge region cysteine residues forming inter- polypeptide disulfide bonds.
- the term "FcRn" denotes the human neonatal Fc-receptor. FcRn functions to salvage IgG from the lysosomal degradation pathway, resulting in reduced clearance and increased half-life.
- the FcRn is a heterodimeric protein consisting of two polypeptides: a 50 kDa class I major histocompatibility complex-like protein (a-FcRn) and a 15 kDa p2-microglobulin ( ⁇ 2 ⁇ ). FcRn binds with high affinity to the CH2-CH3 portion of the Fc-region of IgG.
- the interaction between IgG and FcRn is strictly pH dependent and occurs in a 1 :2 stoichiometry, with one IgG binding to two FcRn molecules via its two heavy chains (Huber, A.H., et al, J. Mol. Biol. 230 (1993) 1077-1083).
- FcRn binding occurs in the endosome at acidic pH (pH ⁇ 6.5) and IgG is released at the neutral cell surface (pH of about 7.4).
- the pH-sensitive nature of the interaction facilitates the FcRn-mediated protection of IgGs pinocytosed into cells from intracellular degradation by binding to the receptor within the acidic environment of endosomes.
- FcRn then facilitates the recycling of IgG to the cell surface and subsequent release into the blood stream upon exposure of the FcRn-IgG complex to the neutral pH environment outside the cell.
- FcRn binding portion of an Fc-region denotes the part of an antibody heavy chain polypeptide that extends approximately from EU position 243 to EU position 261 and approximately from EU position 275 to EU position 293 and approximately from EU position 302 to EU position 319 and approximately from EU position 336 to EU position 348 and approximately from EU position 367 to
- EU position 393 and EU position 408 and approximately from EU position 424 to EU position 440 are altered F243, P244, P245 P, K246, P247, K248, D249, T250, L251, M252, 1253, S254, R255, T256, P257, E258, V259, T260, C261, F275, N276, W277, Y278, V279, D280, V282, E283, V284, H285, N286, A287, K288, T289, K290, P291, R292, E293, V302, V303, S304, V305, L306, T307, V308, L309, H310, Q311, D312, W313, L314, N315, G316, K317, E318, Y319, 1336, S337, K338, A339, K340, G341, Q342, P343, R34
- FR Framework or "FR” refers to variable domain residues other than hypervariable region (HVR) residues.
- the FR of a variable domain generally consists of four FR domains: FR1, FR2, FR3, and FR4. Accordingly, the HVR and FR sequences generally appear in the following sequence in VH (or VL): FR1-H1(L1)-FR2-
- full length antibody denotes an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc-region as defined herein.
- a full length antibody may comprise further domains, such as e.g. a scFv or a scFab conjugated to one or more of the chains of the full length antibody. These conjugates are also encompassed by the term full length antibody.
- heterodimer or “heterodimeric” denote a molecule that comprises two polypeptide chains (e.g. of comparable length), wherein the two polypeptide chains have an amino acid sequence that have at least one different amino acid residue in a corresponding position, whereby corresponding position is determined according to the EU index of Kabat.
- homodimer and “homodimeric” denote a molecule that comprises two polypeptide chains of comparable length, wherein the two polypeptide chains have an amino acid sequence that is identical in corresponding positions, whereby corresponding positions are determined according to the EU index of Kabat.
- an antibody or Fc-region fusion polypeptide as reported herein can be homodimeric or heterodimeric with respect to its Fc-region which is determined with respect to mutations or properties in focus.
- an Fc-region (antibody) is homodimeric (i.e.
- both heavy chain Fc-region polypeptides comprise these mutations) with respect to the mutations H310A, H433A and Y436A (these mutations are in focus with respect to FcRn and/or protein A binding property of the Fc-region fusion polypeptide or antibody) but at the same time heterodimeric with respect to the mutations Y349C, T366S, L368A and Y407V (these mutations are not in focus as these mutations are directed to the heterodimerization of the heavy chains and not to the FcRn/protein A binding properties) as well as the mutations S354C and T366W, respectively (the first set is comprised only in the first Fc-region polypeptide whereas the second set is comprised only in the second
- an Fc-region fusion polypeptide or an antibody as reported herein can be heterodimeric with respect to the mutations I253A, H310A, H433A, H435A and Y436A (i.e. these mutations are directed all to the FcRn and/or protein A binding properties of the dimeric polypeptide), i.e. one Fc-region polypeptide comprises the mutations 1253 A, H310A and H435A, whereas the other Fc-region polypeptide comprises the mutations H310A, H433A and Y436A.
- host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
- Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
- a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
- a "human consensus framework” is a framework which represents the most commonly occurring amino acid residues in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat, E.A. et al, Sequences of Proteins of Immunological Interest, 5th ed., Bethesda MD (1991), NIH Publication 91-3242, Vols. 1-3.
- the subgroup is subgroup kappa I as in Kabat et al, supra.
- the subgroup is subgroup III as in Kabat et al, supra.
- human Fc-region polypeptide denotes an amino acid sequence which is identical to a "native” or “wild-type” human Fc-region polypeptide.
- variant (human) Fc-region polypeptide denotes an amino acid sequence which derived from a "native” or "wild-type” human Fc-region polypeptide by virtue of at least one "amino acid alteration”.
- a "human Fc-region” is consisting of two human Fc-region polypeptides.
- a “variant (human) Fc-region” is consisting of two Fc- region polypeptides, whereby both can be variant (human) Fc-region polypeptides or one is a human Fc-region polypeptide and the other is a variant (human) Fc- region polypeptide.
- the human Fc-region polypeptide has the amino acid sequence of a human IgGl Fc-region polypeptide of SEQ ID NO: 60, or of a human IgG2
- Fc-region polypeptide of SEQ ID NO: 61 or of a human IgG3 Fc-region polypeptide of SEQ ID NO: 62, or of a human IgG4 Fc-region polypeptide of SEQ ID NO: 63.
- the variant (human) Fc-region polypeptide is derived from an Fc-region polypeptide of SEQ ID NO: 60, or 61, or 62, or 63 and has at least one amino acid mutation compared to the human Fc-region polypeptide of SEQ ID NO: 60, or 61, or 62, or 63.
- the variant (human) Fc- region polypeptide comprises/has from about one to about twelve amino acid mutations, and in one embodiment from about one to about eight amino acid mutations. In one embodiment the variant (human) Fc-region polypeptide has at least about 80 % homology with a human Fc-region polypeptide of SEQ ID NO:
- variant (human) Fc-region polypeptide has least about 90 % homology with a human Fc-region polypeptide of SEQ ID NO: 60, or 61, or 62, or 63. In one embodiment the variant (human) Fc- region polypeptide has at least about 95 % homology with a human Fc-region polypeptide of SEQ ID NO: 60, or 61, or 62, or 63.
- the variant (human) Fc-region polypeptide derived from a human Fc-region polypeptide of SEQ ID NO: 60, or 61, or 62, or 63 is defined by the amino acid alterations that are contained.
- P329G denotes a variant (human) Fc-region polypeptide derived human Fc-region polypeptide with the mutation of proline to glycine at amino acid position 329 relative to the human Fc- region polypeptide of SEQ ID NO: 60, or 61, or 62, or 63.
- amino acid positions of all constant regions and domains of the heavy and light chain are numbered according to the Kabat numbering system described in Kabat, et al, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991) and is referred to as "numbering according to Kabat" herein.
- Kabat numbering system see pages 647-660 of Kabat, et al, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991) is used for the light chain constant domain CL of kappa and lambda isotype and the Kabat EU index numbering system (see pages 661-723) is used for the constant heavy chain domains (CHI, Hinge, CH2 and CH3).
- a human IgGl Fc-region polypeptide has the following amino acid sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSPvDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSPGK (SEQ ID NO: 60).
- a human IgGl Fc-region derived Fc-region polypeptide with the mutations L234A, L235A has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with Y349C, T366S, L368A and Y407V mutations has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with S354C, T366W mutations has the following amino acid sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSPGK (SEQ ID NO: 66).
- a human IgGl Fc-region derived Fc-region polypeptide with L234A, L235A mutations and Y349C, T366S, L368A, Y407V mutations has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with a L234A, L235A and S354C, T366W mutations has the following amino acid sequence: DKTHTCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPCRDELTKNQVSLWCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSPGK (SEQ ID NO: 68).
- a human IgGl Fc-region derived Fc-region polypeptide with a P329G mutation has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with L234A, L235A mutations and P329G mutation has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with a P239G mutation and Y349C, T366S, L368A, Y407V mutations has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with a P329G mutation and S354C, T366W mutation has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with L234A, L235A, P329G and Y349C, T366S, L368A, Y407V mutations has the following amino acid sequence:
- a human IgGl Fc-region derived Fc-region polypeptide with L234A, L235A, P329G mutations and S354C, T366W mutations has the following amino acid sequence:
- a human IgG4 Fc-region polypeptide has the following amino acid sequence: ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN VFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 63).
- a human IgG4 Fc-region derived Fc-region polypeptide with S228P and L235E mutations has the following amino acid sequence:
- a human IgG4 Fc-region derived Fc-region polypeptide with S228P, L235E mutations and P329G mutation has the following amino acid sequence:
- a human IgG4 Fc-region derived Fc-region polypeptide with S354C, T366W mutations has the following amino acid sequence: ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPCQEEMTK QVSLWCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN VFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 77).
- a human IgG4 Fc-region derived Fc-region polypeptide with Y349C, T366S, L368A, Y407V mutations has the following amino acid sequence:
- a human IgG4 Fc-region derived Fc-region polypeptide with a S228P, L235E and S354C, T366W mutations has the following amino acid sequence: ESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPCQEEMTKNQVSLWCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGN VFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 79).
- a human IgG4 Fc-region derived Fc-region polypeptide with a P329G mutation has the following amino acid sequence:
- a human IgG4 Fc-region derived Fc-region polypeptide with a P239G and Y349C, T366S, L368A, Y407V mutations has the following amino acid sequence: ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKGLGSSIEKTISKAKGQPREPQVCTLPPSQEEMTKNQVSLSCAVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSRLTVDKSRWQEGN VFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 82).
- a human IgG4 Fc-region derived Fc-region polypeptide with a P329G and S354C, T366W mutations has the following amino acid sequence:
- a human IgG4 Fc-region derived Fc-region polypeptide with a S228P, L235E, P329G and Y349C, T366S, L368A, Y407V mutations has the following amino acid sequence: ESKYGPPCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY KCKVSNKGLGSSIEKTISKAKGQPREPQVCTLPPSQEEMTKNQVSLSCAVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSRLTVDKSRWQEGN VFSCSVMHEALHNHYTQKSLSLSLGK (SEQ ID NO: 84).
- a “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., the CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody.
- a humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody.
- a "humanized form" of an antibody, e.g., a non- human antibody refers to an antibody that has undergone humanization.
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence ("complementarity determining regions” or “CDRs") and form structurally defined loops ("hypervariable loops"), and/or contain the antigen-contacting residues ("antigen contacts").
- CDRs complementarity determining regions
- hypervariable loops form structurally defined loops
- antigen contacts Generally, antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
- HVRs as denoted herein include
- HVR residues comprise those identified elsewhere in the specification.
- HVR residues and other residues in the variable domain are numbered herein according to the Kabat EU index numbering system (Kabat et al., supra).
- IGF-IR refers to any native IGF-IR from any vertebrate source, including mammals such as primates (e.g. humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- the term encompasses "full-length", unprocessed IGF-1R as well as any form of IGF-1R that results from processing in the cell.
- the term also encompasses naturally occurring variants of IGF-1R, e.g., splice variants or allelic variants.
- the amino acid sequence of human IGF-1R is shown in SEQ ID NO: 11.
- An "individual” or “subject” is a mammal. Mammals include, but are not limited to, domesticated animals (e.g. cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats).
- the individual or subject is a human.
- an “isolated” antibody is one which has been separated from a component of its natural environment.
- an antibody is purified to greater than 95 % or 99 % purity as determined by, for example, electrophoretic (e.g., SDS- PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., size-exclusion chromatography or ion exchange or reverse phase HPLC).
- electrophoretic e.g., SDS- PAGE, isoelectric focusing (IEF), capillary electrophoresis
- chromatographic e.g., size-exclusion chromatography or ion exchange or reverse phase HPLC.
- nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment.
- An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- isolated nucleic acid encoding an anti-IGF-lR antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
- “Native antibodies” refer to naturally occurring immunoglobulin molecules with varying structures.
- native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and
- each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain.
- VL variable region
- CL constant light
- the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
- Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office,
- the ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, California, or may be compiled from the source code.
- the ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- a “pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
- a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
- the term "peptidic linker” as used herein denotes a peptide with amino acid sequences, which is in one embodiment of synthetic origin.
- the peptidic linker is in one embodiment a peptide with an amino acid sequence with a length of at least 30 amino acids, in one embodiment with a length of 32 to 50 amino acids. In one embodiment the peptidic linker is a peptide with an amino acid sequence with a length of 32 to 40 amino acids.
- the peptidic linker is (G 4 S) 6 G 2 .
- the term "recombinant antibody” denotes all antibodies (chimeric, humanized and human) that are prepared, expressed, created or isolated by recombinant means. This includes antibodies isolated from a host cell such as a NSO or CHO cell or from an animal (e.g.
- the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germ line VH and VL sequences, may not naturally exist within the human antibody germ line repertoire in vivo.
- treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- antibodies or Fc-region fusion polypeptides as reported herein are used to delay development of a disease or to slow the progression of a disease.
- bivalent as used within the current application denotes the presence of a specified number of binding sites in a (antibody) molecule.
- bivalent tetravalent
- hexavalent denote the presence of two binding site, four binding sites, and six binding sites, respectively, in a (antibody) molecule.
- the bispecific antibodies as reported herein are in one preferred embodiment "bivalent”.
- variable region or “variable domain” refer to the domain of an antibody heavy or light chain that is involved in binding of the antibody to its antigen.
- the variable domains of the heavy chain and light chain (VH and VL, respectively) of an antibody generally have similar structures, with each domain comprising four framework regions (FRs) and three hypervariable regions (HVRs) (see, e.g., Kindt, T.J. et al. Kuby Immunology, 6th ed., W.H. Freeman and Co., N.Y. (2007), page 91).
- a single VH or VL domain may be sufficient to confer antigen-binding specificity.
- antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano, S. et al, J. Immunol. 150 (1993) 880-887; Clackson, T. et al, Nature 352 (1991) 624- 628).
- ocular vascular disease includes, but is not limited to intraocular neovascular syndromes such as diabetic retinopathy, diabetic macular edema, retinopathy of prematurity, neovascular glaucoma, retinal vein occlusions, central retinal vein occlusions, macular degeneration, age-related macular degeneration, retinitis pigmentosa, retinal angiomatous proliferation, macular telangectasia, ischemic retinopathy, iris neovascularization, intraocular neovascularization, corneal neovascularization, retinal neovascularization, choroidal neovascularization, and retinal degeneration (see e.g.
- Garner, A. Vascular diseases, In: Pathobiology of ocular disease, A dynamic approach, Garner, A., and Klintworth, G.K., (eds.), 2nd edition, Marcel Dekker, New York (1994), pp. 1625- 1710).
- vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
- the term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors”.
- VEGF refers to human vascular endothelial growth factor (VEGF/VEGF-A) the 165 -amino acid human vascular endothelial cell growth factor (amino acid 27-191 of precursor sequence of human VEGF 165: SEQ ID NO: 30; amino acids 1-26 represent the signal peptide), and related 121, 189, and 206 vascular endothelial cell growth factor isoforms, as described by Leung, D.W., et al, Science 246 (1989) 1306-1309; Houck et al, Mol. Endocrin.
- VEGF vascular endothelial growth factor
- VEGF is a homodimeric glycoprotein that has been isolated from several sources and includes several isoforms. VEGF shows highly specific mitogenic activity for endothelial cells.
- the term "with (the) mutation IHH-AAA” as used herein refers to the combination of the mutations I253A (Ile253Ala), H310A (His310Ala), and H435A (His435Ala) and the term "with (the) mutation HHY-AAA” as used herein refers to the combination of the mutations H310A (His310Ala), H433A (His433Ala), and Y436A (Tyr436Ala) and the term "with (the) mutation YTE” as used herein refers to the combination of mutations M252Y (Met252Tyr), S254T (Ser254Thr), and T256E (Thr256Glu) in the constant heavy chain region of IgGl or IgG4 subclass, wherein the numbering is according to the EU Index of Kabat.
- the term "with (the) mutations P329G LALA” as used herein refers to the combination of the mutations L234A (Leu234Ala), L235A (Leu235Ala) and P329G (Pro329Gly) in the constant heavy chain region of IgGl subclass, wherein the numbering is according to the EU Index of Kabat.
- the term "with (the) mutation SPLE” as used herein refers to the combination of the mutations S228P (Ser228Pro) and L235E (Leu235Glu) in the constant heavy chain region of IgG4 subclass, wherein the numbering is according to the EU Index of Kabat.
- the invention is based, at least in part, on the finding that the FcRn-binding of an antibody or Fc-region fusion polypeptide can be modified by altering amino acid residues at non-corresponding positions in the individual Fc-region polypeptides because these alterations act together in the modification of the FcRn-binding.
- Antibodies and Fc-region fusion polypeptides as reported herein are useful, e.g., for the treatment of diseases in which tailor-made systemic retention times are required.
- the neonatal Fc-receptor (FcRn) The neonatal Fc-receptor (FcRn) is important for the metabolic fate of antibodies of the IgG class in vivo.
- the FcRn functions to salvage wild-type IgG from the lysosomal degradation pathway, resulting in reduced clearance and increased half- life. It is a heterodimeric protein consisting of two polypeptides: a 50 kDa class I major histocompatibility complex-like protein (a-FcRn) and a 15 kDa ⁇ 2- microglobulin ( ⁇ 2 ⁇ ).
- FcRn binds with high affinity to the CH2-CH3 portion of the Fc-region of an antibody of the class IgG.
- an antibody of the class IgG and the FcRn is pH dependent and occurs in a 1 :2 stoichiometry, i.e. one IgG antibody molecule can interact with two FcRn molecules via its two heavy chain Fc-region polypeptides (see e.g. Huber, A.H., et al, J. Mol. Biol. 230 (1993) 1077-1083).
- an IgGs in vitro FcRn binding properties/characteristics are indicative of its in vivo pharmacokinetic properties in the blood circulation.
- the amino acid residues interacting with the FcRn are located approximately between EU position 243 and EU position 261, approximately between EU position 275 and EU position 293, approximately between EU position 302 and EU position 319, approximately between EU position 336 and EU position 348, approximately between EU position 367 and EU position 393, at EU position 408, and approximately between EU position 424 and EU position 440.
- antibodies with reduced half-life in the blood circulation are desired.
- drugs for intravitreal application should have a long half-live in the eye and a short half-life in the circulation of the patient.
- Such antibodies also have the advantage of increased exposure to a disease site, e.g. in the eye.
