WO2014167338A1 - Roseburia flagellin and immune modulation - Google Patents

Roseburia flagellin and immune modulation Download PDF

Info

Publication number
WO2014167338A1
WO2014167338A1 PCT/GB2014/051123 GB2014051123W WO2014167338A1 WO 2014167338 A1 WO2014167338 A1 WO 2014167338A1 GB 2014051123 W GB2014051123 W GB 2014051123W WO 2014167338 A1 WO2014167338 A1 WO 2014167338A1
Authority
WO
WIPO (PCT)
Prior art keywords
polynucleotide sequence
vector
host cell
roseburia
including bacteria
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2014/051123
Other languages
French (fr)
Inventor
Denise Kelly
Angela Patterson
Edouard MONNAIS
Imke MULDER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
4D Pharma Research Ltd
Original Assignee
GT Biologics Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to EP14717823.0A priority Critical patent/EP3010523B1/en
Priority to BR112015025854A priority patent/BR112015025854A8/en
Priority to CN201480033216.6A priority patent/CN105407908A/en
Priority to PL17204215T priority patent/PL3318268T3/en
Priority to MEP-2018-55A priority patent/ME03020B/en
Priority to NO14717823A priority patent/NO3010523T3/no
Priority to DK14717823.0T priority patent/DK3010523T3/en
Priority to LTEP14717823.0T priority patent/LT3010523T/en
Priority to HRP20180360TT priority patent/HRP20180360T1/en
Priority to SM20180122T priority patent/SMT201800122T1/en
Priority to RS20180240A priority patent/RS56909B1/en
Priority to MX2015014281A priority patent/MX363015B/en
Priority to RU2015147864A priority patent/RU2682651C2/en
Priority to ES14717823.0T priority patent/ES2660823T3/en
Application filed by GT Biologics Ltd filed Critical GT Biologics Ltd
Priority to HK16111589.6A priority patent/HK1223289B/en
Priority to EP17204215.2A priority patent/EP3318268B1/en
Priority to SI201430604T priority patent/SI3010523T1/en
Priority to PL14717823T priority patent/PL3010523T3/en
Priority to JP2016507061A priority patent/JP6641262B2/en
Publication of WO2014167338A1 publication Critical patent/WO2014167338A1/en
Anticipated expiration legal-status Critical
Priority to CY20181100235T priority patent/CY1120177T1/en
Priority to CY20211101016T priority patent/CY1124805T1/en
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23P—SHAPING OR WORKING OF FOODSTUFFS, NOT FULLY COVERED BY A SINGLE OTHER SUBCLASS
    • A23P10/00—Shaping or working of foodstuffs characterised by the products
    • A23P10/30—Encapsulation of particles, e.g. foodstuff additives
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/164—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/02—Bacterial antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/14—Prodigestives, e.g. acids, enzymes, appetite stimulants, antidyspeptics, tonics, antiflatulents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00—Drugs for disorders of the respiratory system
    • A61P11/02—Nasal agents, e.g. decongestants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00—Drugs for skeletal disorders
    • A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/02—Nutrients, e.g. vitamins, minerals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/04—Anorexiants; Antiobesity agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/08—Antiallergic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00

Definitions

  • the present invention relates to Roseburia flagellins, and/or polynucleotide sequences encoding said Roseburia flagellins, and/or vectors comprising said polynucleotide sequences, and/or host cells, including bacteria, comprising said vectors, and/or host cells, including bacteria, comprising said polynucleotide sequences, for various therapeutic and nutritional uses.
  • the human intestine is thought to be sterile in utero, but is exposed to a large variety of maternal and environmental microbes immediately after birth. Thereafter, a dynamic period of microbial colonization and succession occurs which is influenced by factors such as delivery mode, environment, diet and host genotype, all of which impact upon the composition of the gut microbiota, particularly during early life. Subsequently, the microbiota stabilizes and becomes adult-like (Spor, Koren & Ley 2011).
  • the human gut microbiota contains more than 500-1000 different phylotypes belonging essentially to two major bacterial divisions, the Bacteroidetes and the Firmicutes (Eckburg ei al. 2005).
  • the successful symbiotic relationships arising from bacterial colonization of the human gut have yielded a wide variety of metabolic, structural, protective and other beneficial functions.
  • the enhanced metabolic activities of the colonized gut ensure that otherwise indigestible dietary components are degraded with release of byproducts providing an important nutrient source for the host.
  • the immunological importance of the gut microbiota is well-recognized and is exemplified in germfree animals which have an impaired immune system that is functionally reconstituted following the introduction of commensal bacteria (Macpherson ef al. 2001 , Macpherson, Martinic & Harris 2002, Mazmanian ei al. 2005).