- Fc-region residues critical to the mouse Fc-mouse FcRn interaction have been identified by site-directed mutagenesis (see e.g. Dall'Acqua, W.F., et al. J. Immunol 169 (2002) 5171-5180). Residues 1253, H310,
- H433, N434, and H435 (EU numbering according to Kabat) are involved in the interaction (Medesan, C, et al, Eur. J. Immunol. 26 (1996) 2533-2536; Firan, M., et al, Int. Immunol. 13 (2001) 993-1002; Kim, J.K., et al, Eur. J. Immunol. 24 (1994) 542-548). Residues 1253, H310, and H435 were found to be critical for the interaction of human Fc with murine FcRn (Kim, J.K., et al, Eur. J. Immunol. 29 (1999) 2819-2825).
- Residues M252Y, S254T, T256E have been described by Dall'Acqua et al. to improve FcRn binding by protein-protein interaction studies (DallAcqua, W.F., et al. J. Biol. Chem. 281 (2006) 23514-23524).
- Studies of the human Fc-human FcRn complex have shown that residues 1253, S254, H435, and Y436 are crucial for the interaction (Firan, M., et al., Int. Immunol. 13 (2001) 993- 1002; Shields, R.L., et al, J. Biol. Chem. 276 (2001) 6591-6604).
- T252L/T254S/T256F increased increased Ghetie, V.
- T252A/T254S/T256A (murine) (in mouse) and Ward,
- H310A H310A ⁇ 0.1 (in mouse) Eur. J.
- T307A/E380A/N434A increased increased in Pop, L.M.
- N434A increased increased in Yeung
- the variant (human) IgG class Fc-region is a heterodimer and the pairing of the first (heavy chain) Fc-region polypeptide and the second (heavy chain) Fc- region polypeptide to form a functional Fc-region results in the formation of a heterodimer.
- the single mutation H310A is the most silent symmetrical mutation to delete any FcRn-binding.
- the symmetric single mutation 1253 A and H435A result in a relative shift of retention time of 0.3 - 0.4 min. This can be generally regarded as a non-detectable binding.
- the single mutation Y436A results in detectable interaction strength to the FcRn affinity column. Without being bound by this theory this mutation could have an FcRn mediated half-life which can be differentiated from a zero interaction such as the combination of the 1253 A, H310A and H435A mutations (IHH-AAA mutation).
- VEGF/ANG2 bispecific anti-VEGF/ANG2 antibody
- IGF-1R monospecific anti-IGF-lR antibody
- fusion full length antibody with fusions to the C-terminus of both heavy chains (fusion) assembled using the knobs-into-holes technology in order to allow the introduction of asymmetric mutations
- VEGF/ANG2 bispecific anti-VEGF/ANG2 antibody
- IGF-1R monospecific anti-IGF-lR antibody
- fusion full length antibody with fusions to the C-terminus of both heavy chains
- VEGFang2 I253A I253A L234A no no n.d. no -0016 H310A H310A L235A
- H435A H435A P329G antibody further further FcR FcRn FcRn protein A protein A mutation mutation binding binding binding binding binding binding binding binding in knob in hole affecting (SPR) (column) (SPR) (column) chain chain mutations
- mutations I253A, H310A, H435A, or L251D, L314D, L432D, or L251S, L314S, L432S result in a loss of the binding to protein A
- mutations 1253 A, H310A, H435A, or H310A, H433A, Y436A, or L251D, L314D, L432D result in a loss of the binding to the human neonatal Fc receptor.
- One aspect as reported herein is an antibody or Fc-region fusion polypeptide comprising the variant human IgG class Fc-region as reported herein.
- the Fc-region in the Fc-region fusion polypeptide confers the above described characteristics to its fusion partner.
- the fusion partner can be any molecules having a biological activity whose in vivo half-live shall be reduced or increased, i.e. whose in vivo half-live shall be clearly defined and tailor-made for its intended application.
- TNFR human tumor necrosis factor receptor
- IL-1R human interleukin-1 receptor
- VEGFR-Fc-region fusion polypeptides VEGFR-Fc-region fusion polypeptides
- VEGFR-Fc-region fusion polypeptides human vascular
- Fc-region fusion polypeptides may comprise e.g. a variant (human) IgG class Fc- region as reported herein and an antibody fragment that binds to a target including, such as, for example, an antibody Fab fragment, scFvs (see e.g. Nat. Biotechnol. 23 (2005) 1126-1136), or domain antibodies (dAbs) (see e.g. WO 2004/058821, WO 2003/002609).
- Fc-region fusion polypeptides may comprise e.g. a variant (human) IgG class Fc- region as reported herein and a receptor ligand (either naturally occurring or artificial).
- the invention provides isolated antibodies that have modified FcRn- binding, i.e. these antibodies bind to human FcRn with an affinity higher or lower than an antibody having no mutations affecting the FcRn-binding.
- the antibody comprises an Fc-region comprising a first Fc- region polypeptide and a second Fc-region polypeptide, wherein a) the first Fc-region polypeptide and the second Fc-region polypeptide are derived from the same human Fc-region polypeptide, and b) the first Fc-region polypeptide has been modified in that its amino acid sequence differs from the second Fc-region polypeptide amino acid sequence at least at one corresponding position according to the Kabat EU index numbering system, and the second Fc-region polypeptide has been modified in that its amino acid sequence differs from the first Fc-region polypeptide amino acid sequence at least at one corresponding position according to the Kabat EU index numbering system, whereby the modified position in the first Fc-region polypeptide and the modified position in the second Fc-region polypeptide are different, and c) the Fc-region has a different affinity to a human Fc-receptor compared to an Fc-region that comprises as first and second Fc-region
- One exemplary antibody as reported herein and also one aspect of the current invention is a bispecific, bivalent antibody with abolished FcRn binding comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, wherein i) the first antigen-binding site specifically binding to VEGF comprises in the heavy chain variable domain a CDR3H region of SEQ ID NO: 14, a CDR2H region of SEQ ID NO: 15, and a CDR1H region of SEQ ID NO: 16, and in the light chain variable domain a CDR3L region of SEQ ID NO: 17, a CDR2L region of SEQ ID NO: 18, and a CDR1L region of SEQ ID NO: 19, and ii) the second antigen-binding site specifically binding to ANG-2 comprises in the heavy chain variable domain a CDR3H region of SEQ ID NO: 22, a CDR2H region of, SEQ ID NO: 23, and a C
- the Fc-region is a variant (human) IgG class Fc- region.
- the variant (human) IgG class Fc-region is an IgG class heterodimeric Fc-region.
- the pairing of the first Fc-region polypeptide and the second Fc-region polypeptide to form a (functional) Fc-region results in the formation of a heterodimer.
- human Fc-region polypeptide is a human Fc-region polypeptide of the IgGl subclass or of the IgG4 subclass.
- human Fc-region polypeptide is a human Fc-region polypeptide of the IgGl subclass which further comprises the mutations L234A, L235A and P329G. In one embodiment the human Fc-region polypeptide is a human Fc-region polypeptide of the IgG4 subclass which further comprises the mutations S228P and L235E.
- the first Fc-region polypeptide further comprises the mutations S354C and T366W and the second Fc-region polypeptide further comprises the mutations Y349C, T366S, L368A and Y407V.
- the bispecific antibody is characterized in that i) the first antigen-binding site specifically binding to VEGF comprises as heavy chain variable domain VH an amino acid sequence of SEQ ID NO: 20, and as light chain variable domain VL an amino acid sequence of SEQ ID NO: 21, and ii) the second antigen-binding site specifically binding to ANG-2 comprises as heavy chain variable domain VH an amino acid sequence of SEQ ID NO: 28, and as light chain variable domain VL an amino acid sequence of SEQ ID NO: 29.
- the bispecific antibody is characterized in that the Fc-region of iii) is of human IgGl subclass. In one embodiment the bispecific antibody is characterized in that the Fc-region of human IgGl subclass further comprises the mutations L234A, L235A and P329G (numbering according to EU Index of Kabat).
- the bispecific antibody is characterized in that the Fc-region of iii) is of human IgG4 subclass. In one embodiment the bispecific antibody is characterized in that the Fc-region of human IgG4 subclass further comprises the mutations S228P and L235E (numbering according to EU Index of Kabat). In one embodiment the bispecific antibody is characterized in that the Fc-region of human IgG4 subclass further comprises the mutations S228P, L235E and P329G (numbering according to EU Index of Kabat).
- the bispecific antibody comprises an Fc-region comprising a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (i.e. derived from human origin), which comprise one or two of the mutations selected from i) the group 1253 A, H310A, H435A, or ii) the group H310A, H433A, Y436A, or iii) the group L251D, L314D, L432D, or iv) the group L251S, L314S, L432S (numbering according to Kabat EU index numbering system) in the first Fc-region polypeptide and one or two of the mutations selected from the group comprising the mutations L251D, L251S, I253A, H310A, L314D, L314S, L432D, L432S, H433A, H435A, and Y436A (numbering according to Kabat EU
- the bispecific antibody comprises an Fc-region comprising a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (i.e. derived from human origin), which comprise the mutations I253A/H310A/H435A or H310A/H433A/Y436A or L251D/L314D/L432D or L251S/L314S/L432S or combinations thereof in the Fc-region (numbering according to Kabat EU index numbering system), whereby either all mutations are in the first or the second Fc-region polypeptide or one or two mutations are in the first Fc-region polypeptide and one or two mutations are in the second Fc-region polypeptide so that all of the mutations i) 1253 A, H310A, H435A, or ii) H310A, H433A, Y436A, or iii) L251D, L314D, L4
- Still further aspects as reported herein are a pharmaceutical formulation comprising the bispecific antibody, the pharmaceutical formulation for use in the treatment of ocular vascular diseases, the use of the bispecific antibody for the manufacture of a medicament for the treatment of ocular vascular diseases, a method of treatment of patient suffering from ocular vascular diseases by administering the bispecific antibody to a patient in the need of such treatment.
- the bispecific antibody or the pharmaceutical formulation comprising the bispecific antibody is administered via intravitreal application.
- a further aspect according to the current invention is a nucleic acid molecule encoding a heavy and/or light chain of a bispecific antibody as reported herein.
- the invention further provides expression vectors containing the nucleic acid as reported herein capable of expressing the nucleic acid in a prokaryotic or eukaryotic host cell, and host cells containing such vectors for the recombinant production of a bispecific antibody as reported herein.
- the invention further comprises a prokaryotic or eukaryotic host cell comprising a vector as reported herein.
- the invention further comprises a method for the production of a bispecific antibody as reported herein, characterized by expressing a nucleic acid as reported herein in a prokaryotic or eukaryotic host cell and recovering the bispecific antibody from the cell or the cell culture supernatant.
- a method for the preparation of a bispecific antibody as reported herein comprising the steps of
- the invention further comprises the antibody obtained by such method for the production of a bispecific antibody.
- the antibodies as reported herein have highly valuable properties due to their specific modifications in the Fc-region causing a benefit for a patient suffering from ocular vascular diseases. They show high stability in the intravitreal environment and slow diffusion from the eye (compared to smaller antibody fragments without a constant heavy chain region), where the actual disease is located and treated (so treatment schedule may potentially be improved compared to non-IgG like antibodies like e.g. Fab and (Fab)2 fragments).
- the antibodies as reported herein are cleared on the other hand quite rapidly from serum (which is highly desired to reduce potential side effects arising from systemic exposure).
- the antibodies as reported herein show a lower aggregation tendency (see Figure 4) during storage (compared to versions without the combination of the mutations 1253 A, H310A and H435A in the Fc-region) which is critical for intravitreal application in the eye (as an aggregation in the eye can lead to complications during such treatment).
- bispecific antibodies as reported herein show good efficacy in inhibition of vascular diseases.
- the bispecific antibodies as reported herein due to their specific modifications in the constant region e.g. P329G LALA
- the bispecific antibody as reported herein is bivalent.
- the bispecific, bivalent antibody as reported herein is characterized in comprising
- This bispecific, bivalent antibody format for the bispecific antibody specifically binding to human vascular endothelial growth factor (VEGF) and human angiopoietin-2 (ANG-2) is described in WO 2009/080253 (including knobs-into- holes modified CH3 domains).
- the antibodies based on this bispecific, bivalent antibody format are named CrossMabs.
- bispecific, bivalent antibody is characterized in comprising
- bispecific, bivalent antibody is characterized in comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 34 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 36, and
- bispecific, bivalent antibody is characterized in comprising
- bispecific, bivalent antibody is characterized in comprising
- bispecific, bivalent antibody is characterized in comprising
- such bispecific, bivalent antibody is characterized in comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 92 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 44, and
- bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 38, of SEQ
- bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 34, of SEQ
- bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 42, of SEQ
- bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 90, of SEQ
- bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 88, of SEQ
- one aspect as reported herein is a bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 92, of SEQ ID NO: 93, of SEQ ID NO: 44, and of SEQ ID NO: 45.
- This bispecific, bivalent antibody format for this bispecific antibody specifically binding to human vascular endothelial growth factor (VEGF) and human angiopoietin-2 (ANG-2) is described in WO 2011/117330 (including knobs-into- holes modified CH3 domains).
- the antibodies based on this bispecific, bivalent antibody format are named one-armed single chain Fabs (OAscFabs).
- bispecific, bivalent antibody is characterized in comprising
- bispecific, bivalent antibody is characterized in comprising
- bispecific, bivalent antibody is characterized in comprising
- bispecific, bivalent antibody is characterized in comprising
- the antibody heavy chain variable domain (VH) and the antibody light chain variable domain (VL) of the heavy and light chain of the second full length antibody are further stabilized by the introduction of a disulfide bond between the following positions: heavy chain variable domain position 44 and light chain variable domain position 100 (numbering according to Kabat (Kabat, E.A., et al, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991)). Techniques to introduce disulfide bridges for stabilization are described e.g. in WO 94/029350, Rajagopal, V., et al, Prot. Eng. 10 (1997) 1453-1459, Kobayashi et al, Nuclear
- one aspect as reported herein is a bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 46, of SEQ ID NO: 47, and of SEQ ID NO: 48.
- one aspect as reported herein is a bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 49, of SEQ ID NO: 50, and of SEQ ID NO: 51.
- one aspect as reported herein is a bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 94, of SEQ ID NO: 95, and of SEQ ID NO: 48.
- one aspect as reported herein is a bispecific, bivalent antibody comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in comprising the amino acid sequences of SEQ ID NO: 96, of SEQ ID NO: 97, and of SEQ ID NO: 51.
- the CH3 domains of the bispecific, bivalent antibody as reported herein are altered by the "knob-into-holes" technology which is described in detail with several examples e.g. in WO 96/027011, Ridgway J.B., et al, Protein Eng. 9 (1996) 617-621, and Merchant, A.M., et al, Nat. Biotechnol. 16 (1998) 677- 681.
- the interaction surfaces of the two CH3 domains are altered to increase the heterodimerization of both heavy chains containing these two CH3 domains.
- Each of the two CH3 domains (of the two heavy chains) can be the
- the bispecific antibodies is characterized in that the CH3 domain of one heavy chain and the CH3 domain of the other heavy chain each meet at an interface which comprises an original interface between the antibody CH3 domains, wherein the interface is altered to promote the formation of the bispecific antibody, wherein the alteration is characterized in that: a) the CH3 domain of one heavy chain is altered, so that within the original interface the CH3 domain of one heavy chain that meets the original interface of the CH3 domain of the other heavy chain within the bispecific antibody an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the interface of the CH3 domain of one heavy chain which is positionable in a cavity within the interface of the CH3 domain of the other heavy chain, and b) the CH3 domain of the other heavy chain is altered, so that within the original interface of the second CH3 domain that meets the original interface of the first CH3 domain within the bispecific antibody an amino acid residue is replaced with an amino acid residue having a smaller side chain volume
- the antibody according to invention is in one preferred embodiment characterized in that the CH3 domain of the heavy chain of the full length antibody of a) and the CH3 domain of the heavy chain of the full length antibody of b) each meet at an interface which comprises an alteration in the original interface between the antibody's CH3 domains, wherein i) in the CH3 domain of one heavy chain an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the interface of the CH3 domain of one heavy chain which is positionable in a cavity within the interface of the CH3 domain of the other heavy chain, and wherein ii) in the CH3 domain of the other heavy chain an amino acid residue is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the interface of the second CH3 domain within which a protuberance within the interface of the first CH3 domain is positionable.
- the amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenyl-
- amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), valine (V).
- both CH3 domains are further altered by the introduction of a cysteine residue (C) in the corresponding positions of each CH3 domain such that a disulfide bridge between both CH3 domains can be formed.
- C cysteine residue
- the bispecific antibody comprises a T366W mutation in the CH3 domain of the "knobs chain” and the T366S, L368A and Y407V mutations in the CH3 domain of the "hole chain”.
- An additional interchain disulfide bridge between the CH3 domains can also be used (Merchant, A.M, et al., Nature Biotech 16 (1998) 677-681) e.g. by introducing a Y349C or S354C mutation into the CH3 domain of the "knobs chain” and a Y439C or E356C or S354C mutation into the CH3 domain of the "hole chain”.
- the bispecific antibody as reported herein comprises the mutation Y349C or S354C and the mutation T366W in one of the two CH3 domains and the mutations S354C or E356C or Y349C and the mutations T366S, L368A and Y407V in the other of the two CH3 domains.
- the bispecific antibody comprises the Y349C, T366W mutations in one of the two CH3 domains and the S354C, T366S, L368A, Y407V mutations in the other of the two CH3 domains (the additional Y349C mutation in one CH3 domain and the additional S354C mutation in the other CH3 domain forming a interchain disulfide bridge) (numbering according to EU index of Kabat (Kabat, E.A., et al, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991)).
- the bispecific antibody comprises the S354C, T366W mutations in one of the two CH3 domains and the Y349C, T366S, L368A, Y407V mutations in the other of the two CH3 domains (the additional Y349C mutation in one CH3 domain and the additional S354C mutation in the other CH3 domain forming a interchain disulfide bridge) (numbering according to EU index of Kabat (Kabat, E.A., et al, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991)).
- knobs-in-holes technologies as described by EP 1 870 459 Al, can be used alternatively or additionally.
- the bispecific antibody are the R409D and K370E mutations in the CH3 domain of the "knobs chain” and the D399K and E357K mutations in the CH3 domain of the "hole chain” (numbering according to EU index of Kabat (Kabat, E.A., et al., Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, National Institutes of Health, Bethesda, MD (1991)).
- the bispecific antibody comprises a T366W mutation in the CH3 domain of the "knobs chain” and the T366S, L368A and Y407V mutations in the CH3 domain of the "hole chain” and additionally the R409D, K370E mutations in the CH3 domain of the "knobs chain” and the D399K, E357K mutations in the
- the bispecific antibody comprises the Y349C, T366W mutations in one of the two CH3 domains and the S354C, T366S, L368A and Y407V mutations in the other of the two CH3 domains, or the bispecific antibody comprises the Y349C, T366W mutations in one of the two CH3 domains and the
- the bispecific antibody comprises the S354C, T366W mutations in one of the two CH3 domains and the Y349C, T366S, L368A, Y407V mutations in the other of the two CH3 domains, or the bispecific antibody comprises the S354C, T366W mutations in one of the two CH3 domains and the Y349C, T366S, L368A and Y407V mutations in the other of the two CH3 domains and additionally the R409D, K370E mutations in the CH3 domain of the "knobs chain” and the D399K, E357K mutations in the CH3 domain of the "hole chain”.