  • Roseburia spp. are dominant in the healthy human gut and are under-represented in IBD patients (Machiels K. er a/. 2013).
  • GenBank Accession Number for 16S rRNA gene strain L1-82: AJ312385 described herein the reference genome sequence is shown in GenBank under accession number ABYJ02000000 (version 2) and consists of sequences ABYJ02000001- ABYJ02000409. STATEMENTS OF INVENTION
  • Roseburia flagellin proteins are important in modulating the immune response.
  • the present inventors surprisingly found that the flagellin proteins derived or derivable from Roseburia hominis or Roseburia intestinalis are important in modulating the immune response.
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in modulating the inflammation of a tissue or an organ (such as the intestine) in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in modulating the production of T cells (e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5) in a subject.
  • T cells e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in restoring immunological tolerance.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the immune system of a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in treating a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
  • the present invention in another aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in modulating dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in a tissue or an organ of a subject.
  • dendritic cells such as bone marrow dendritic cells
  • the present invention in a further aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the production of IL-10 and/ or TGF in a cell or cells of a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A l-E, CD317/BST-2, CD 03, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject.
  • Rosaburia flagellin such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in regulating (e.g.
  • Type I IFN genes such as but not limited to one or more genes selected from the group consisting of IFN- ⁇ , IFN-p3, Ifi202b, Ifi203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 and Irf4 in a cell or cells of a subject.
  • the present invention in a further aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species
  • Roseburia hominis or the bacterial species Roseburia intestinaiis
  • regulating e.g. downregulating
  • the expression of one or more pro-inflammatory genes such as one or more genes selected from the group consisting of but not limited to ILI- ⁇ , IL4, IL5, IL6, IL8, IL12,
  • CXCL12, CXCL13, and TNF-a in a cell or cells of a subject.
  • the present invention in another aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in improving intestinal microbiota in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in regulating appetite in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in regulating (e.g. downregulating) the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
  • Cck cholecystokinin
  • Gcg glucagon
  • the present invention in a further aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in improving alimentary canal health in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention in another aspect, relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and a pharmaceutically acceptable excipient, carrier or diluent.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to a nutritional supplement comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Rosebuna (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and a nutritional acceptable excipient, carrier or diluent.
  • a nutritional supplement comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Rosebuna (such as the bacterial species Roseburi
  • the present invention relates to a feedstuff, food product, dietary supplement, or food additive comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis).
  • a feedstuff, food product, dietary supplement, or food additive comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburi
  • the present invention in a further aspect, relates to a process for producing a pharmaceutical composition according to the present invention, said process comprising admixing a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), with a pharmaceutically acceptable excipient, carrier or diluent; optionally said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell comprising said vector, and/or said host cell comprising said polynucleotide sequence, and/or said Roseburia (such as the bacterial species Roseburia hominis, or
  • the present invention relates to a process for producing a nutritional supplement according to the present invention, said process comprising admixing a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), with a nutritionally acceptable excipient, carrier or diluent; optionally said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell comprising said vector, and/or said host cell comprising said polynucleotide sequence, and/or said Roseburia (such as the bacterial species Roseburia hominis, or the
  • the present invention relates to a method of modulating the inflammation of a tissue or an organ (such as the intestine) in a subject, said method comprising administering to the subject a Roseburia flagellin, or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the inflammation of the tissue or organ (such as the intestine) in the subject is modulated.
  • a Roseburia flagellin or a polynucleotide sequence encoding said Roseburia flagellin
  • a vector comprising said polynucleotide sequence
  • a host cell comprising said vector
  • a host cell comprising said polyn
  • the present invention in another aspect, relates to a method of modulating the production of T cells (e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5) in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the production of T cells (e.g.
  • the present invention in a further aspect, relates to a method of regulating the immune system of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the immune system of the subject is regulated.
  • the present invention relates to a method of treating a disorder in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
  • the present invention relates to a method of modulating dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in the subject are modulated.
  • dendritic cells such as bone marrow dendritic cells
  • epithelial cells in the subject are modulated.
  • the present invention relates to a method of regulating the production of IL-10 and/or TGFp in a cell or cells of a subject, said method comprising administering a Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), to the subject, and wherein the production of IL-10 and/or TGFp in a cell or cells of the subject is regulated.