- the bispecific antibody as reported herein is characterized in having one or more of the following properties: - shows a lower serum concentration compared to a corresponding bispecific antibody without the mutations described under iii) (96 hours after intravitreal application in mice, which are mouse FcRn deficient, but hemizygous transgenic for human FcRn) (determined in an assays as described in Example 6),
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- the bispecific, bivalent antibody is characterized in comprising a first Fc-region polypeptide and a second Fc-region polypeptide wherein a) the first and the second Fc-region polypeptide comprise the mutation Y436A, or b) the first and the second Fc-region polypeptide comprise the mutations 1253 A, H310A and H435A, or c) the first and the second Fc-region polypeptide comprise the mutations H310A, H433A and Y436A, or d) the first and the second Fc-region polypeptide comprise the mutations L251D, L314D and L432D, or e) the first and the second Fc-region polypeptide comprise the mutations L251S, L314S and L432S, or f) the first Fc-region polypeptide comprises the mutation Y436A and the second Fc-region polypeptide comprises
- the first Fc-region polypeptide comprises the mutations 1253 A, H310A and H435A and the second Fc-region polypeptide comprises
- the first Fc-region polypeptide comprises the mutations H310A, H433A and Y436A and the second Fc-region polypeptide comprises
- L314D and L432D and the second Fc-region polypeptide comprises
- the bispecific antibody comprises an Fc-region comprising a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (i.e. derived from human origin), which comprise one or two of the mutations selected from i) the group 1253 A, H310A, H435A, or ii) the group H310A, H433A, Y436A, or iii) the group L251D, L314D, L432D, or iv) the group L251S, L314S, L432S (numbering according to Kabat EU index numbering system) in the first Fc-region polypeptide and one or two of the mutations selected from the group comprising the mutations L251D, L251S, I253A, H310A, L314D, L314S, L432D, L432S, H433A, H435A and Y436A (numbering according to Kabat EU index
- the bispecific antibody comprises an Fc-region comprising a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (i.e. derived from human origin), which comprise the mutations I253A/H310A/H435A or H310A/H433A/Y436A or L251D/L314D/L432D or L251S/L314S/L432S or combinations thereof in the Fc-region (numbering according to Kabat EU index numbering system), whereby either all mutations are in the first or the second Fc-region polypeptide, or one or two mutations are in the first Fc-region polypeptide and one or two mutations are in the second Fc-region polypeptide so that all of the mutations in the first and the second Fc-region polypeptide when taken together result in that the mutations i) 1253 A, H310A and H435A, or ii) H310A, H433A and
- the bispecific, bivalent antibody is characterized in comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in that i) the first antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 20, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 21, and ii) the second antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 28, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 29, and iii) the bispecific antibody comprises an Fc-region comprising a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (i.e.
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn (determined in assays as described in Example 6),
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- iii mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- the bispecific, bivalent antibody is characterized in comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, characterized in that i) the first antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 20, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 21, and ii) the second antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 28, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 29, and iii) the bispecific antibody comprises a first Fc-region polypeptide and a second Fc-region polypeptide wherein a) the first and the second Fc-region polypeptide comprise the mutation Y436A, or b) the first and the second Fc-region polypeptide comprise the mutations 1253 A, H310A and H4
- the first Fc-region polypeptide comprises the mutations 1253 A, H310A and H435A and the second Fc-region polypeptide comprises
- the first Fc-region polypeptide comprises the mutations H310A, H433A and Y436A and the second Fc-region polypeptide comprises
- the first Fc-region polypeptide comprises the mutations L251D, L314D and L432D and the second Fc-region polypeptide comprises
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn (determined in assays as described in Example 6),
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- iii mice, which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- the bispecific antibody is characterized in comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen- binding site that specifically binds to human ANG-2, characterized in that i) the first antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 20 with 1, 2 or 3 amino acid substitutions, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 21 with 1, 2 or 3 amino acid substitutions, and ii) the second antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 28 with 1, 2 or 3 amino acid substitutions, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 29 with 1, 2 or 3 amino acid substitutions, and iii) the bispecific antibody comprises an Fc-region comprising a first and a second Fc-region polypeptide both of human IgGl or human IgG4 subclass (i.e
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn (determined in assays as described in Example 6),
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- iii mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- the bispecific antibody is characterized in comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen- binding site that specifically binds to human ANG-2, characterized in that i) the first antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 20 with 1, 2 or 3 amino acid substitutions, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 21 with 1, 2 or 3 amino acid substitutions, and ii) the second antigen-binding site comprises as heavy chain variable domain (VH) the amino acid sequence of SEQ ID NO: 28 with 1, 2 or 3 amino acid substitutions, and as light chain variable domain (VL) the amino acid sequence of SEQ ID NO: 29 with 1, 2 or 3 amino acid substitutions, and iii) the bispecific antibody comprises a first Fc-region polypeptide and a second Fc-region polypeptide wherein a) the first and the second Fc-region polypeptide comprise the
- the first Fc-region polypeptide comprises the mutations 1253 A, H310A and H435A and the second Fc-region polypeptide comprises
- the first Fc-region polypeptide comprises the mutations H310A, H433A and Y436A and the second Fc-region polypeptide comprises
- the mutations L251D, L314D and L432D or b) the mutations L251S, L314S and L432S, or i) the first Fc-region polypeptide comprises the mutations L251D, L314D and L432D and the second Fc-region polypeptide comprises
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn (determined in assays as described in Example 6),
- mice which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- iii mice, which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye
- An antigen-binding site of the bispecific antibody as reported herein contains six complementarity determining regions (CDRs) which contribute in varying degrees to the affinity of the binding site for its antigen. There are three heavy chain variable domain CDRs (CDRHl, CDRH2 and CDRH3) and three light chain variable domain CDRs (CDRLl, CDRL2 and CDRL3).
- CDRHl, CDRH2 and CDRH3 three heavy chain variable domain CDRs
- CDRLl, CDRL2 and CDRL3 three light chain variable domain CDRs
- the extent of CDR and framework regions (FRs) is determined by comparison to a compiled database of amino acid sequences in which those regions have been defined according to variability among the sequences.
- the antibody does not specifically bind to the human FcRn.
- the antibody in addition does specifically bind to Staphylococcal protein A.
- the antibody does not specifically bind to the human FcRn. In one embodiment of all aspects the antibody in addition does not specifically bind to Staphylococcal protein A
- the first polypeptide further comprises the mutations Y349C, T366S, L368A and Y407V contemplathole") and the second polypeptide comprises the mutations S354C and T366W disorderknob"). In one embodiment of all aspects the first polypeptide further comprises the mutations S354C, T366S, L368A and Y407V contemplathole") and the second polypeptide comprises the mutations Y349C and T366W disorderknob").
- the Fc-region polypeptides are of the human IgGl subclass. In one embodiment the first Fc-region polypeptide and the second Fc- region polypeptide further comprise the mutations L234A and L235A. In one embodiment the first Fc-region polypeptide and the second Fc-region polypeptide further comprise the mutation P329G.
- the Fc-region polypeptides are of the human IgG4 subclass. In one embodiment the first Fc-region polypeptide and the second Fc- region polypeptide further comprise the mutations S228P and L235E. In one embodiment the first Fc-region polypeptide and the second Fc-region polypeptide further comprise the mutation P329G.
- the antibody as reported herein is produced by recombinant means.
- one aspect as reported herein is a nucleic acid encoding the antibody as reported herein and a further aspect is a cell comprising the nucleic acid encoding an antibody as reported herein.
- Methods for recombinant production are widely known in the state of the art and comprise protein expression in prokaryotic and eukaryotic cells with subsequent isolation of the antibody and usually purification to a pharmaceutically acceptable purity.
- nucleic acids encoding the respective (modified) light and heavy chains are inserted into expression vectors by standard methods.
- one aspect as reported herein is a method for the preparation of a bispecific antibody as reported herein, comprising the steps of
- the recovering step under c) includes the use of a light chain constant domain specific capture reagent (which e.g. specific for the kappa or the lambda constant light chain, depending on whether a kappa or a lambda light chain is contained in the bispecific antibody).
- this light chain specific capture reagent is used in in a bind-and-elute-mode.
- Examples of such light chain constant domain specific capture reagents are e.g. KappaSelectTM and LambdaFabSelectTM (available from GE Healthcare/BAC), which are based on a highly rigid agarose base matrix that allows high flow rates and low back pressure at large scale.
- These materials contain a ligand that binds to the constant region of the kappa or the lambda light chain, respectively (i.e. fragments lacking the constant region of the light chain will not bind; Figure 1). Both are therefore capable of binding other target molecules containing the constant region of the light chain, for example, IgG, IgA and IgM.
- the ligands are attached to the matrix via a long hydrophilic spacer arm to make them easily available for binding to the target molecule. They are based on a single-chain antibody fragment that is screened for either human Ig kappa or lambda.
- the recovering step under c) includes the use of an Fc-region specific capture reagent.
- the Fc-region specific capture reagent is used in a bind-and-elute-mode.
- Fc-region specific capture reagents are e.g. Staphylococcus protein A-based affinity chromatography materials.
- the bispecific antibodies are suitably separated from the culture medium by conventional immunoglobulin purification procedures such as, for example, affinity chromatography (protein A-Sepharose, or KappaSelectTM, LambdaFabSelectTM), hydroxylapatite chromatography, gel electrophoresis, or dialysis.
- DNA and R A encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures.
- B-cells or hybridoma cells can serve as a source of such DNA and RNA.
- the DNA may be inserted into expression vectors, which are then transfected into host cells such as HEK 293 cells, CHO cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of recombinant monoclonal antibodies in the host cells.
- Some of the molecules as reported herein provide ease of isolation/purification by comprising Fc-regions that are differentially modified, wherein at least one of the modifications results in i) a differential affinity of the molecule for (Staphylococcal) protein A and ii) a differential affinity of the molecule for the human FcRn, and the molecule is isolable from a disrupted cell, from medium, or from a mixture of molecules based on its affinity for protein A.
- Purification of antibodies is performed in order to eliminate cellular components or other contaminants, e.g. other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis, and others well known in the art (see e.g. Ausubel, F., et al, ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987)).
- Different methods are well established and widespread used for protein purification, such as affinity chromatography with microbial proteins (e.g. protein A or protein G affinity chromatography), ion exchange chromatography (e.g.
- cation exchange (carboxymethyl resins), anion exchange (amino ethyl resins) and mixed-mode exchange), thiophilic adsorption (e.g. with beta-mercaptoethanol and other SH ligands), hydrophobic interaction or aromatic adsorption chromatography (e.g. with phenyl-sepharose, aza-arenophilic resins, or m-aminophenylboronic acid), metal chelate affinity chromatography (e.g.
- the bivalent bispecific antibody against human VEGF and human ANG-2 as reported herein may have a valuable efficacy/safety profile and may provide benefits for a patient in the need of an anti-VEGF and anti- ANG-2 therapy.
- a pharmaceutical formulation comprising an antibody as reported herein.
- Another aspect as reported herein is the use of an antibody as reported herein for the manufacture of a pharmaceutical formulation.
- a further aspect as reported herein is a method for the manufacture of a pharmaceutical formulation comprising an antibody as reported herein.
- a formulation is provided, e.g. a pharmaceutical formulation, containing an antibody as reported herein, formulated together with a pharmaceutical carrier.
- a formulation of the present invention can be administered by a variety of methods known in the art. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. To administer a compound as reported herein by certain routes of administration, it may be necessary to coat the compound with, or co-administer the compound with a material to prevent its inactivation.
- the compound may be administered to a subject in an appropriate carrier, for example, liposomes, or a diluent.
- Pharmaceutically acceptable diluents include saline and aqueous buffer solutions.
- Pharmaceutical carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. The use of such media and agents for pharmaceutically active substances is known in the art.
- the application is intraocular and includes, but it's not limited to, subconjunctival injection, intracanieral injection, injection into the anterior chamber via the termporai limbus, intrastromal injection, intracorneal injection, subretinal injection, aqueous humor injection, subtenon injection or sustained delivery device, intravitreal injection (e.g., front, mid or back vitreal injection).
- the application is topical and includes, but it's not limited to eye drops to the cornea.
- the bispecific antibody or pharmaceutical formulation as reported herein is administered via intravitreal application, e.g. via intravitreal injection.
- intravitreal application e.g. via intravitreal injection.
- This can be performed in accordance with standard procedures known in the art (see, e.g., Ritter et al, J. Clin. Invest. 116 (2006) 3266-3276, Russelakis- Carneiro et al, Neuropathol. Appl. Neurobiol. 25 (1999) 196-206, and Wray et al, Arch. Neurol. 33 (1976) 183-185).
- therapeutic kits as reported herein can contain one or more doses of a (bispecific) antibody present in a pharmaceutical formulation described herein, a suitable device for intravitreal injection of the pharmaceutical formulation, and an instruction detailing suitable subjects and protocols for carrying out the injection.
- the formulations are typically administered to the subject in need of treatment via intravitreal injection. This can be performed in accordance with standard procedures known in the art (see, e.g., Ritter et al., J. Clin. Invest. 116 (2006) 3266-3276, Russelakis-Carneiro et al., Neuropathol. Appl. Neurobiol. 25 (1999) 196-206, and Wray et al, Arch. Neurol. 33 (1976) 183-185).
- the formulations may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures, supra, and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol, sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the formulations. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- the compounds as reported herein which may be used in a suitable hydrated form, and/or the pharmaceutical formulations as reported herein, are formulated into pharmaceutically acceptable dosage forms by conventional methods known to those of skill in the art.
- Actual dosage levels of the active ingredients in the pharmaceutical formulations as reported herein may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, formulation, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular formulations employed, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular formulations employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- the formulation must be sterile and fluid to the extent that the formulation is deliverable by syringe.
- the carrier preferably is an isotonic buffered saline solution.
- Proper fluidity can be maintained, for example, by use of coating such as lecithin, by maintenance of required particle size in the case of dispersion and by use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol or sorbitol, and sodium chloride in the formulation.
- the formulation can comprise an ophthalmic depot formulation comprising an active agent for subconjunctival administration.
- the ophthalmic depot formulation comprises microparticles of essentially pure active agent, e.g., the bispecific antibody as reported herein.
- the microparticles comprising the bispecific antibody as reported herein can be embedded in a biocompatible pharmaceutically acceptable polymer or a lipid encapsulating agent.
- the depot formulations may be adapted to release all of substantially all the active material over an extended period of time.
- the polymer or lipid matrix if present, may be adapted to degrade sufficiently to be transported from the site of administration after release of all or substantially all the active agent.
- the depot formulation can be liquid formulation, comprising a pharmaceutical acceptable polymer and a dissolved or dispersed active agent. Upon injection, the polymer forms a depot at the injections site, e.g. by gelifying or precipitating.
- Another aspect as reported herein is the bispecific antibody as reported herein for use in the treatment of ocular vascular diseases.
- Another aspect as reported herein is the pharmaceutical formulation as reported herein for use in the treatment of ocular vascular diseases.
- Another aspect as reported herein is the use of an antibody as reported herein for the manufacture of a medicament for the treatment of ocular vascular disease.
- Another aspect as reported herein is method of treatment of patient suffering from ocular vascular diseases by administering an antibody as reported herein to a patient in the need of such treatment.
- the term “comprising” as used herein comprises the term “consisting of.
- all aspects and embodiments that contain the term “comprising” are likewise disclosed with the term “consisting of.
- an antibody according to any of the above embodiments may incorporate any of the features, singly or in combination, as described in Sections 1-6 below:
- an antibody provided herein has a dissociation constant (Kd) of ⁇ 100 nM, ⁇ 10 nM (e.g. 10 ⁇ 7 M or less, e.g. from 10 ⁇ 7 M to 10 "13 M, e.g., from 10 "8 M to 10 "13 M).
- Kd dissociation constant
- Kd is measured using a BIACORE ® surface plasmon resonance assay.
- a BIACORE ® surface plasmon resonance assay For example, an assay using a BIACORE -2000 or a BIACORE ® -3000 (GE Healthcare Inc., Piscataway, NJ) is performed at 25 °C with immobilized antigen CM5 chips at ⁇ 10 response units (RU).
- CM5 carboxymethylated dextran biosensor chips
- EDC N-ethyl-N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
- NHS N-hydroxysuccinimide
- Antigen is diluted with 10 mM sodium acetate, pH 4.8, to 5 ⁇ g/mL ( ⁇ 0.2 ⁇ ) before injection at a flow rate of 5 ⁇ / ⁇ to achieve approximately 10 response units (RU) of coupled protein.
- 1 M ethanolamine is injected to block non-reacted groups.
- two-fold serial dilutions of Fab (0.78 nM to 500 nM) are injected in PBS with 0.05 % polysorbate 20 (TWEEN-20TM) surfactant (PBST) at 25 °C at a flow rate of approximately 25 ⁇ / ⁇ .
- association rates (k on ) and dissociation rates (k 0 ff) are calculated using a simple one-to-one Langmuir binding model (BIACORE Evaluation Software version 3.2) by simultaneously fitting the association and dissociation sensorgrams.
- the equilibrium dissociation constant (Kd) is calculated as the ratio k off /k on (see, e.g., Chen, Y. et al, J. Mol. Biol. 293 (1999) 865-881).
- an antibody provided herein is a chimeric antibody.
- chimeric antibodies are described, e.g., in US 4,816,567; and Morrison, S.L., et al., Proc. Natl. Acad. Sci. USA 81 (1984) 6851-6855).
- a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region.
- a chimeric antibody is a "class switched" antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
- a chimeric antibody is a humanized antibody.
- a non-human antibody is humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
- a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody, and FRs (or portions thereof) are derived from human antibody sequences.
- HVRs e.g., CDRs, (or portions thereof) are derived from a non-human antibody
- FRs or portions thereof
- a humanized antibody optionally will also comprise at least a portion of a human constant region.
- some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity.
- a non-human antibody e.g., the antibody from which the HVR residues are derived
- Humanized antibodies and methods of making them are reviewed, e.g., in
- Human framework regions that may be used for humanization include but are not limited to: framework regions selected using the "best- fit” method (see, e.g., Sims, M.J., et al., J. Immunol.
- framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions see, e.g., Carter, P., et al, Proc. Natl. Acad. Sci. USA
- an antibody provided herein is a human antibody.
- Human antibodies can be produced using various techniques known in the art. Human antibodies are described generally in van Dijk, M.A. and van de Winkel, J.G., Curr.
- Human antibodies maybe prepared by administering an immunogen to a transgenic animal that has been modified to produce intact human antibodies or intact antibodies with human variable regions in response to antigenic challenge.
- Such animals typically contain all or a portion of the human immunoglobulin loci, which replace the endogenous immunoglobulin loci, or which are present extrachromosomally or integrated randomly into the animal's chromosomes. In such transgenic mice, the endogenous immunoglobulin loci have generally been inactivated.