  • a Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin and/or a vector comprising said polynucleotide sequence
  • a host cell comprising said vector,
  • the present invention in another aspect, relates to a method of regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, I- A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), to the subject, and wherein the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2,
  • the present invention relates to a method of regulating (e.g. downregulating) the expression of one of more Type I IFN genes (such as one or more genes selected from the group consisting of but not limited to IFN- ⁇ , IFN-p3, Ifi202b, lfi ' 203, IFI44, IFTI, MXI, OAS!, OAS2, OAS3, OASL, lr ⁇ 3 and Irf4) in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), wherein the expression of one of more Type
  • the present invention relates to a method of regulating (e.g. downregulating) the expression of one or more pro-inflammatory genes (such as one or more genes selected from the group consisting of but not limited to IL - ⁇ , IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-a in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the group consisting of but not
  • the present invention in a further aspect, relates to a method of improving intestinal microbiota in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the intestinal microbiota in a subject is improved.
  • the present invention relates to a method of regulating appetite in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the appetite in the subject is regulated.
  • the present invention in another aspect relates to a method of regulating (e.g. downregulating) the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of the subject is
  • the present invention relates to a method of improving alimentary canal health in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein alimentary canal health in a subject is improved.
  • the present invention in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for modulating the inflammation of a tissue or an organ (such as the intestine) in a subject.
  • the present invention in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for modulating the production of T cells (e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5) in a subject.
  • T cells e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5
  • the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating the immune system of a subject.
  • Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin
  • a vector comprising said polynucleotide sequence
  • a host cell comprising said vector
  • a host cell comprising said polynucleotide sequence
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for the treatment of a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
  • a Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin
  • a vector comprising said polynucleotide sequence
  • a host cell comprising said vector
  • a host cell comprising said polynucleotide sequence
  • Roseburia such as
  • the present invention in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for modulating dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in a tissue or an organ of a subject.
  • dendritic cells such as bone marrow dendritic cells
  • the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating the production of IL-10 and/or TGF in a cell or cells of a subject.
  • the present invention in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject.
  • Rosaburia flagellin such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating (e.g.
  • Type I IFN genes such as one or more genes selected from the group consisting of but not limited to IFN- ⁇ , IFN-p3, Ifi202b, ⁇ 203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, lr ⁇ 3 and Irf4 in a cell or cells of a subject.
  • the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating (e.g.
  • one or more proinflammatory genes such as one or more genes selected from the group consisting of but not limited to ILI- ⁇ , IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-cc) in a cell or cells of a subject.
  • proinflammatory genes such as one or more genes selected from the group consisting of but not limited to ILI- ⁇ , IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-cc
  • the present invention in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for improving intestinal microbiota in a subject.
  • Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin
  • a vector comprising said polynucleotide sequence
  • a host cell comprising said vector
  • a host cell comprising said polynucleotide sequence
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseb
  • the present invention in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating appetite in a subject.
  • Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin
  • a vector comprising said polynucleotide sequence
  • a host cell comprising said vector
  • a host cell comprising said polynucleotide sequence
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating (e.g. downregulating) the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
  • a Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide
  • the present invention in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for improving alimentary canal health in a subject.
  • the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in medicine.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in restoring immunological tolerance.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for restoring immunological tolerance in a subject.
  • the present invention relates to, in another aspect, a method of restoring immunological tolerance in a subject, said method comprising administering a Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the immunological tolerance in a subject is restored.
  • FIG. 1 Sequence and annotation of R. hominis genome.
  • the complete genome sequence of R. hominis A2-183 was produced. It is represented by a single 3,592,125-bp chromosome with four ribosomal operons, 66 RNAs and 3,273 predicted proteins.
  • the tracks on the genome map, starting at the outer track 0, are: track 0 (blue) - Real-time PCR experiments indicated by numbered tick marks; track 1 (pale blue) - Forward CDS; track 2 (pale blue) - Reverse CDS; track 3 (grey) - rRNA; track 4 (green) - tRNA; track 5 (red) - STS marking regions targeted by Real-time PCR; graph 1 - GC content; graph 2 - GC bias.
  • (B) Functional annotation of the R. hominis genome shows that the largest number of genes belong to Carbohydrates , Protein Metabolism and Amino acids and Derivatives.
  • R. hominis responds to the gut environment by up-regulating motility, mobilization and chemotaxis genes.
  • A Real-time PCR validation of genes involved in conjugation/mobilization transfer.
  • B Real-time PCR validation of genes involved in Motility and Chemotaxis.
  • C Western blot of R.
  • FIG. 1 Colonic T cell markers are significantly induced by R. hominis mono- colonization.
  • B Immunofluorescence analysis of lamina intestinal cells labelled with (i) anti-Ly6G, (ii) anti-CD11b, (iii) anti-CD3, and (iv) anti-CD3 and anti-FoxP3 in ascending colon of GF and R. hominis-treated C3H/HeN mice.