- Human variable regions from intact antibodies generated by such animals may be further modified, e.g., by combining with a different human constant region.
- Human antibodies can also be made by hybridoma-based methods. Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described (see, e.g., Kozbor, D., J. Immunol. 133 (1984) 3001-3005; Brodeur, B.R., et al, Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York (1987), pp. 51-63; and Boerner, P., et al., J. Immunol. 147 (1991) 86-95). Human antibodies generated via human B-cell hybridoma technology are also described in Li, J.et al Proc. Natl. Acad. Sci.
- Human antibodies may also be generated by isolating Fv clone variable domain sequences selected from human-derived phage display libraries. Such variable domain sequences may then be combined with a desired human constant domain. Techniques for selecting human antibodies from antibody libraries are described below.
- Antibodies as reported herein may be isolated by screening combinatorial libraries for antibodies with the desired activity or activities. For example, a variety of methods are known in the art for generating phage display libraries and screening such libraries for antibodies possessing the desired binding characteristics. Such methods are reviewed, e.g., in Hoogenboom, H.R. et al, Methods in Molecular Biology 178 (2001) 1-37 and further described, e.g., in the McCafferty, J. et al,
- repertoires of VH and VL genes are separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be screened for antigen-binding phage as described in Winter, G., et al, Ann. Rev. Immunol. 12 (1994) 433-455.
- Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments.
- Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
- naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths, A.D., et al, EMBO J. 12 (1993) 725-734.
- naive libraries can also be made synthetically by cloning non-rearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom, H.R. and Winter, G., J. Mol. Biol. 227 (1992) 381-388.
- Patent publications describing human antibody phage libraries include, for example: US 5,750,373, and US 2005/0079574, US 2005/0119455, US 2005/0266000, US 2007/0117126, US 2007/0160598, US 2007/0237764, US 2007/0292936, and US 2009/0002360.
- Antibodies or antibody fragments isolated from human antibody libraries are considered human antibodies or human antibody fragments herein.
- an antibody provided herein is a multispecific antibody, e.g. a bispecific antibody.
- Multispecific antibodies are monoclonal antibodies that have binding specificities for at least two different sites.
- Bispecific antibodies may also be used to localize cytotoxic agents to cells which express one or more of the target antigens.
- Bispecific antibodies can be prepared as full length antibodies or antibody fragments. Techniques for making multispecific antibodies include, but are not limited to, recombinant co-expression of two immunoglobulin heavy chain-light chain pairs having different specificities (see Milstein, C. and Cuello, A.C., Nature 305 (1983) 537-540, WO 93/08829, and Traunecker, A., et al, EMBO J.
- Multi-specific antibodies may also be made by engineering electrostatic steering effects for making antibody Fc-heterodimeric molecules (WO 2009/089004); cross-linking two or more antibodies or fragments (see, e.g., US 4,676,980, and Brennan, M. et al, Science 229 (1985) 81-83); using leucine zippers to produce bi-specific antibodies (see, e.g., Kostelny, S.A., et al, J. Immunol.
- the antibody or fragment herein also includes a "Dual Acting Fab” or “DAF” comprising an antigen binding site that binds to a first antigen as well as another, different antigen (see, US 2008/0069820, for example).
- the antibody or fragment herein also includes multispecific antibodies described in WO 2009/080251, WO 2009/080252, WO 2009/080253, WO 2009/080254, WO 2010/112193, WO 2010/115589, WO 2010/136172, WO 2010/145792, and WO 2010/145793.
- amino acid sequence variants of the antibodies provided herein are contemplated.
- Amino acid sequence variants of an antibody may be prepared by introducing appropriate modifications into the nucleotide sequence encoding the antibody, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution can be made to arrive at the final construct, provided that the final construct possesses the desired characteristics, e.g., antigen-binding. a) Substitution, Insertion, and Deletion Variants
- antibody variants having one or more amino acid substitutions are provided.
- Sites of interest for substitutional mutagenesis include the HVRs and FRs.
- Conservative substitutions are shown in the Table below under the heading of "preferred substitutions”. More substantial changes are provided in the following Table under the heading of "exemplary substitutions", and as further described below in reference to amino acid side chain classes.
- Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
- Amino acids may be grouped according to common side-chain properties:
- substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
- a parent antibody e.g. a humanized or human antibody
- the resulting variant(s) selected for further study will have modifications (e.g., improvements) in certain biological properties (e.g., increased affinity, reduced immunogenicity) relative to the parent antibody and/or will have substantially retained certain biological properties of the parent antibody.
- An exemplary substitutional variant is an affinity matured antibody, which may be conveniently generated, e.g., using phage display-based affinity maturation techniques such as those described herein. Briefly, one or more HVR residues are mutated and the variant antibodies displayed on phage and screened for a particular biological activity (e.g. binding affinity).
- Alterations may be made in HVRs, e.g., to improve antibody affinity. Such alterations may be made in HVR "hotspots," i.e., residues encoded by codons that undergo mutation at high frequency during the somatic maturation process (see, e.g., Chowdhury, P.S., Methods Mol. Biol. 207 (2008) 179-196), and/or residues that contact antigen, with the resulting variant VH or VL being tested for binding affinity.
- Affinity maturation by constructing and reselecting from secondary libraries has been described, e.g., in Hoogenboom, H.R. et al. in Methods in Molecular Biology 178 (2002) 1-37.
- variable genes chosen for maturation are introduced into the variable genes chosen for maturation by any of a variety of methods (e.g., error-prone PCR, chain shuffling, or oligonucleotide-directed mutagenesis).
- a secondary library is then created. The library is then screened to identify any antibody variants with the desired affinity.
- Another method to introduce diversity involves HVR-directed approaches, in which several HVR residues (e.g., 4-6 residues at a time) are randomized. HVR residues involved in antigen binding may be specifically identified, e.g., using alanine scanning mutagenesis or modeling. CDR-H3 and CDR-L3 in particular are often targeted.
- substitutions, insertions, or deletions may occur within one or more HVRs so long as such alterations do not substantially reduce the ability of the antibody to bind antigen.
- conservative alterations e.g., conservative substitutions as provided herein
- Such alterations may, for example, be outside of antigen contacting residues in the HVRs.
- each HVR either is unaltered, or contains no more than one, two or three amino acid substitutions.
- a useful method for identification of residues or regions of an antibody that may be targeted for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham, B.C. and Wells, J.A., Science 244 (1989) 1081-1085.
- a residue or group of target residues e.g., charged residues such as arg, asp, his, lys, and glu
- a neutral or negatively charged amino acid e.g., alanine or polyalanine
- a crystal structure of an antigen- antibody complex to identify contact points between the antibody and antigen can be used. Such contact residues and neighboring residues may be targeted or eliminated as candidates for substitution. Variants may be screened to determine whether they contain the desired properties.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue.
- Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g. for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- an antibody provided herein is altered to increase or decrease the extent to which the antibody is glycosylated.
- Addition or deletion of glycosylation sites to an antibody may be conveniently accomplished by altering the amino acid sequence such that one or more glycosylation sites is created or removed.
- the antibody comprises an Fc-region
- the carbohydrate attached thereto may be altered.
- Native antibodies produced by mammalian cells typically comprise a branched, biantennary oligosaccharide that is generally attached by an N-linkage to Asn297 of the CH2 domain of the Fc-region. See, e.g., Wright, A. and Morrison, S.L., TIBTECH 15 (1997) 26-32.
- the oligosaccharide may include various carbohydrates, e.g., mannose, N-acetyl glucosamine (GlcNAc), galactose, and sialic acid, as well as a fucose attached to a GlcNAc in the "stem" of the biantennary oligosaccharide structure.
- modifications of the oligosaccharide in an antibody as reported herein may be made in order to create antibody variants with certain improved properties.
- antibody variants having a carbohydrate structure that lacks fucose attached (directly or indirectly) to an Fc-region.
- the amount of fucose in such antibody may be from 1 % to 80 %, from 1 % to 65 %, from 5 % to 65 % or from 20 % to 40 %.
- the amount of fucose is determined by calculating the average amount of fucose within the sugar chain at Asn297, relative to the sum of all glycostructures attached to Asn 297 (e. g. complex, hybrid and high mannose structures) as measured by MALDI-TOF mass spectrometry, as described in WO 2008/077546, for example.
- Asn297 refers to the asparagine residue located at about position 297 in the Fc-region (EU numbering of Fc-region residues); however, Asn297 may also be located about ⁇ 3 amino acids upstream or downstream of position 297, i.e., between positions 294 and 300, due to minor sequence variations in antibodies.
- Such fucosylation variants may have improved ADCC function. See, e.g., US 2003/0157108; US 2004/0093621.
- Examples of publications related to "defucosylated” or "fucose-deficient" antibody variants include: US 2003/0157108; WO 2000/61739; WO 2001/29246; US 2003/0115614;
- Antibodies variants are further provided with bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to the Fc-region of the antibody is bisected by GlcNAc. Such antibody variants may have reduced fucosylation and/or improved ADCC function. Examples of such antibody variants are described, e.g., in WO 2003/011878; US 6,602,684; and US 2005/0123546. Antibody variants with at least one galactose residue in the oligosaccharide attached to the Fc-region are also provided. Such antibody variants may have improved CDC function. Such antibody variants are described, e.g., in WO 1997/30087; WO 1998/58964; and WO 1999/22764. c) Fc-region variants
- one or more further amino acid modifications may be introduced into the Fc-region of an antibody provided herein, thereby generating an Fc-region variant.
- the Fc-region variant may comprise a human Fc-region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc-region) comprising an amino acid modification (e.g. a substitution/mutation) at one or more amino acid positions.
- the invention contemplates an antibody variant that possesses some but not all effector functions, which make it a desirable candidate for applications in which the half-life of the antibody in vivo is important yet certain effector functions (such as CDC and ADCC) are unnecessary or deleterious.
- Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
- FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch, J.V. and Kinet, J.P., Annu. Rev. Immunol. 9 (1991) 457-492.
- Non-limiting examples of in vitro assays to assess ADCC activity of a molecule of interest are described in US 5,500,362 (see, e.g. Hellstrom, I. et al, Proc. Natl. Acad. Sci. USA 83 (1986) 7059-7063; and Hellstrom, I. et al, Proc. Natl. Acad. Sci. USA 82 (1985) 1499-1502); US 5,821,337 (see Bruggemann, M. et al, J. Exp. Med. 166 (1987) 1351-1361).
- non-radioactive assays methods may be employed (see, for example, ACTITM non-radioactive cytotoxicity assay for flow cytometry (CellTechnology, Inc. Mountain View, CA; and CytoTox 96 ® non-radioactive cytotoxicity assay (Promega, Madison, WI).
- Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes, R. et al., Proc. Natl. Acad. Sci. USA 95 (1998) 652-656.
- Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity. See, e.g., Clq and C3c binding ELISA in WO 2006/029879 and WO 2005/100402.
- a CDC assay may be performed (see, for example, Gazzano-Santoro, H. et al, J. Immunol. Methods 202 (1996) 163-171; Cragg, M.S. et al, Blood 101 (2003) 1045-1052; and Cragg, M.S. and M.J. Glennie, Blood 103
- FcRn binding and in vivo clearance/half-life determinations can also be performed using methods known in the art (see, e.g., Petkova, S.B. et al, Int. Immunol. 18 (2006) 1759-1769).
- Antibodies with reduced effector function include those with substitution of one or more of Fc-region residues 238, 265, 269, 270, 297, 327 and 329 (US 6,737,056).
- Fc-region variants include Fc-regions with substitutions at two or more of amino acid positions 265, 269, 270, 297 and 327, including the so-called "DANA" Fc-region mutant with substitution of residues 265 and 297 to alanine (US 7,332,581).
- DANA "DANA" Fc-region mutant with substitution of residues 265 and 297 to alanine
- Certain antibody variants with improved or diminished binding to FcRs are described (see, e.g., US 6,737,056; WO 2004/056312, and Shields, R.L. et al, J. Biol. Chem. 276 (2001) 6591-6604).
- an antibody variant comprises an Fc-region with one or more amino acid substitutions which improve ADCC, e.g., substitutions at positions 298, 333, and/or 334 of the Fc-region (EU numbering of residues).
- alterations are made in the Fc-region that result in altered (i.e., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in US 6,194,551, WO 99/51642, and Idusogie, E.E. et al, J. Immunol. 164 (2000) 4178-4184.
- Fc-region variants include those with substitutions at one or more of Fc-region residues: 238, 256, 265, 272, 286, 303, 305, 307, 311, 312, 317, 340, 356, 360, 362, 376, 378, 380, 382, 413, 424 or 434, e.g., substitution of Fc-region residue 434 (US 7,371,826). See also Duncan, A.R. and Winter, G., Nature 322 (1988) 738-740; US 5,648,260;
- cysteine engineered antibodies e.g., "thioMAbs”
- one or more residues of an antibody are substituted with cysteine residues.
- the substituted residues occur at accessible sites of the antibody.
- reactive thiol groups are thereby positioned at accessible sites of the antibody and may be used to conjugate the antibody to other moieties, such as drug moieties or linker-drug moieties, to create an immunoconjugate, as described further herein.
- any one or more of the following residues may be substituted with cysteine: V205 (Kabat numbering) of the light chain; Al 18 (EU numbering) of the heavy chain; and S400 (EU numbering) of the heavy chain Fc-region.
- Cysteine engineered antibodies may be generated as described, e.g., in US 7,521,541.
- an antibody provided herein may be further modified to contain additional non-proteinaceous moieties that are known in the art and readily available.
- the moieties suitable for derivatization of the antibody include but are not limited to water soluble polymers.
- water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-l,3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide copolymers, polyoxyethylated polyols (e.g.,
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or non-branched.
- the number of polymers attached to the antibody may vary, and if more than one polymer is attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
- conjugates of an antibody and non-proteinaceous moiety that may be selectively heated by exposure to radiation are provided.
- the non-proteinaceous moiety is a carbon nanotube (Kam, N.W. et al., Proc. Natl. Acad. Sci. USA 102 (2005) 11600-11605).
- the radiation may be of any wavelength, and includes, but is not limited to, wavelengths that do not harm ordinary cells, but which heat the non-proteinaceous moiety to a temperature at which cells proximal to the antibody-non-proteinaceous moiety are killed.
- Heterodimerization There exist several approaches for CH3 -modifications to enforce the heterodimerization, which are well described e.g.
- the first CH3 domain and the second CH3 domains are both engineered in a complementary manner so that each CH3 domain (or the heavy chain comprising it) cannot longer homodimerize with itself but is forced to heterodimerize with the complementary engineered other CH3 domain ( so that the first and second CH3 domain heterodimerize and no homodimers between the two first or the two second CH3 domains are formed).
- These different approaches for improved heavy chain heterodimerization are contemplated as different alternatives in combination with the heavy -light chain modifications (VH and VL exchange/replacement in one binding arm and the introduction of substitutions of charged amino acids with opposite charges in the CH1/CL interface) in the multispecific antibodies according to the invention which reduce light chain mispairing an Bence- Jones type side products.
- the CH3 domains of said multispecific antibody according to the invention can be altered by the "knob-into- holes" technology which is described in detail with several examples in e.g. WO 96/027011, Ridgway, J.B., et al, Protein Eng. 9 (1996) 617-621; and Merchant, A.M., et al, Nat. Biotechnol. 16 (1998) 677-681; WO 98/ 050431(.
- the interaction surfaces of the two CH3 domains are altered to increase the heterodimerization of both heavy chains containing these two CH3 domains.
- Each of the two CH3 domains (of the two heavy chains) can be the "knob", while the other is the "hole”.
- the introduction of a disulfide bridge further stabilizes the heterodimers (Merchant, A.M., et al, Nature Biotech. 16 (1998) 677-681; Atwell, S., et al, J. Mol. Biol. 270 (1997) 26-35) and increases the yield.
- said multispecific antibody (comprises a CH3 domain in each heavy chain and) is further characterized in that the first CH3 domain of the first heavy chain of the antibody under a) and the second CH3 domain of the second heavy chain of the antibody under b) each meet at an interface which comprises an original interface between the antibody CH3 domains.
- said interface is altered to promote the formation of the multispecific antibody, wherein the alteration is characterized in that:
- the CH3 domain of one heavy chain is altered, so that within the original interface of the CH3 domain of one heavy chain that meets the original interface of the CH3 domain of the other heavy chain within the multispecific antibody, an amino acid residue is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the interface of the CH3 domain of one heavy chain which is positionable in a cavity within the interface of the CH3 domain of the other heavy chain
- the CH3 domain of the other heavy chain is altered, so that within the original interface of the second CH3 domain that meets the original interface of the first CH3 domain within the multispecific antibody
- an amino acid residue is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the interface of the second CH3 domain within which a protuberance within the interface of the first CH3 domain is positionable.
- amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), tryptophan (W).
- amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), valine (V).
- both CH3 domains are further altered by the introduction of cysteine (C) as amino acid in the corresponding positions of each CH3 domain such that a disulfide bridge between both CH3 domains can be formed.
- C cysteine
- said multispecific antibody comprises a amino acid T366W mutation in the first CH3 domain of the "knobs chain” and amino acid T366S, L368A, Y407V mutations in the second CH3 domain of the "hole chain”.
- An additional interchain disulfide bridge between the CH3 domains can also be used (Merchant, A.M., et al, Nature Biotech. 16 (1998) 677-681) e.g. by introducing an amino acid Y349C mutation into the CH3 domain of the "hole chain” and an amino acid E356C mutation or an amino acid S354C mutation into the CH3 domain of the "knobs chain”.
- said multispecific antibody (which comprises a CH3 domain in each heavy chain) comprises amino acid S354C, T366W mutations in one of the two CH3 domains and amino acid Y349C, T366S, L368A, Y407V mutations in the other of the two CH3 domains (the additional amino acid S354C mutation in one CH3 domain and the additional amino acid Y349C mutation in the other CH3 domain forming an interchain disulfide bridge) (numbering according to Kabat).
- R409D K370E mutations in the first CH3 domain of the (of the multispecific antibody) and amino acid D399K; E357K mutations in the seconds CH3 domain of the multispecific antibody (numbering according to Kabat).
- said multispecific antibody comprises a amino acid T366W mutation in the CH3 domain of the "knobs chain” and amino acid T366S, L368A, Y407V mutations in the CH3 domain of the "hole chain” and additionally amino acid R409D; K370E mutations in the CH3 domain of the "knobs chain” and amino acid D399K; E357K mutations in the CH3 domain of the "hole chain”.
- said multispecific antibody comprises amino acid S354C, T366W mutations in one of the two CH3 domains and amino acid Y349C, T366S,
- L368A, Y407V mutations in the other of the two CH3 domains or said multispecific antibody comprises amino acid Y349C, T366W mutations in one of the two CH3 domains and amino acid S354C, T366S, L368A, Y407V mutations in the other of the two CH3 domains and additionally amino acid R409D; K370E mutations in the CH3 domain of the "knobs chain” and amino acid D399K; E357K mutations in the CH3 domain of the "hole chain”.
- a first CH3 domain comprises amino acid T366K mutation and a second CH3 domain polypeptide comprises amino acid L351D mutation.
- the first CH3 domain comprises further amino acid L351K mutation.