  • C Frequencies of recombinant flagellin (SE, K12, RH1 , RH2) treated Flt3L- and GMCSF- derived dendritic cell populations from conventional C3H/HeN gated on CD 1c+B220+CD317+ cells and CD11c+CD11 b+B220- cells, respectively. Data presented as percentage of total, live and singlet cells, mean ⁇ SEM from three experiments.
  • mice Twenty-two female C57BL/6 mice were used to assess the therapeutic effect of R. hominis during DSS-induced colitis. Treated mice were dosed daily with 10 9 CFU R. hominis for 14 days. From day 8, mice were given DSS in their drinking water for 6 days. The animals were euthanized on day 14 and intestinal tissue sampling was performed.
  • B Histopathology tissue scoring presented as mean percentage of fields of view at a given grade. DSS treatment significantly altered all fields of view at grades 0, 2, 3, and 4. R.
  • R. hominis preferentially colonizes the ascending colon of mono-colonized mice.
  • A R. hominis colonized the ascending colon of the mouse gut with close association of bacteria to the host epithelium, detected by FISH using A2-183 (R. hominis-spedt c probe; FITC), Eub338 (universal 16S probe; Cy3) and DAPI (nuclei; blue). Overlays of A2-183 + Eub338 and Eub338 + DAPI are also shown. The gamma for the red channel was increased in the Eub338 + DAPI overlay to illustrate the labelled bacteria.
  • Figure S2 Gene Ontology analysis performed on genes up-regulated at 28 days in the ascending colon. Gene Ontology (GO) based functional interpretation of the data was performed using DAVID (http://david.abcc.ncifcrf.gov). Significantly different transcripts (P ⁇ 0.05) were allocated into the GO category 'Biological Process' to find significantly enriched GO terms. The GO biological processes for 'actin polymerization' (GO: 0030041) and 'negative regulation of l-kappaB kinase/NF-kappaB cascade' (GO:0043124) were affected. Figure S3. Identification of transcripts differentially expressed in the murine gut after mono-association with E. coli.
  • B Heatmap generated from differentially expressed genes with functional significance in E. co//-colonized mice at 22d vs. 10d.
  • Figure S Identification of transcripts differentially expressed in TLR5KO mouse gut after mono-association with R. hominis.
  • B Heatmap generated from differentially expressed immune-associated genes in ascending colon of R. TLR5KO and wildtype mice at 28d.
  • C Heatmap generated from differentially expressed genes in ileum of R from/ ' n/s-colonized TLR5KO and wildtype mice at 28d.
  • D Heatmap generated from differentially expressed immune-associated genes in ileum of R joAn/>j/s-colonized TLR5KO and wildtype mice at 28d.
  • Figure S5. Gene Ontology analysis performed on genes down -regulated at 28 days in the ascending colon. GO biological processes involved in appetite regulation, such as 'negative regulation of response to food' (GO:0032096), 'negative regulation of appetite' (GO:0032099) and 'regulation of catecholamine secretion' (GO:0050433) were mostly affected.
  • FIG. 6 R. hominis colonization influences satiety genes and body weight. Dry body weight and lipid carcass analysis was performed. (A) Dry carcass weights of R. hominis- associated mice were significantly heavier compared to GF animals. (B) Carcass lipid analysis showed that total adiposity was also significantly higher in R. hominis-ireated animals at 14d. Data is presented as mean ⁇ SD.
  • Figure 1A Representation of the cloning vector pCR-Blunt ll-TOPO used for cloning recombinant flagellins insoluble after cell lysis. It allows high-efficiency DNA cloning of blunt-end PCR products. It encodes Kanamycin and Zeocin resistance genes for selection in E. coli, and the insert is flanked by multiples restriction sites for excision.
  • Figure 2A Representation of the expression vector T7-MAT-Tag-FI_AG- used for cloning recombinant flagellins insoluble after cell lysis.
  • the multi cloning site ( CS) is flanked by MAT (Metal Affinity Tag) sequence and FLAG peptide (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys) sequence, which results in the production of double-tagged flagellin, which can be further purified by affinity columns.
  • This expression vector also encodes a pT7/lac (phage T7 lac operon) promoter for IPTG inducible, high-level expression of MAT-ORF-FLAG recombinant flagellins, an internal lacl gene that represses transcription at basal state in any E. coli host, and an AmpR gene for ampicillin selection.
  • pT7/lac phage T7 lac operon
  • Figure 3A Visualization on a SDS-PAGE of recombinant flagellin cloned with the pCR-Blunt ll-TOPO cloning vector and expressed through the pT7-MAT-Tag-FLAG-2 expression vector. Description of lanes: 1 , protein standard (kDa); 2, RH1 .