- the second CH3 domain comprises further amino acid mutation selected from Y349E, Y349D and L368E (preferably L368E).
- a first CH3 domain comprises amino acid L351Y, Y407A mutations and a second CH3 domain comprises amino acid T366A, K409F mutations.
- the second CH3 domain comprises a further amino acid mutation at position T411, D399, S400, F405, N390, or K392 e.g.
- T411 N selected from a) T411 N, T411 R, T411Q, T411 K, T411D, T411E or T411W, b) D399R, D399W, D399Y or D399K, c S400E, S400D, S400R, or S400K F405I, F405M, F405T, F405S, F405V or F405W N390R, N390K or N390D K392V, K392M, K392R, K392L, K392F or K392E.
- a first CH3 domain comprises amino acid L351Y, Y407A mutations and a second CH3 domain comprises amino acid T366V, K409F mutations.
- a first CH3 domain comprises amino acid Y407A mutations and a second CH3 domain comprises amino acid T366A, K409F mutations.
- the second CH3 domain comprises a further amino acid K392E, T41 IE, D399R and S400R mutations.
- the heterodimerization approach described in WO2011/143545 can be used alternatively e.g. with the amino acid modification at a position selected from the group consisting of 368 and 409.
- a first CH3 domain comprises amino acid
- T366W mutations and a second CH3 domain comprises amino acid Y407A mutations.
- a first CH3 domain comprises amino acid T366Y mutations and a second CH3 domain comprises amino acid Y407T mutations.
- the multispecific antibody is of IgG2 isotype and the heterodimerization approach described in WO2010/129304 can be used alternatively.
- a first CH3 domain comprises amino acid substitution of K392 or N392 with a negative-charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), preferably K392D or N392D) and a second negative-charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), preferably K392D or N392D) and a second negative-charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), preferably K392D or N392D) and a second negative-charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), preferably K392D or N392D) and a second negative-charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), preferably K392D or N392D) and a second negative-charged amino acid (e.g. glutamic acid (E), or aspartic acid
- CH3 domain comprises amino acid substitution of D399, E356, D356, or E357 with a positive-charged amino acid (e.g. Lysine (K) or arginine (R), preferably D399K, E356K, D356K, or E357K and more preferably D399K and E356K.
- the first CH3 domain further comprises amino acid substitution of K409 or R409 with a negative-charged amino acid (e.g. glutamic acid (E), or aspartic acid (D), preferably K409D or R409D).
- the first CH3 domain further or alternatively comprises amino acid substitution of K439 and/or K370 with a negative-charged amino acid (e.g.
- a first CH3 domain comprises amino acid K253E, D282K, and K322D mutations and a second CH3 domain comprises amino acid D239K, E240K, and K292D mutations.
- the heterodimerization approach described in WO2007/110205 can be used alternatively.
- Antibodies may be produced using recombinant methods and formulations, e.g., as described in US 4,816,567.
- isolated nucleic acid(s) encoding an antibody as described herein is(are) provided.
- Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody).
- one or more vectors e.g., expression vectors
- a host cell comprising such nucleic acid is provided.
- a host cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell or lymphoid cell (e.g., Y0, NS0, Sp20 cell).
- a method of making an antibody as reported herein comprises culturing a host cell comprising a nucleic acid encoding the antibody, as provided above, under conditions suitable for expression of the antibody, and optionally recovering the antibody from the host cell (or host cell culture medium).
- nucleic acid encoding the variant Fc-region is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the variant Fc-region polypeptides or heavy and light chains of the antibody).
- Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein.
- antibodies may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- For expression of antibody fragments and polypeptides in bacteria see, e.g., US 5,648,237, US 5,789,199, and US 5,840,523 (see also Charlton, K.A., In:
- the antibody may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized", resulting in the production of an antibody with a partially or fully human glycosylation pattern. See Gerngross, T.U., Nat. Biotech. 22 (2004) 1409-1414; and Li, H. et al, Nat. Biotech. 24 (2006) 210-215.
- Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
- Plant cell cultures can also be utilized as hosts. See, e.g., US 5,959,177, US 6,040,498, US 6,420,548, US 7,125,978, and US 6,417,429 (describing PLANTIBODIESTM technology for producing antibodies in transgenic plants).
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- Other examples of useful mammalian host cell lines are monkey kidney CVl line transformed by SV40 (COS-7); human embryonic kidney line (HEK293 or 293 cells as described, e.g., in Graham, F.L., et al, J. Gen Virol. 36 (1977) 59-74); baby hamster kidney cells (BHK); mouse Sertoli cells (TM4 cells as described, e.g., in Mather, J.P., Biol. Reprod.
- Antibodies provided herein may be identified, screened for, or characterized for their physical/chemical properties and/or biological activities by various assays known in the art.
- an antibody as reported herein is tested for its antigen binding activity, e.g., by known methods such as ELISA, Western Blot, etc.
- Immunoconj ugates The invention also provides immunoconjugates comprising an antibody as reported herein conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
- cytotoxic agents such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
- an immunoconjugate is an antibody-drug conjugate (ADC) in which an antibody is conjugated to one or more drugs, including but not limited to a maytansinoid (see US 5,208,020, US 5,416,064 and EP 0 425 235 Bl); an auristatin such as monomethyl auristatin drug moieties DE and DF (MMAE and MMAF) (see US 5,635,483, US 5,780,588, and US 7,498,298); a dolastatin; a calicheamicin or derivative thereof (see US 5,712,374, US 5,714,586,
- ADC antibody-drug conjugate
- an immunoconjugate comprises an antibody as described herein conjugated to an enzymatically active toxin or fragment thereof, including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes.
- an enzymatically active toxin or fragment thereof including but not limited to diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (
- an immunoconjugate comprises an antibody as described herein conjugated to a radioactive atom to form a radioconjugate.
- a variety of radioactive isotopes are available for the production of radioconjugates. Examples include At 211 , I 131 , I 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu.
- the radioconjugate When used for detection, it may comprise a radioactive atom for scintigraphic studies, for example TC 99m or I 123 , or a spin label for nuclear magnetic resonance (NMR) imaging (also known as magnetic resonance imaging, MRI), such as iodine- 123, iodine-131, indium-I l l, fluorine- 19, carbon- 13 , nitrogen- 15 , oxygen- 17, gadolinium, manganese or iron.
- NMR nuclear magnetic resonance
- Conjugates of an antibody and cytotoxic agent may be made using a variety of bifunctional protein coupling agents such as N-succinimidyl-3-(2-pyridyldithio) propionate (SPDP), succinimidyl-4-(N-maleimidomethyl) cyclohexane-1- carboxylate (SMCC), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HC1), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p- diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as toluene 2,6- diisocyanate), and bis-active fluorine compounds (such as l,
- MX-DTPA 1- isothiocyanatobenzyl-3-methyldiethylene triamine pentaacetic acid
- the linker may be a "cleavable linker" facilitating release of a cytotoxic drug in the cell.
- an acid-labile linker, peptidase-sensitive linker, photolabile linker, dimethyl linker or disulfide-containing linker (Chari, R.V. et al, Cancer Res. 52 (1992) 127-131; US 5,208,020) may be used.
- immuno-conjugates or ADCs herein expressly contemplate, but are not limited to such conjugates prepared with cross-linker reagents including, but not limited to, BMPS, EMCS, GMBS, HBVS, LC-SMCC, MBS, MPBH, SBAP, SIA, SIAB,
- SMCC SMPB
- SMPH sulfo-EMCS
- sulfo-GMBS sulfo-KMUS
- sulfo-MBS sulfo-SIAB
- sulfo-SMCC and sulfo-SMPB
- SVSB succinimidyl-(4- vinylsulfone) benzoate
- any of the antibodies provided herein is useful for detecting the presence of its cognate antigen(s) in a biological sample.
- the term "detecting" as used herein encompasses quantitative or qualitative detection.
- a biological sample comprises a cell or tissue.
- an antibody as reported herein for use in a method of diagnosis or detection is provided.
- Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction.
- labels or moieties that are detected directly such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels
- moieties such as enzymes or ligands
- radioisotopes P, C, I, H, and I include, but are not limited to, the radioisotopes P, C, I, H, and I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (US 4,737,456), luciferin, 2,3- dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, ⁇ - galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxid
- compositions of an antibody as described herein are prepared by mixing such antibody having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences, 16th edition, Osol, A. (ed.) (1980)), in the form of lyophilized formulations or aqueous solutions.
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyl dimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m- cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as poly(vinylpyrrolidone); amino acids such as glycine, glutamine, asparagine, histidine, arg
- sHASEGP soluble neutral-active hyaluronidase glycoproteins
- rhuPH20 HYLENEX®, Baxter International, Inc.
- a sHASEGP is combined with one or more additional glycosaminoglycanases such as chondroitinases.
- Exemplary lyophilized antibody formulations are described in US 6,267,958.
- Aqueous antibody formulations include those described in US 6, 171 ,586 and WO 2006/044908, the latter formulations including a histidine-acetate buffer.
- the formulation herein may also contain more than one active ingredients as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
- Active ingredients may be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methyl methacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macro emulsions.
- colloidal drug delivery systems for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules
- Such techniques are disclosed in Remington's Pharmaceutical Sciences, 16th edition, Osol, A. (ed.) (1980).
- Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
- the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
- an antibody as reported herein for use as a medicament is provided.
- an antibody for use in a method of treatment is provided.
- the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, e.g., as described below.
- An "individual” according to any of the above embodiments is in one preferred embodiment a human.
- the invention provides for the use of an antibody in the manufacture or preparation of a medicament.
- An "individual” according to any of the above embodiments may be a human.
- the invention provides pharmaceutical formulations comprising any of the antibodies provided herein, e.g., for use in any of the above therapeutic methods.
- a pharmaceutical formulation comprises any of the antibodies provided herein and a pharmaceutically acceptable carrier.
- a pharmaceutical formulation comprises any of the antibodies provided herein and at least one additional therapeutic agent, e.g., as described below.
- Antibodies as reported herein can be used either alone or in combination with other agents in a therapy. For instance, an antibody as reported herein may be coadministered with at least one additional therapeutic agent.
- An antibody as reported herein can be administered by any suitable means, including parenteral, intrapulmonary, and intranasal, and, if desired for local treatment, intralesional administration.
- Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration. Dosing can be by any suitable route, e.g. by injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic.
- Various dosing schedules including but not limited to single or multiple administrations over various time- points, bolus administration, and pulse infusion are contemplated herein.
- Antibodies as reported herein would be formulated, dosed, and administered in a fashion consistent with good medical practice. Factors for consideration in this context include the particular disorder being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the agent, the method of administration, the scheduling of administration, and other factors known to medical practitioners.
- the antibody need not be, but is optionally formulated with one or more agents currently used to prevent or treat the disorder in question. The effective amount of such other agents depends on the amount of antibody present in the formulation, the type of disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with administration routes as described herein, or about from 1 to 99 % of the dosages described herein, or in any dosage and by any route that is empirically/clinically determined to be appropriate.
- an antibody as reported herein when used alone or in combination with one or more other additional therapeutic agents, will depend on the type of disease to be treated, the type of antibody, the severity and course of the disease, whether the antibody is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician.
- the antibody is suitably administered to the patient at one time or over a series of treatments.
- about 1 ⁇ g/kg to 15 mg/kg (e.g. 0.5 mg/kg - lO mg/kg) of antibody can be an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion.
- One typical daily dosage might range from about 1 ⁇ g/kg to 100 mg/kg or more, depending on the factors mentioned above. For repeated administrations over several days or longer, depending on the condition, the treatment would generally be sustained until a desired suppression of disease symptoms occurs.
- One exemplary dosage of the antibody would be in the range from about 0.05 mg/kg to about 10 mg/kg.
- one or more doses of about 0.5 mg/kg, 2.0 mg/kg, 4.0 mg/kg or 10 mg/kg (or any combination thereof) may be administered to the patient.
- Such doses may be administered intermittently, e.g. every week or every three weeks (e.g. such that the patient receives from about two to about twenty, or e.g. about six doses of the antibody).
- An initial higher loading dose, followed by one or more lower doses may be administered. The progress of this therapy is easily monitored by conventional techniques and assays.
- an article of manufacture containing materials useful for the treatment, prevention and/or diagnosis of the disorders described above comprises a container and a label or package insert on or associated with the container.
- Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a formulation which is by itself or combined with another formulation effective for treating, preventing and/or diagnosing the condition and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- At least one active agent in the formulation is an antibody as reported herein.
- the label or package insert indicates that the formulation is used for treating the condition of choice.
- the article of manufacture may comprise (a) a first container with a formulation contained therein, wherein the formulation comprises an antibody as reported herein; and (b) a second container with a formulation contained therein, wherein the formulation comprises a further cytotoxic or otherwise therapeutic agent.
- the article of manufacture in this embodiment as reported herein may further comprise a package insert indicating that the formulations can be used to treat a particular condition.
- the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically- acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate- buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, and syringes.
- BWFI bacteriostatic water for injection
- phosphate- buffered saline such as
- any of the above articles of manufacture may include an immunoconjugate as reported herein in place of or in addition to an antibody as reported herein.
- An IgG class Fc-region comprising a first variant Fc-region polypeptide and a second variant Fc-region polypeptide, wherein a) the first variant Fc-region polypeptide is derived from a first parent IgG class Fc-region polypeptide and the second variant Fc-region polypeptide is derived from a second parent IgG class Fc-region polypeptide, whereby the first parent IgG class Fc-region polypeptide is identical to or different from the second parent IgG class Fc-region polypeptide, and b) the first variant Fc-region polypeptide differs from the second variant Fc- region polypeptide in one or more amino acid residues other than those amino acid residues in which the first parent IgG class Fc-region polypeptide differs from the second parent IgG class Fc-region polypeptide, and c) the IgG class Fc-region comprising the first variant Fc-region polypeptide and the second variant Fc-region polypeptide has an affinity to
- the IgG class Fc-region according to any one of embodiments 1 to 3, wherein the affinity of the IgG class Fc-region comprising the first variant Fc-region polypeptide and the second variant Fc-region polypeptide to a human Fc- receptor is increased or reduced by 10 % or more determined by surface plasmon resonance (SPR) compared to that of an IgG class Fc-region comprising the first parent IgG class Fc-region polypeptide of a) and the second parent IgG class Fc-region polypeptide of a).
- SPR surface plasmon resonance
- the second parent IgG class Fc-region polypeptide is selected from the group comprising
- IgG class Fc-region according to any one of embodiments 1 to 6, wherein i) the first parent IgG class Fc-region polypeptide has an amino acid sequence selected from the group comprising SEQ ID NO: 60, 61, 62, 63, 64, 65, 67, 69, 70, 71, 73, 75, 76, 78, 80, 81, 82 and 84,
- the second parent IgG class Fc-region polypeptide has an amino acid sequence selected from the group comprising SEQ ID NO: 60, 61, 62, 63, 64, 66, 68, 69, 70, 72, 74, 75, 76, 77, 79, 81, 83 and 85.
- the IgG class Fc-region according to any one of embodiments 1 to 7, wherein i) the first parent IgG class Fc-region polypeptide is a human IgGl Fc-region polypeptide and the second parent IgG class Fc-region polypeptide is a human IgGl Fc-region polypeptide, or ii) the first parent IgG class Fc-region polypeptide is a human IgGl Fc-region polypeptide with the mutations L234A, L235A and the second parent IgG class Fc-region polypeptide is a human IgGl Fc-region polypeptide with the mutations L234A, L235A, or iii) the first parent IgG class Fc-region polypeptide is a human IgGl Fc-region polypeptide with the mutations L234A, L235A, P329G and the second parent IgG class Fc-region polypeptide is a human IgGl Fc-region polypeptid
- the IgG class Fc-region according to any one of embodiments 1 to 5 and 7, wherein i) the first parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ ID NO: 60 and the second parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ ID NO: 60, or ii) the first parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ ID NO: 64 and the second parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ ID NO: 64, or iii) the first parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ ID NO: 70 and the second parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ ID NO: 70, or iv) the first parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ ID NO: 68 and the second parent IgG class Fc-region polypeptide has the amino acid sequence of SEQ
- the IgG class Fc-region according to any one of embodiments 1 to 9, wherein the first variant Fc-region polypeptide differs from the second variant Fc- region polypeptide in one to eight amino acid residues other than those amino acid residues in which the first parent IgG class Fc-region polypeptide differs from the second parent IgG class Fc-region polypeptide.
- first variant Fc-region polypeptide differs from the second variant Fc-region polypeptide in one or more of the amino acid residues at position 228, 234, 235, 236, 237, 238, 239, 253, 254, 265, 266, 267, 268, 269, 270, 288, 297, 298, 299, 307, 311, 327, 328, 329, 330, 331, 332, 434 and 435 (numbering according to Kabat EU index numbering system).
- first variant Fc-region polypeptide differs from the second variant Fc-region polypeptide in one or more of the amino acid residues at position 233, 236, 265, 297, 329 and 331.
- first variant Fc-region polypeptide differs from the second variant Fc-region polypeptide in one or more of the amino acid residues at position 233, 236, 265, 297, 329 and 331.
- Fc-region polypeptide differs from the second variant Fc-region polypeptide by one or more of the amino acid alterations E233P, AG236, D265A, N297A, N297D, P329A, and P331S.
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to 13, wherein the first variant Fc-region polypeptide differs from the second variant Fc-region polypeptide in one or more of the amino acid residues at position 248, 250, 251, 252, 253, 254, 255, 256, 257, 272, 285, 288, 290, 291, 308, 309, 310, 311, 314, 385, 386, 387, 428, 432, 433, 434, 435 and 436.
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to
- first variant Fc-region polypeptide differs from the second variant Fc-region polypeptide in one or more of the amino acid residues at position 251, 253, 310, 314, 432, 433, 435 and 436.
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to
- the first Fc-region polypeptide differs by one or two of the mutations selected from i) the group 1253 A, H310A and H435A, or ii) the group H310A, H433A and Y436A, or iii) the group L251D, L314D and L432D, or iv) the group L251S, L314S and L432S (numbering according to Kabat EU index numbering system) from the second Fc-region polypeptide and the second Fc-region polypeptide differs by one or two of the mutations selected from the group comprising the mutations L251D, L251S, I253A, H310A, L314D, L314S, L432D, L432S, H433A, H435A and Y436A (numbering according to Kabat EU index numbering system) from the first Fc- region polypeptide so that all of the mutations in the first and the second Fc-
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to 18, wherein the first Fc-region polypeptide differs by one or two of the mutations selected from i) the group 1253 A, H310A and H435A, or ii) the group H310A, H433A and Y436A (numbering according to Kabat EU index numbering system) from the second Fc-region polypeptide and the second Fc- region polypeptide differs by one or two of the mutations selected from the group comprising the mutations 1253 A, H310A, H433A, H435A and Y436A (numbering according to Kabat EU index numbering system) from the first Fc- region polypeptide so that all of the mutations in the first and the second Fc- region polypeptide when taken together result in that the mutations i) 1253 A, H310A and H435A, or ii) H310A, H433A and Y436A are comprised in the
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to 18, comprising the mutations I253A/H310A/H435A or H310A/H433A/Y436A or L251D/L314D/L432D or L251S/L314S/L432S or combinations thereof in the Fc-region (numbering according to Kabat EU index numbering system), whereby i) all mutations are in the first or the second Fc-region polypeptide, or ii) one or two mutations are in the first Fc-region polypeptide and one or two mutations are in the second Fc-region polypeptide so that all of the mutations in the first and the second Fc-region polypeptide when taken together result in that the mutations i) 1253 A, H310A and H435A, or ii) H310A, H433A and Y436A, or iii) L251D, L314D and L432D
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to 18, comprising the mutations I253A/H310A/H435A or H310A/H433A/Y436A or a combination thereof in the Fc-region (numbering according to Kabat EU index numbering system), whereby i) all mutations are in the first or the second Fc-region polypeptide, or ii) one or two mutations are in the first Fc- region polypeptide and one or two mutations are in the second Fc-region polypeptide so that all of the mutations in the first and the second Fc-region polypeptide when taken together result in that the mutations i) 1253 A, H310A and H435A, or ii) H310A, H433A and Y436A are comprised in the Fc-region.
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to 22, wherein the IgG class Fc-region has a reduced binding to Staphylococcus protein A than an IgG class Fc-region comprising the first parent IgG class Fc- region polypeptide of a) and the second parent IgG class Fc-region polypeptide of a).
- the IgG class Fc-region according to any one of embodiments 1 to 3 and 5 to 17, comprising the mutations M252Y/S254T/T256E in the Fc-region (numbering according to Kabat EU index numbering system), whereby i) all mutations are in the first or the second Fc-region polypeptide, or ii) one or two mutations are in the first Fc-region polypeptide and one or two mutations are in the second Fc-region polypeptide so that all of the mutations in the first and the second Fc-region polypeptide when taken together result in that the mutations M252Y/S254T/T256E are comprised in the IgG class Fc-region.
- An antibody comprising the IgG class Fc-region according to any one of embodiments 1 to 24.
- a bispecific, bivalent antibody with abolished FcRn binding comprising a first antigen-binding site that specifically binds to human VEGF and a second antigen-binding site that specifically binds to human ANG-2, wherein a) the first antigen-binding site specifically binding to VEGF comprises in the heavy chain variable domain a CDR3H region of SEQ ID NO: 14, a CDR2H region of SEQ ID NO: 15, and a CDR1H region of SEQ ID NO: 16, and in the light chain variable domain a CDR3L region of SEQ ID NO: 17, a CDR2L region of SEQ ID NO: 18, and a CDR1L region of SEQ ID NO: 19, and ⁇ ) the second antigen-binding site specifically binding to ANG-2 comprises in the heavy chain variable domain a CDR3H region of SEQ ID NO: 22, a CDR2H region of, SEQ ID NO: 23, and a CDR1H region of SEQ ID NO: 24, and in the light chain variable domain
- a bispecific, bivalent antibody with abolished FcRn binding comprising a heavy chain and the light chain of a first full length antibody that specifically binds to VEGF and a modified heavy chain and modified light chain of a second full length antibody that specifically binds to ANG-2, in which the constant domains CL and CHI are replaced by each other, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 38 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 40, and ⁇ ) as modified heavy chain of the second full length antibody the amino acid sequence of SEQ ID NO: 39 and as modified light chain of the second full length antibody the amino acid sequence of SEQ ID NO: 41.
- a bispecific, bivalent antibody with abolished FcRn binding comprising a heavy chain and the light chain of a first full length antibody that specifically binds to VEGF and a modified heavy chain and modified light chain of a second full length antibody that specifically binds to ANG-2, in which the constant domains CL and CHI are replaced by each other, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 34 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 36, and ⁇ ) as modified heavy chain of the second full length antibody the amino acid sequence of SEQ ID NO: 35 and as modified light chain of the second full length antibody the amino acid sequence of SEQ ID NO: 37.
- a bispecific, bivalent antibody with abolished FcRn binding comprising a heavy chain and the light chain of a first full length antibody that specifically binds to VEGF and a modified heavy chain and modified light chain of a second full length antibody that specifically binds to ANG-2, in which the constant domains CL and CHI are replaced by each other, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 42 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 44, and ⁇ ) as modified heavy chain of the second full length antibody the amino acid sequence of SEQ ID NO: 43 and as modified light chain of the second full length antibody the amino acid sequence of SEQ ID NO: 45.
- a bispecific, bivalent antibody with abolished FcRn binding comprising a heavy chain and the light chain of a first full length antibody that specifically binds to VEGF and a modified heavy chain and modified light chain of a second full length antibody that specifically binds to ANG-2, in which the constant domains CL and CHI are replaced by each other, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 90 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 40, and ⁇ ) as modified heavy chain of the second full length antibody the amino acid sequence of SEQ ID NO: 91 and as modified light chain of the second full length antibody the amino acid sequence of SEQ ID NO: 41.
- a bispecific, bivalent antibody with abolished FcRn binding comprising a heavy chain and the light chain of a first full length antibody that specifically binds to VEGF and a modified heavy chain and modified light chain of a second full length antibody that specifically binds to ANG-2, in which the constant domains CL and CHI are replaced by each other, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 88 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 36, and ⁇ ) as modified heavy chain of the second full length antibody the amino acid sequence of SEQ ID NO: 89 and as modified light chain of the second full length antibody the amino acid sequence of SEQ ID NO: 37.
- a bispecific, bivalent antibody with abolished FcRn binding comprising a heavy chain and the light chain of a first full length antibody that specifically binds to VEGF and a modified heavy chain and modified light chain of a second full length antibody that specifically binds to ANG-2, in which the constant domains CL and CHI are replaced by each other, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 92 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 44, and ⁇ ) as modified heavy chain of the second full length antibody the amino acid sequence of SEQ ID NO: 93 and as modified light chain of the second full length antibody the amino acid sequence of SEQ ID NO: 45.
- a bispecific antibody with abolished FcRn binding comprising the heavy chain and the light chain of a first full length antibody that specifically binds to VEGF, and the heavy chain and the light chain of a second full length antibody that specifically binds to ANG-2, wherein the N-terminus of the heavy chain is connected to the C-terminus of the light chain via a peptidic linker, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 46 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 48, and ⁇ ) as heavy chain of the second full length antibody connected to the light chain of the second full length antibody via a peptidic linker the amino acid sequence of SEQ ID NO: 47.
- a bispecific antibody with abolished FcRn binding comprising the heavy chain and the light chain of a first full length antibody that specifically binds to VEGF, and the heavy chain and the light chain of a second full length antibody that specifically binds to ANG-2, wherein the N-terminus of the heavy chain is connected to the C-terminus of the light chain via a peptidic linker, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 49 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 51, and ⁇ ) as heavy chain of the second full length antibody connected to the light chain of the second full length antibody via a peptidic linker the amino acid sequence of SEQ ID NO: 50.
- a bispecific antibody with abolished FcRn binding comprising the heavy chain and the light chain of a first full length antibody that specifically binds to VEGF, and the heavy chain and the light chain of a second full length antibody that specifically binds to ANG-2, wherein the N-terminus of the heavy chain is connected to the C-terminus of the light chain via a peptidic linker, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 94 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 48, and ⁇ ) as heavy chain of the second full length antibody connected to the light chain of the second full length antibody via a peptidic linker the amino acid sequence of SEQ ID NO: 95.
- a bispecific antibody with abolished FcRn binding comprising the heavy chain and the light chain of a first full length antibody that specifically binds to VEGF, and the heavy chain and the light chain of a second full length antibody that specifically binds to ANG-2, wherein the N-terminus of the heavy chain is connected to the C-terminus of the light chain via a peptidic linker, comprising a) as heavy chain of the first full length antibody the amino acid sequence of SEQ ID NO: 96 and as light chain of the first full length antibody the amino acid sequence of SEQ ID NO: 51, and ⁇ ) as heavy chain of the second full length antibody connected to the light chain of the second full length antibody via a peptidic linker the amino acid sequence of SEQ ID NO: 97.
- bispecific antibody according to any one of embodiments 33 to 43, wherein the bispecific antibody comprises the mutations S354C, T366W in one of the two CH3 domains and the mutations Y349C, T366S, L368A, Y407V in the other of the two CH3 domains, or wherein the bispecific antibody comprises the mutations Y349C, T366W in one of the two CH3 domains and the mutations S354C, T366S, L368A, Y407V in the other of the two CH3 domains.
- bispecific antibody according to any one of embodiments 33 to 43, wherein the bispecific antibody comprises the mutations S354C, T366W in one of the two CH3 domains and the mutations Y349C, T366S, L368A, Y407V in the other of the two CH3 domains and the mutations R409D, K370E in the CH3 domain in addition to the mutations Y349C, T366S, L368A, Y407V and the mutations D399K, E357K in the CH3 domain in addition to the mutations S354C, T366W, or wherein the bispecific antibody comprises the mutations Y349C, T366W in one of the two CH3 domains and the mutations S354C, T366S, L368A, Y407V in the other of the two CH3 domains and the mutations R409D, K370E in the CH3 domain in addition to the mutations S354C, T366S, L3
- the bispecific antibody according to any one of embodiments 25 to 45, wherein the antibody has one or more of the following properties: shows a lower serum concentration compared to a corresponding bispecific antibody without the mutations described under iii) (96 hours after intravitreal application in mice, which are mouse FcRn deficient, but hemizygous transgenic for human FcRn), and/or shows a similar (factor 0.8 to 1.2) concentration in whole right eye lysates compared to a corresponding bispecific antibody without the mutations described under iii) (in mice, which are mouse FcRn deficient, but hemizygous transgenic for human FcRn, 96 hours after intravitreal application in the right eye), and/or shows no binding to the human neonatal Fc receptor, and/or shows no binding to Staphylococcal protein A, and/or shows binding to Staphylococcal protein A.
- An Fc-region fusion polypeptide comprising the IgG class Fc-region according to any one of embodiments 1 to 24.
- a pharmaceutical formulation comprising the antibody according to any one of embodiments 25 to 46 or the Fc-region fusion polypeptide according to embodiment 47.
- the antibody according to any one of embodiments 25 to 46 or the Fc-region fusion polypeptide according to embodiment 47 for use as a medicament.
- the use according to embodiment 50 wherein the use is for the treatment of ocular vascular diseases.
- the use of the antibody according to any one of embodiments 25 to 46 or the Fc-region fusion polypeptide according to embodiment 47 in the manufacture of a medicament.
- Protein aliquots (50 ⁇ g) were deglycosylated by adding 0.5 N-Glycanase plus (Roche) and sodium phosphate buffer (0.1 M, pH 7.1) to obtain a final sample volume of 115 ⁇ . The mixture was incubated at 37 °C for 18 h. Afterwards for reduction and denaturing 60 ⁇ ⁇ 0.5 M TCEP (Pierce) in 4 M guanidine * HC1 (Pierce) and 50 8 M guanidine * HC1 were added. The mixture was incubated at
- the FcRn receptor was immobilized onto a BIAcore CM5 -biosensor chip (GE Healthcare Bioscience, Uppsala, Sweden) via amine coupling to a level of 400 Response units (RU).
- the assay was carried out at room temperature with PBS, 0.05 % Tween-20TM pH 6.0 (GE Healthcare Bioscience) as running and dilution buffer. 200 nM of antibody samples were injected at a flow rate of 50 ⁇ / ⁇ at room temperature. Association time was 180 seconds, dissociation phase took 360 seconds.
- Regeneration of the chip surface was reached by a short injection of HBS-P, pH 8.0.
- Evaluation of SPR-data was performed by comparison of the biological response signal height at 180 seconds after injection and at 300 seconds after injection.
- the corresponding parameters are the RU max level (180 seconds after injection) and late stability (300 seconds after end of injection).
- Protein A surface plasmon resonance (SPR) analysis The assay is based on surface plasmon resonance spectroscopy.
- Protein A is immobilized onto the surface of a SPR biosensor.
- the sensor chip By injecting the sample into the flow cells of the SPR spectrometer it forms a complex with the immobilized protein A resulting in an increasing mass on the sensor chip surface, and therefore to a higher response (as 1 RU is defined as 1 pg/mm 2 ).
- the sensor chip is regenerated by dissolving the sample-protein A-complex.
- the gained responses are then evaluated for the signal high in response units (RU) and the dissociation behavior.
- Around 3,500 response units (RU) of protein A (20 ⁇ g/mL) were coupled onto a CM5 chip (GE Healthcare) at pH 4.0 by using the amine coupling kit of GE Healthcare.
- sample and system buffer was HBS-P+ (0.01 M HEPES, 0.15 M NaCl, 0.005 % Surfactant P20 Sterile-filtered, pH 7.4).
- Flow cell temperature was set to
- sample compartment temperature 25 °C and sample compartment temperature to 12 °C.
- the system was primed with running buffer. Then, a 5 nM solutions of the sample constructs were injected for 120 seconds with a flow rate of 30 ⁇ / ⁇ , followed by a 300 seconds dissociation phase. Then the sensor chip surface was regenerated by two 30 seconds long injections of Glycine-HCl pH 1.5 at a flow rate of 30 ⁇ / ⁇ . Each sample was measured as a triplicate.
- ⁇ VEGF-ANG-2> SEQ ID NO: 56, SEQ ID CrossMAb IgGl with NO: 57, SEQ ID NO: 58, P329G LALA mutations SEQ ID NO: 59
- anti-VEGF/ANG2 SEQ ID NO: 90, SEQ ID CrossMab IgGl with NO: 91, SEQ ID NO: 40, HHY-AAA mutations and SEQ ID NO: 41
- anti-VEGF/ANG2 SEQ ID NO: 92, SEQ ID CrossMab IgG4 with NO: 93, SEQ ID NO: 44, HHY-AAA mutations and SEQ ID NO: 45
- the term "with (the) mutation IHH-AAA” as used herein refers to the combination of the mutations I253A (Ile253Ala), H310A (His310Ala), and H435A (His435Ala) in a constant heavy chain region of IgGl or IgG4 subclass (numbering according to EU Index of Kabat),
- the term "with (the) mutation HHY-AAA” as used herein refers the combination of the mutations H310A (His310Ala), H433A (His433Ala) and Y436A (Tyr436Ala) in a constant heavy chain region of IgGl or IgG4 subclass (numbering according to EU Index of Kabat)
- the term "with (the) mutation P329G LALA” as used herein refers to the combination of the mutations L234A (Leu234Ala), L235A (Leu235Ala) and P329G (Pro329Gly) in
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Vascular Medicine (AREA)
- Urology & Nephrology (AREA)
- Ophthalmology & Optometry (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Priority Applications (17)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP21163081.9A EP3878866A1 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
CA2904805A CA2904805A1 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
KR1020157033963A KR102266819B1 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
CN202410625378.4A CN118561989A (en) | 2013-04-29 | 2014-04-25 | Modified asymmetric antibodies to FC-receptor binding and methods of use |
CN201480024044.6A CN105164157B (en) | 2013-04-29 | 2014-04-25 | Modified asymmetric antibodies to FC-receptor binding and methods of use |
PL14719743T PL2992010T3 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
ES14719743T ES2871383T3 (en) | 2013-04-29 | 2014-04-25 | Modified Asymmetric Antibodies Binding to the Fc Receptor and Procedures for Use |
RU2015145719A RU2687043C2 (en) | 2013-04-29 | 2014-04-25 | Fc-RECEPTOR BINDING MODIFIED ASYMMETRIC ANTIBODIES AND METHODS OF USE |
MX2015015060A MX2015015060A (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use. |
EP14719743.8A EP2992010B1 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
JP2016511014A JP6618893B2 (en) | 2013-04-29 | 2014-04-25 | Asymmetric antibodies with altered FC receptor binding and methods of use |
US14/785,900 US20160068613A1 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
US14/927,022 US20160194389A1 (en) | 2013-04-29 | 2015-10-29 | Fc-receptor binding modified asymmetric antibodies and methods of use |
HK16106757.2A HK1218761A1 (en) | 2013-04-29 | 2016-06-13 | Fc-receptor binding modified asymmetric antibodies and methods of use fc- |
US16/422,147 US20200172607A1 (en) | 2013-04-29 | 2019-05-24 | Fc-receptor binding modified asymmetric antibodies and methods of use |
US16/590,938 US20200095310A1 (en) | 2013-04-29 | 2019-10-02 | Fc-receptor binding modified asymmetric antibodies and methods of use |
US17/825,314 US20220324955A1 (en) | 2013-04-29 | 2022-05-26 | Fc-receptor binding modified asymmetric antibodies and methods of use |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP13165725.6 | 2013-04-29 | ||
EP13165725 | 2013-04-29 | ||
EP14151314.3 | 2014-01-15 | ||
EP14151314 | 2014-01-15 |
Related Child Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/785,900 A-371-Of-International US20160068613A1 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
EP21163081.9A Previously-Filed-Application EP3878866A1 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
US14/927,022 Continuation US20160194389A1 (en) | 2013-04-29 | 2015-10-29 | Fc-receptor binding modified asymmetric antibodies and methods of use |
US16/422,147 Continuation US20200172607A1 (en) | 2013-04-29 | 2019-05-24 | Fc-receptor binding modified asymmetric antibodies and methods of use |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2014177459A2 true WO2014177459A2 (en) | 2014-11-06 |
WO2014177459A3 WO2014177459A3 (en) | 2014-12-24 |
Family
ID=50588697
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2014/058416 WO2014177459A2 (en) | 2013-04-29 | 2014-04-25 | Fc-receptor binding modified asymmetric antibodies and methods of use |
Country Status (12)
Country | Link |
---|---|
US (5) | US20160068613A1 (en) |
EP (2) | EP3878866A1 (en) |
JP (3) | JP6618893B2 (en) |
KR (1) | KR102266819B1 (en) |
CN (2) | CN118561989A (en) |
CA (1) | CA2904805A1 (en) |
ES (1) | ES2871383T3 (en) |
HK (1) | HK1218761A1 (en) |
MX (2) | MX2015015060A (en) |
PL (1) | PL2992010T3 (en) |
RU (2) | RU2019108429A (en) |
WO (1) | WO2014177459A2 (en) |
Cited By (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2016071376A3 (en) * | 2014-11-06 | 2016-06-30 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn-binding and methods of use |
WO2017072210A1 (en) * | 2015-10-29 | 2017-05-04 | F. Hoffmann-La Roche Ag | Anti-variant fc-region antibodies and methods of use |
CN107074966A (en) * | 2014-11-06 | 2017-08-18 | 豪夫迈·罗氏有限公司 | The Fc region variants of FCRN and albumin A binding property with change |
WO2019147973A1 (en) * | 2018-01-26 | 2019-08-01 | Genzyme Corporation | Fc variants with enhanced binding to fcrn and prolonged half-life |
WO2019154776A1 (en) * | 2018-02-06 | 2019-08-15 | F. Hoffmann-La Roche Ag | Treatment of ophthalmologic diseases |
RU2698969C2 (en) * | 2014-01-15 | 2019-09-02 | Ф.Хоффманн-Ля Рош Аг | VARIANTS OF Fc-REGION WITH IMPROVED ABILITY TO BIND TO PROTEIN A |
US10669344B2 (en) | 2016-08-12 | 2020-06-02 | Janssen Biotech, Inc. | Engineered antibodies and other Fc-domain containing molecules with enhanced agonism and effector functions |
US11091541B2 (en) | 2013-04-29 | 2021-08-17 | Hoffmann-La Roche Inc. | Human FcRn-binding modified antibodies and methods of use |
US20220064327A1 (en) * | 2018-12-21 | 2022-03-03 | Kymab Limited | Fixaxfx bispecific antibody with common light chain |
US11332541B2 (en) | 2018-06-09 | 2022-05-17 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
RU2795592C2 (en) * | 2018-01-26 | 2023-05-05 | Джензим Корпорейшн | Fc OPTIONS WITH INCREASED FcRn BINDING AND PROLONGED HALF-LIFE |
US11795232B2 (en) | 2017-02-17 | 2023-10-24 | Denali Therapeutics Inc. | Engineered transferrin receptor binding polypeptides |
Families Citing this family (50)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP6618893B2 (en) * | 2013-04-29 | 2019-12-11 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Asymmetric antibodies with altered FC receptor binding and methods of use |
EP3065771B1 (en) | 2013-11-04 | 2019-03-20 | UTI Limited Partnership | Methods and compositions for sustained immunotherapy |
US9840553B2 (en) | 2014-06-28 | 2017-12-12 | Kodiak Sciences Inc. | Dual PDGF/VEGF antagonists |
US12011480B2 (en) | 2015-05-06 | 2024-06-18 | Uti Limited Partnership | Nanoparticle compositions for sustained therapy |
SG10201913625XA (en) | 2015-08-07 | 2020-03-30 | Imaginab Inc | Antigen binding constructs to target molecules |
IL290457B1 (en) | 2015-12-30 | 2024-10-01 | Kodiak Sciences Inc | Antibodies and conjugates thereof |
WO2017165464A1 (en) | 2016-03-21 | 2017-09-28 | Elstar Therapeutics, Inc. | Multispecific and multifunctional molecules and uses thereof |
AU2017292184A1 (en) | 2016-07-08 | 2019-02-07 | Staten Biotechnology B.V. | Anti-Apoc3 antibodies and methods of use thereof |
BR112019002394B1 (en) | 2016-08-10 | 2021-12-21 | Ajou University Industry-Academic Cooperation Foundation | HETERODIMERIC PROTEIN FLUTED WITH CF AND ITS USE |
US11059908B2 (en) * | 2016-09-29 | 2021-07-13 | Amgen Inc. | Low-viscosity antigen binding proteins and methods of making them |
CN108299560B (en) * | 2017-01-13 | 2019-07-19 | 泰州翰中生物医药有限公司 | The monoclonal antibody and its application of anti-PD-1 |
US11266745B2 (en) | 2017-02-08 | 2022-03-08 | Imaginab, Inc. | Extension sequences for diabodies |
WO2018151820A1 (en) | 2017-02-16 | 2018-08-23 | Elstar Therapeutics, Inc. | Multifunctional molecules comprising a trimeric ligand and uses thereof |
JP7337698B2 (en) | 2017-02-28 | 2023-09-04 | シージェン インコーポレイテッド | Cysteine mutated antibodies for conjugation |
MA49270A (en) * | 2017-03-27 | 2020-02-05 | Hoffmann La Roche | ENHANCED ANTIGEN RECEPTORS |
AU2018244574A1 (en) * | 2017-03-28 | 2019-10-31 | Lyvgen Biopharma Holdings Limited | Therapeutic agents and methods for enhancing immune responses in tumor microenvironment |
AU2018255938A1 (en) | 2017-04-21 | 2019-10-31 | Staten Biotechnology B.V. | Anti-ApoC3 antibodies and methods of use thereof |
JP2020522254A (en) | 2017-05-31 | 2020-07-30 | エルスター セラピューティクス, インコーポレイテッド | Multispecific molecules that bind myeloproliferative leukemia (MPL) proteins and uses thereof |
WO2019035938A1 (en) | 2017-08-16 | 2019-02-21 | Elstar Therapeutics, Inc. | Multispecific molecules that bind to bcma and uses thereof |
MX2020004512A (en) | 2017-10-31 | 2020-08-13 | Anti-apoc3 antibodies and methods of use thereof. | |
US10538583B2 (en) | 2017-10-31 | 2020-01-21 | Staten Biotechnology B.V. | Anti-APOC3 antibodies and compositions thereof |
MX2020009152A (en) | 2018-03-02 | 2020-11-09 | Kodiak Sciences Inc | Il-6 antibodies and fusion constructs and conjugates thereof. |
WO2019178362A1 (en) | 2018-03-14 | 2019-09-19 | Elstar Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
WO2019178364A2 (en) | 2018-03-14 | 2019-09-19 | Elstar Therapeutics, Inc. | Multifunctional molecules and uses thereof |
AU2019297451A1 (en) | 2018-07-03 | 2021-01-28 | Marengo Therapeutics, Inc. | Anti-TCR antibody molecules and uses thereof |
JP7529568B2 (en) * | 2018-09-28 | 2024-08-06 | 協和キリン株式会社 | Antibody Compositions |
SG11202104136YA (en) | 2018-10-23 | 2021-05-28 | Dragonfly Therapeutics Inc | Heterodimeric fc-fused proteins |
CN112955240B (en) * | 2018-10-25 | 2022-09-16 | 豪夫迈·罗氏有限公司 | Modification of antibody FcRn binding |
CA3121168A1 (en) * | 2018-11-30 | 2020-06-04 | Memorial Sloan Kettering Cancer Center | Heterodimeric tetravalency and specificity antibody compositions and uses thereof |
CN109870428A (en) * | 2019-01-21 | 2019-06-11 | 江苏华泰疫苗工程技术研究有限公司 | A kind of antibody quantitative detecting method based on surface plasma resonance technology |
AU2020224154A1 (en) | 2019-02-21 | 2021-09-16 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to calreticulin and uses thereof |
WO2020172596A1 (en) | 2019-02-21 | 2020-08-27 | Elstar Therapeutics, Inc. | Anti-tcr antibody molecules and thereof |
AU2020224680A1 (en) | 2019-02-21 | 2021-09-16 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to T cells and uses thereof to treat autoimmune disorders |
JP2022521937A (en) | 2019-02-21 | 2022-04-13 | マレンゴ・セラピューティクス,インコーポレーテッド | Antibody molecules that bind to NKp30 and their use |
JP2022523197A (en) | 2019-02-21 | 2022-04-21 | マレンゴ・セラピューティクス,インコーポレーテッド | Multifunctional molecules that bind to T cell-related cancer cells and their use |
EP3969907A1 (en) * | 2019-05-13 | 2022-03-23 | F. Hoffmann-La Roche AG | Interference-suppressed pharmacokinetic immunoassay |
TWI785360B (en) * | 2019-08-06 | 2022-12-01 | 美商建南德克公司 | Personalized treatment of ophthalmologic diseases |
CA3157509A1 (en) | 2019-10-10 | 2021-04-15 | Kodiak Sciences Inc. | Methods of treating an eye disorder |
CN113121677B (en) * | 2019-12-31 | 2023-06-27 | 周易 | Method for obtaining high-purity heterologous antibody |
WO2021138407A2 (en) | 2020-01-03 | 2021-07-08 | Marengo Therapeutics, Inc. | Multifunctional molecules that bind to cd33 and uses thereof |
TW202140553A (en) | 2020-01-13 | 2021-11-01 | 美商威特拉公司 | Antibody molecules to c5ar1 and uses thereof |
JP7283406B2 (en) | 2020-01-31 | 2023-05-30 | トヨタ自動車株式会社 | vehicle |
JP2023523011A (en) | 2020-04-24 | 2023-06-01 | マレンゴ・セラピューティクス,インコーポレーテッド | Multifunctional molecules that bind to T cell-associated cancer cells and uses thereof |
CN116917316A (en) | 2020-08-26 | 2023-10-20 | 马伦戈治疗公司 | Antibody molecules that bind to NKp30 and uses thereof |
CN116249718A (en) | 2020-08-26 | 2023-06-09 | 马伦戈治疗公司 | Multifunctional molecules binding to calreticulin and uses thereof |
CN116761818A (en) | 2020-08-26 | 2023-09-15 | 马伦戈治疗公司 | Method for detecting TRBC1 or TRBC2 |
MX2023008302A (en) | 2021-01-13 | 2023-09-25 | Visterra Inc | Humanized complement 5a receptor 1 antibodies and methods of use thereof. |
CA3214757A1 (en) | 2021-04-08 | 2022-10-13 | Andreas Loew | Multifuntional molecules binding to tcr and uses thereof |
US20230116446A1 (en) * | 2021-09-21 | 2023-04-13 | Qilu Puget Sound Biotherapeutics Corporation | HETERODIMERIC Fc FOR MAKING FUSION PROTEINS AND BISPECIFIC ANTIBODIES |
CN116162171A (en) * | 2022-10-13 | 2023-05-26 | 深圳市百士通科技开发有限公司 | Use of antibody mutation methods in therapeutic antibody drugs |
Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100158909A1 (en) * | 2006-12-01 | 2010-06-24 | Seattle Genetics, Inc. | Variant Target Binding Agents and Uses Thereof |
WO2010121766A1 (en) * | 2009-04-22 | 2010-10-28 | Merck Patent Gmbh | Antibody fusion proteins with modified fcrn binding sites |
US20100331527A1 (en) * | 2009-06-26 | 2010-12-30 | Regeneron Pharmaceuticals, Inc. | Readily Isolated Bispecific Antibodies with Native Immunoglobulin Format |
US20110054151A1 (en) * | 2009-09-02 | 2011-03-03 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
US20110236388A1 (en) * | 2010-03-26 | 2011-09-29 | Monika Baehner | Bispecific, bivalent anti-vegf/anti-ang-2 antibodies |
WO2012125850A1 (en) * | 2011-03-16 | 2012-09-20 | Amgen Inc. | Fc variants |
US20120321627A1 (en) * | 2008-10-08 | 2012-12-20 | Monika Baehner | Bispecific anti-vegf/anti-ang-2 antibodies |
Family Cites Families (130)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
US4737456A (en) | 1985-05-09 | 1988-04-12 | Syntex (U.S.A.) Inc. | Reducing interference in ligand-receptor binding assays |
US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
WO1988007089A1 (en) | 1987-03-18 | 1988-09-22 | Medical Research Council | Altered antibodies |
US5606040A (en) | 1987-10-30 | 1997-02-25 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group |
US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
CA2026147C (en) | 1989-10-25 | 2006-02-07 | Ravi J. Chari | Cytotoxic agents comprising maytansinoids and their therapeutic use |
US5959177A (en) | 1989-10-27 | 1999-09-28 | The Scripps Research Institute | Transgenic plants expressing assembled secretory antibodies |
US6150584A (en) | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
DK0564531T3 (en) | 1990-12-03 | 1998-09-28 | Genentech Inc | Enrichment procedure for variant proteins with altered binding properties |
WO1992022653A1 (en) | 1991-06-14 | 1992-12-23 | Genentech, Inc. | Method for making humanized antibodies |
US7018809B1 (en) | 1991-09-19 | 2006-03-28 | Genentech, Inc. | Expression of functional antibody fragments |
WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
DE69329503T2 (en) | 1992-11-13 | 2001-05-03 | Idec Pharma Corp | Therapeutic use of chimeric and labeled antibodies directed against a differentiation antigen, the expression of which is restricted to human B lymphocyte, for the treatment of B cell lymphoma |
US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
US5747654A (en) | 1993-06-14 | 1998-05-05 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant disulfide-stabilized polypeptide fragments having binding specificity |
CA2163345A1 (en) | 1993-06-16 | 1994-12-22 | Susan Adrienne Morgan | Antibodies |
US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
US5789199A (en) | 1994-11-03 | 1998-08-04 | Genentech, Inc. | Process for bacterial production of polypeptides |
US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
US5840523A (en) | 1995-03-01 | 1998-11-24 | Genetech, Inc. | Methods and compositions for secretion of heterologous polypeptides |
US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
US6267958B1 (en) | 1995-07-27 | 2001-07-31 | Genentech, Inc. | Protein formulation |
GB9603256D0 (en) | 1996-02-16 | 1996-04-17 | Wellcome Found | Antibodies |
EP0915987A2 (en) | 1997-04-21 | 1999-05-19 | Donlar Corporation | POLY-($g(a)-L-ASPARTIC ACID), POLY-($g(a)-L-GLUTAMIC ACID) AND COPOLYMERS OF L-ASP AND L-GLU, METHOD FOR THEIR PRODUCTION AND THEIR USE |
IL132560A0 (en) | 1997-05-02 | 2001-03-19 | Genentech Inc | A method for making multispecific antibodies having heteromultimeric and common components |
US20020062010A1 (en) | 1997-05-02 | 2002-05-23 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
AU757627B2 (en) | 1997-06-24 | 2003-02-27 | Genentech Inc. | Methods and compositions for galactosylated glycoproteins |
US6040498A (en) | 1998-08-11 | 2000-03-21 | North Caroline State University | Genetically engineered duckweed |
ATE419009T1 (en) | 1997-10-31 | 2009-01-15 | Genentech Inc | METHODS AND COMPOSITIONS CONSISTING OF GLYCOPROTEIN GLYCOFORMS |
US6610833B1 (en) | 1997-11-24 | 2003-08-26 | The Institute For Human Genetics And Biochemistry | Monoclonal human natural antibodies |
WO1999029888A1 (en) | 1997-12-05 | 1999-06-17 | The Scripps Research Institute | Humanization of murine antibody |
US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
DE69937291T2 (en) | 1998-04-02 | 2008-07-10 | Genentech, Inc., South San Francisco | ANTIBODY VARIANTS AND FRAGMENTS THEREOF |
DK2180007T4 (en) | 1998-04-20 | 2017-11-27 | Roche Glycart Ag | Glycosylation technique for antibodies to enhance antibody-dependent cell cytotoxicity |
US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
KR20060067983A (en) | 1999-01-15 | 2006-06-20 | 제넨테크, 인크. | Polypeptide variants with altered effector function |
EP2275541B1 (en) | 1999-04-09 | 2016-03-23 | Kyowa Hakko Kirin Co., Ltd. | Method for controlling the activity of immunologically functional molecule |
PT1222292E (en) | 1999-10-04 | 2005-11-30 | Medicago Inc | METHOD FOR REGULATING THE TRANSCRIPTION OF EXOGENEOUS GENES IN THE PRESENCE OF NITROGEN |
US7125978B1 (en) | 1999-10-04 | 2006-10-24 | Medicago Inc. | Promoter for regulating expression of foreign genes |
US7504256B1 (en) | 1999-10-19 | 2009-03-17 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing polypeptide |
JP2003516755A (en) | 1999-12-15 | 2003-05-20 | ジェネンテック・インコーポレーテッド | Shotgun scanning, a combined method for mapping functional protein epitopes |
DE60031793T2 (en) | 1999-12-29 | 2007-08-23 | Immunogen Inc., Cambridge | DOXORUBICIN AND DAUNORUBICIN-CONTAINING CYTOTOXIC AGENTS AND THEIR THERAPEUTIC USE |
US7449443B2 (en) | 2000-03-23 | 2008-11-11 | California Institute Of Technology | Method for stabilization of proteins using non-natural amino acids |
EP1272647B1 (en) | 2000-04-11 | 2014-11-12 | Genentech, Inc. | Multivalent antibodies and uses therefor |
US6586207B2 (en) | 2000-05-26 | 2003-07-01 | California Institute Of Technology | Overexpression of aminoacyl-tRNA synthetases for efficient production of engineered proteins containing amino acid analogues |
EA013224B1 (en) | 2000-10-06 | 2010-04-30 | Киова Хакко Кирин Ко., Лтд. | Cells producing antibody compositions |
US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
US7064191B2 (en) | 2000-10-06 | 2006-06-20 | Kyowa Hakko Kogyo Co., Ltd. | Process for purifying antibody |
US6596541B2 (en) | 2000-10-31 | 2003-07-22 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
PT1354034E (en) | 2000-11-30 | 2008-02-28 | Medarex Inc | Transgenic transchromosomal rodents for making human antibodies |
DE60237282D1 (en) | 2001-06-28 | 2010-09-23 | Domantis Ltd | DOUBLE-SPECIFIC LIGAND AND ITS USE |
NZ592087A (en) | 2001-08-03 | 2012-11-30 | Roche Glycart Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
AU2002337935B2 (en) | 2001-10-25 | 2008-05-01 | Genentech, Inc. | Glycoprotein compositions |
US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
EP1490677A4 (en) | 2002-02-27 | 2006-01-18 | California Inst Of Techn | Computational method for designing enzymes for incorporation of amino acid analogs into proteins |
AU2003236017B2 (en) | 2002-04-09 | 2009-03-26 | Kyowa Kirin Co., Ltd. | Drug containing antibody composition |
JP4832719B2 (en) | 2002-04-09 | 2011-12-07 | 協和発酵キリン株式会社 | Medicine containing antibody composition for FcγRIIIa polymorphism patients |
EP1498491A4 (en) | 2002-04-09 | 2006-12-13 | Kyowa Hakko Kogyo Kk | METHOD OF ENHANCING ACTIVITY OF ANTIBODY COMPOSITION OF BINDING TO Fc GAMMA RECEPTOR IIIa |
EP1498490A4 (en) | 2002-04-09 | 2006-11-29 | Kyowa Hakko Kogyo Kk | Process for producing antibody composition |
ES2362419T3 (en) | 2002-04-09 | 2011-07-05 | Kyowa Hakko Kirin Co., Ltd. | CELLS WITH DEPRESSION OR DELETION OF THE ACTIVITY OF THE PROTEIN THAT PARTICIPATES IN THE TRANSPORT OF GDP-FUCOSA. |
WO2003085107A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Cells with modified genome |
CA2488441C (en) | 2002-06-03 | 2015-01-27 | Genentech, Inc. | Synthetic antibody phage libraries |
US7361740B2 (en) | 2002-10-15 | 2008-04-22 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
PT1572744E (en) | 2002-12-16 | 2010-09-07 | Genentech Inc | Immunoglobulin variants and uses thereof |
CA2511910A1 (en) | 2002-12-27 | 2004-07-15 | Domantis Limited | Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand |
WO2004065416A2 (en) | 2003-01-16 | 2004-08-05 | Genentech, Inc. | Synthetic antibody phage libraries |
US20060104968A1 (en) | 2003-03-05 | 2006-05-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminogly ycanases |
US7871607B2 (en) | 2003-03-05 | 2011-01-18 | Halozyme, Inc. | Soluble glycosaminoglycanases and methods of preparing and using soluble glycosaminoglycanases |
CN1798767B (en) * | 2003-04-10 | 2011-02-16 | 晶面生物技术公司 | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
EP1688439A4 (en) | 2003-10-08 | 2007-12-19 | Kyowa Hakko Kogyo Kk | Fused protein composition |
SG176455A1 (en) | 2003-10-09 | 2011-12-29 | Ambrx Inc | Polymer derivatives |
EP1705251A4 (en) | 2003-10-09 | 2009-10-28 | Kyowa Hakko Kirin Co Ltd | PROCESS FOR PRODUCING ANTIBODY COMPOSITION BY USING RNA INHIBITING THE FUNCTION OF a1,6-FUCOSYLTRANSFERASE |
SG10202008722QA (en) | 2003-11-05 | 2020-10-29 | Roche Glycart Ag | Cd20 antibodies with increased fc receptor binding affinity and effector function |
BR122018071808B8 (en) | 2003-11-06 | 2020-06-30 | Seattle Genetics Inc | conjugate |
CN101124245A (en) * | 2003-11-12 | 2008-02-13 | 比奥根艾迪克Ma公司 | Neonatal Fc receptor (FcRn)-binding polypeptide variants, dimeric Fc binding proteins and methods related thereto |
WO2005053742A1 (en) | 2003-12-04 | 2005-06-16 | Kyowa Hakko Kogyo Co., Ltd. | Medicine containing antibody composition |
US8906676B2 (en) | 2004-02-02 | 2014-12-09 | Ambrx, Inc. | Modified human four helical bundle polypeptides and their uses |
JP5128935B2 (en) | 2004-03-31 | 2013-01-23 | ジェネンテック, インコーポレイテッド | Humanized anti-TGF-β antibody |
US7785903B2 (en) | 2004-04-09 | 2010-08-31 | Genentech, Inc. | Variable domain library and uses |
EP2360186B1 (en) | 2004-04-13 | 2017-08-30 | F. Hoffmann-La Roche AG | Anti-P-selectin antibodies |
JP2008510466A (en) | 2004-08-19 | 2008-04-10 | ジェネンテック・インコーポレーテッド | Polypeptide variants with altered effector function |
TWI380996B (en) | 2004-09-17 | 2013-01-01 | Hoffmann La Roche | Anti-ox40l antibodies |
CA2580141C (en) | 2004-09-23 | 2013-12-10 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
JO3000B1 (en) | 2004-10-20 | 2016-09-05 | Genentech Inc | Antibody Formulations. |
US8802820B2 (en) * | 2004-11-12 | 2014-08-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
EP3050963B1 (en) | 2005-03-31 | 2019-09-18 | Chugai Seiyaku Kabushiki Kaisha | Process for production of polypeptide by regulation of assembly |
EP1957531B1 (en) | 2005-11-07 | 2016-04-13 | Genentech, Inc. | Binding polypeptides with diversified and consensus vh/vl hypervariable sequences |
US20070237764A1 (en) | 2005-12-02 | 2007-10-11 | Genentech, Inc. | Binding polypeptides with restricted diversity sequences |
JP5474531B2 (en) | 2006-03-24 | 2014-04-16 | メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツング | Engineered heterodimeric protein domains |
JP2009536527A (en) | 2006-05-09 | 2009-10-15 | ジェネンテック・インコーポレーテッド | Binding polypeptide with optimized scaffold |
EP2035456A1 (en) | 2006-06-22 | 2009-03-18 | Novo Nordisk A/S | Production of bispecific antibodies |
WO2008027236A2 (en) | 2006-08-30 | 2008-03-06 | Genentech, Inc. | Multispecific antibodies |
US20100143254A1 (en) * | 2006-10-16 | 2010-06-10 | Medimmune, Llc | Molecules with reduced half-lives, compositions and uses thereof |
US20080226635A1 (en) | 2006-12-22 | 2008-09-18 | Hans Koll | Antibodies against insulin-like growth factor I receptor and uses thereof |
CN100592373C (en) | 2007-05-25 | 2010-02-24 | 群康科技(深圳)有限公司 | Liquid crystal panel drive device and its drive method |
JO3076B1 (en) * | 2007-10-17 | 2017-03-15 | Janssen Alzheimer Immunotherap | Immunotherapy regimes dependent on apoe status |
US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
HUE028536T2 (en) * | 2008-01-07 | 2016-12-28 | Amgen Inc | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
EP2144159A1 (en) * | 2008-07-10 | 2010-01-13 | Siemens Aktiengesellschaft | Method and program network for handling exceptions |
JP5913980B2 (en) * | 2008-10-14 | 2016-05-11 | ジェネンテック, インコーポレイテッド | Immunoglobulin variants and uses thereof |
RU2598248C2 (en) * | 2009-04-02 | 2016-09-20 | Роше Гликарт Аг | Polyspecific antibodies containing antibody of full length and one-chain fragments fab |
PL2417156T3 (en) | 2009-04-07 | 2015-07-31 | Roche Glycart Ag | Trivalent, bispecific antibodies |
EP2424567B1 (en) | 2009-04-27 | 2018-11-21 | OncoMed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
CA2761233A1 (en) | 2009-05-27 | 2010-12-02 | F. Hoffmann-La Roche Ag | Tri- or tetraspecific antibodies |
US9676845B2 (en) | 2009-06-16 | 2017-06-13 | Hoffmann-La Roche, Inc. | Bispecific antigen binding proteins |
US8703132B2 (en) | 2009-06-18 | 2014-04-22 | Hoffmann-La Roche, Inc. | Bispecific, tetravalent antigen binding proteins |
ME02505B (en) | 2009-12-29 | 2017-02-20 | Aptevo Res & Development Llc | Heterodimer binding proteins and uses thereof |
TW201138821A (en) * | 2010-03-26 | 2011-11-16 | Roche Glycart Ag | Bispecific antibodies |
PT2560993T (en) | 2010-04-20 | 2024-09-16 | Genmab As | Heterodimeric antibody fc-containing proteins and methods for production thereof |
JP6022444B2 (en) | 2010-05-14 | 2016-11-09 | ライナット ニューロサイエンス コーポレイション | Heterodimeric protein and method for producing and purifying it |
RS59589B1 (en) | 2010-11-05 | 2019-12-31 | Zymeworks Inc | Stable heterodimeric antibody design with mutations in the fc domain |
HUE041335T2 (en) * | 2011-03-29 | 2019-05-28 | Roche Glycart Ag | Antibody fc variants |
US20140001724A1 (en) * | 2011-09-13 | 2014-01-02 | Behrang Mehrgan | Four and five bar linkage steering mechanism for 3 wheel vehicle and methods for defining the geometry of said vahicle |
EP3674320A3 (en) * | 2011-10-27 | 2020-08-12 | Genmab A/S | Production of heterodimeric proteins |
SI2794905T1 (en) | 2011-12-20 | 2020-08-31 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
AU2013249985B2 (en) | 2012-04-20 | 2017-11-23 | Merus N.V. | Methods and means for the production of Ig-like molecules |
SG10201800492PA (en) * | 2013-04-29 | 2018-03-28 | Hoffmann La Roche | Human fcrn-binding modified antibodies and methods of use |
JP6618893B2 (en) | 2013-04-29 | 2019-12-11 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Asymmetric antibodies with altered FC receptor binding and methods of use |
-
2014
- 2014-04-25 JP JP2016511014A patent/JP6618893B2/en active Active
- 2014-04-25 RU RU2019108429A patent/RU2019108429A/en unknown
- 2014-04-25 WO PCT/EP2014/058416 patent/WO2014177459A2/en active Application Filing
- 2014-04-25 PL PL14719743T patent/PL2992010T3/en unknown
- 2014-04-25 MX MX2015015060A patent/MX2015015060A/en unknown
- 2014-04-25 CN CN202410625378.4A patent/CN118561989A/en active Pending
- 2014-04-25 KR KR1020157033963A patent/KR102266819B1/en active IP Right Grant
- 2014-04-25 US US14/785,900 patent/US20160068613A1/en not_active Abandoned
- 2014-04-25 CA CA2904805A patent/CA2904805A1/en not_active Abandoned
- 2014-04-25 EP EP21163081.9A patent/EP3878866A1/en active Pending
- 2014-04-25 CN CN201480024044.6A patent/CN105164157B/en active Active
- 2014-04-25 ES ES14719743T patent/ES2871383T3/en active Active
- 2014-04-25 EP EP14719743.8A patent/EP2992010B1/en active Active
- 2014-04-25 RU RU2015145719A patent/RU2687043C2/en active
-
2015
- 2015-10-28 MX MX2020003260A patent/MX2020003260A/en unknown
- 2015-10-29 US US14/927,022 patent/US20160194389A1/en not_active Abandoned
-
2016
- 2016-06-13 HK HK16106757.2A patent/HK1218761A1/en unknown
-
2019
- 2019-05-24 US US16/422,147 patent/US20200172607A1/en not_active Abandoned
- 2019-07-26 JP JP2019137374A patent/JP6942162B2/en active Active
- 2019-10-02 US US16/590,938 patent/US20200095310A1/en active Pending
-
2021
- 2021-06-01 JP JP2021092002A patent/JP7240443B2/en active Active
-
2022
- 2022-05-26 US US17/825,314 patent/US20220324955A1/en active Pending
Patent Citations (7)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20100158909A1 (en) * | 2006-12-01 | 2010-06-24 | Seattle Genetics, Inc. | Variant Target Binding Agents and Uses Thereof |
US20120321627A1 (en) * | 2008-10-08 | 2012-12-20 | Monika Baehner | Bispecific anti-vegf/anti-ang-2 antibodies |
WO2010121766A1 (en) * | 2009-04-22 | 2010-10-28 | Merck Patent Gmbh | Antibody fusion proteins with modified fcrn binding sites |
US20100331527A1 (en) * | 2009-06-26 | 2010-12-30 | Regeneron Pharmaceuticals, Inc. | Readily Isolated Bispecific Antibodies with Native Immunoglobulin Format |
US20110054151A1 (en) * | 2009-09-02 | 2011-03-03 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
US20110236388A1 (en) * | 2010-03-26 | 2011-09-29 | Monika Baehner | Bispecific, bivalent anti-vegf/anti-ang-2 antibodies |
WO2012125850A1 (en) * | 2011-03-16 | 2012-09-20 | Amgen Inc. | Fc variants |
Non-Patent Citations (5)
Title |
---|
GILLIES S D ET AL: "Improving the efficacy of antibody-interleukin 2 fusion proteins by reducing their interaction with Fc receptors", CANCER RESEARCH, AMERICAN ASSOCIATION FOR CANCER RESEARCH, US, vol. 59, no. 9, 1 May 1999 (1999-05-01), pages 2159-2166, XP002107035, ISSN: 0008-5472 cited in the application * |
KIM J-K ET AL: "Mapping the site on human IgG for binding of the MHC class I-related receptor, FcRn", EUROPEAN JOURNAL OF IMMUNOLOGY, WILEY - V C H VERLAG GMBH & CO. KGAA, DE, vol. 29, no. 9, 1 September 1999 (1999-09-01), pages 2819-2825, XP002300286, ISSN: 0014-2980, DOI: 10.1002/(SICI)1521-4141(199909)29:09<2819: :AID-IMMU2819>3.0.CO;2-6 cited in the application * |
MARTIN W L ET AL: "Crystal structure at 2.8 ANG of an FcRn/heterodimeric Fc complex: Mechanism of pH-dependent binding", MOLECULAR CELL, CELL PRESS, CAMBRIDGE, MA, US, vol. 7, no. 4, 1 April 2001 (2001-04-01), pages 867-877, XP002305812, ISSN: 1097-2765, DOI: 10.1016/S1097-2765(01)00230-1 * |
S.-W. QIAO ET AL: "Dependence of antibody-mediated presentation of antigen on FcRn", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 105, no. 27, 1 January 2008 (2008-01-01), pages 9337-9342, XP055046753, ISSN: 0027-8424, DOI: 10.1073/pnas.0801717105 cited in the application * |
SHIELDS R L ET AL: "High resolution mapping of the binding site on human IgG1 for FcgammaRI, FcgammaRII, FcgammaRIII, and FcRn and design of IgG1 variants with improved binding to the FcgammaR", JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY, US, vol. 276, no. 9, 2 March 2001 (2001-03-02) , pages 6591-6604, XP002271092, ISSN: 0021-9258, DOI: 10.1074/JBC.M009483200 cited in the application * |
Cited By (23)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US11091541B2 (en) | 2013-04-29 | 2021-08-17 | Hoffmann-La Roche Inc. | Human FcRn-binding modified antibodies and methods of use |
US11555067B2 (en) | 2014-01-15 | 2023-01-17 | Hoffmann-La Roche Inc. | Fc-region variants with improved protein A-binding |
RU2698969C2 (en) * | 2014-01-15 | 2019-09-02 | Ф.Хоффманн-Ля Рош Аг | VARIANTS OF Fc-REGION WITH IMPROVED ABILITY TO BIND TO PROTEIN A |
US10683368B2 (en) | 2014-11-06 | 2020-06-16 | Hoffmann-La Roche Inc. | Fc-region variants with modified FcRn-binding and methods of use |
CN107074966A (en) * | 2014-11-06 | 2017-08-18 | 豪夫迈·罗氏有限公司 | The Fc region variants of FCRN and albumin A binding property with change |
US11440971B2 (en) | 2014-11-06 | 2022-09-13 | Hoffmann-La Roche Inc. | Fc-region variants with modified FcRn-binding and methods of use |
WO2016071376A3 (en) * | 2014-11-06 | 2016-06-30 | F. Hoffmann-La Roche Ag | Fc-region variants with modified fcrn-binding and methods of use |
EP3611188A1 (en) * | 2014-11-06 | 2020-02-19 | F. Hoffmann-La Roche AG | Fc-region variants with modified fcrn-binding and methods of use |
US10899846B2 (en) | 2014-11-06 | 2021-01-26 | Hoffmann-La Roche Inc. | Fc-region variants with modified FcRn- and protein A-binding properties |
EP4015533A1 (en) * | 2015-10-29 | 2022-06-22 | F. Hoffmann-La Roche AG | Anti-variant fc-region antibodies and methods of use |
US10899845B2 (en) | 2015-10-29 | 2021-01-26 | Hoffmann-La Roche Inc. | Anti-variant Fc-region antibodies and method of use |
CN108350066A (en) * | 2015-10-29 | 2018-07-31 | 豪夫迈·罗氏有限公司 | Resistance body Fc domain antibodies and application method |
WO2017072210A1 (en) * | 2015-10-29 | 2017-05-04 | F. Hoffmann-La Roche Ag | Anti-variant fc-region antibodies and methods of use |
US10669344B2 (en) | 2016-08-12 | 2020-06-02 | Janssen Biotech, Inc. | Engineered antibodies and other Fc-domain containing molecules with enhanced agonism and effector functions |
US11912778B2 (en) | 2017-02-17 | 2024-02-27 | Denali Therapeutics Inc. | Methods of engineering transferrin receptor binding polypeptides |
US11795232B2 (en) | 2017-02-17 | 2023-10-24 | Denali Therapeutics Inc. | Engineered transferrin receptor binding polypeptides |
RU2795592C2 (en) * | 2018-01-26 | 2023-05-05 | Джензим Корпорейшн | Fc OPTIONS WITH INCREASED FcRn BINDING AND PROLONGED HALF-LIFE |
WO2019147973A1 (en) * | 2018-01-26 | 2019-08-01 | Genzyme Corporation | Fc variants with enhanced binding to fcrn and prolonged half-life |
IL276383B1 (en) * | 2018-02-06 | 2023-09-01 | Hoffmann La Roche | Treatment of ophthalmologic diseases |
IL276383B2 (en) * | 2018-02-06 | 2024-01-01 | Hoffmann La Roche | Treatment of ophthalmologic diseases |
WO2019154776A1 (en) * | 2018-02-06 | 2019-08-15 | F. Hoffmann-La Roche Ag | Treatment of ophthalmologic diseases |
US11332541B2 (en) | 2018-06-09 | 2022-05-17 | Boehringer Ingelheim International Gmbh | Multi-specific binding proteins for cancer treatment |
US20220064327A1 (en) * | 2018-12-21 | 2022-03-03 | Kymab Limited | Fixaxfx bispecific antibody with common light chain |
Also Published As
Publication number | Publication date |
---|---|
JP6942162B2 (en) | 2021-09-29 |
EP2992010A2 (en) | 2016-03-09 |
US20160194389A1 (en) | 2016-07-07 |
KR102266819B1 (en) | 2021-06-18 |
JP2020015723A (en) | 2020-01-30 |
JP7240443B2 (en) | 2023-03-15 |
US20200095310A1 (en) | 2020-03-26 |
CN105164157A (en) | 2015-12-16 |
RU2019108429A (en) | 2019-05-06 |
CA2904805A1 (en) | 2014-11-06 |
PL2992010T3 (en) | 2021-08-23 |
RU2687043C2 (en) | 2019-05-06 |
JP2021138732A (en) | 2021-09-16 |
HK1218761A1 (en) | 2017-03-10 |
JP2016528166A (en) | 2016-09-15 |
CN118561989A (en) | 2024-08-30 |
US20160068613A1 (en) | 2016-03-10 |
ES2871383T3 (en) | 2021-10-28 |
RU2015145719A (en) | 2017-06-05 |
WO2014177459A3 (en) | 2014-12-24 |
CN105164157B (en) | 2024-05-28 |
US20200172607A1 (en) | 2020-06-04 |
JP6618893B2 (en) | 2019-12-11 |
EP3878866A1 (en) | 2021-09-15 |
MX2020003260A (en) | 2020-07-20 |
US20220324955A1 (en) | 2022-10-13 |
MX2015015060A (en) | 2016-02-25 |
EP2992010B1 (en) | 2021-03-24 |
KR20160003818A (en) | 2016-01-11 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20220324955A1 (en) | Fc-receptor binding modified asymmetric antibodies and methods of use | |
US11440971B2 (en) | Fc-region variants with modified FcRn-binding and methods of use | |
US20240218060A1 (en) | Fc-region variants with modified fcrn-binding properties | |
CA2904806C (en) | Human fcrn-binding modified antibodies and methods of use | |
US20170037153A1 (en) | Fc-region variants with modified fcrn- and maintained protein a-binding properties | |
US20170044246A1 (en) | Fc-region variants with improved protein a-binding |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
WWE | Wipo information: entry into national phase |
Ref document number: 201480024044.6 Country of ref document: CN |
|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14719743 Country of ref document: EP Kind code of ref document: A2 |
|
ENP | Entry into the national phase |
Ref document number: 2904805 Country of ref document: CA |
|
WWE | Wipo information: entry into national phase |
Ref document number: 14785900 Country of ref document: US Ref document number: 2014719743 Country of ref document: EP |
|
ENP | Entry into the national phase |
Ref document number: 2016511014 Country of ref document: JP Kind code of ref document: A |
|
WWE | Wipo information: entry into national phase |
Ref document number: 201480024044.6 Country of ref document: CN Ref document number: MX/A/2015/015060 Country of ref document: MX |
|
ENP | Entry into the national phase |
Ref document number: 20157033963 Country of ref document: KR Kind code of ref document: A |
|
ENP | Entry into the national phase |
Ref document number: 2015145719 Country of ref document: RU Kind code of ref document: A |
|
REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015026590 Country of ref document: BR |
|
ENP | Entry into the national phase |
Ref document number: 112015026590 Country of ref document: BR Kind code of ref document: A2 Effective date: 20151020 |