  • Figure B1 A and B1 B show an SDS-Analysis of recombinant flagellins.
  • RI2 Roseburia intestinalis Fla 2
  • RI4 Roseburia intestinalis Fla 4
  • Figure C1-C4 Multiple sequence alignment confirming flagellin nucleotide sequence and accession number.
  • Figure D.2 Comparative analysis of CCL20 gene induction by different flagellins.
  • HT-29 and Caco-2 cells were stimulated for 2 hours with a single recombinant flagellin at a concentration of 100 ng/mL
  • Total RNA was extracted and subjected to real time quantitative PCR analysis for the genes CCL20 and ⁇ -actin. Experiments were done in triplicate on three separate occasions.
  • Table D2 indicates significant differences between each treatment calculated with paired t test in HT-29.
  • Figure D Flagellin-mediated chemokine secretion in HT-29 and Caco-2 cells. Tables D3a, D3b, D3c and D3d indicate significant differences between each treatment calculated with paired t test. Figure D4, neutralization of TLR5 with an anti-TLR5 specific antibody.
  • Figure D5A Frequencies of GM-CSF/IL-4 derived dendritic cells stimulated with recombinant flagellins, data shown as fold change compared to unstimulated GM-CSF/IL-4 derived dendritic cells.
  • Figure D5B Frequencies of Flt3L derived dendritic cells stimulated with recombinant flagellins, data shown as fold change compared to unstimulated Flt3L derived dendritic cells.
  • Figure D 6 A and B Flow cytometry analysis of FoxP3+ Tregs in lamina intestinal of BOY/J WT and TLR5KO mice treated with R. hominis.
  • Flagellin is the principal substituent of bacterial flagellum, and is present in large amounts on nearly all flagellated bacteria. Typically, flagellins are globular proteins which arrange into a hollow cylinder to form the filament in bacterial flagellum. The diversity of flagellin structural proteins and gene sequences is well recognized and vary according to bacterial species, geographical and clinical and environmental origins. There are thousands of flagellins and related flagellin genes. Some of the important ones in gut bacteria include the flagellins FLA, FliC, FlgC, FLiE, FlaB, Mo A and FliG.
  • FlaA1 There are several types of FLA (Fla) polypeptides. FlaA1 , FlaA2, FlaA3, FlaA4 and FlaB are examples of FLA polypeptides.
  • polypeptide FlaA1 refers to the flagellin protein FlaA1.
  • polypeptides include the FlaA1 polypeptide of Roseburia hominis, Roseburia proliferationcoia, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans; the polypeptide sequence shown as SEQ ID NO 2 or SEQ ID No 6; and polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to SEQ ID NO 2 or SEQ ID No 6 or variants, homologues, fragments or derivatives thereof.
  • SEQ ID NO 2 has the following sequence:
  • SEQ ID NO 2 is deposited with NCBI under accession number ABI48297.1.
  • polypeptide FlaA1 and “FlaA1 polypeptide” are used interchangeably herein.
  • FlaA1 and “Fla1 polypeptide” are used interchangeably herein.
  • FlaA1 and “RH1” may be used interchangeably herein.
  • the polypeptide FlaA1 has at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to SEQ ID NO 2 or to variants, homologues, fragments or derivatives thereof.
  • the amino acids at positions 79 to 1 17 and positions 408 to 439 as well as 41 , 412, 420 of SEQ ID NO 2 (or equivalent thereof) are considered important.
  • the amino acids at positions 41 1 , 412, 420 of SEQ ID NO 2 (or equivalent thereof) are alanine (A), glutamine (Q) and serine (S) respectively.
  • polypeptide FlaA1 is the polypeptide shown as SEQ ID NO 2 or SEQ ID No 6.
  • FlaA1 polypeptides can be derived from certain microorganisms.
  • the FlaA1 polypeptide is derived from a bacterium such as a Firmicute.
  • the FlaA1 polypeptide is derived from a Roseburia spp such as a Roseburia hominis, Roseburia triocola, Roseburia faecis, Roseburia intestinalis, or Roseburia inulinivorans.
  • Roseburia hominis and Roseburia intestinalis are recently described commensal gut anaerobes of the phylogenetic cluster XlVa within the Firmicutes phylum, belonging to a dominant group of bacteria in the human gut and are also major butyrate producers.
  • Another example is the bacterial species is Roseburia hominis as described in Duncan, S. H., Aminov, R. I. , Scott, K. P., Louis, P., Stanton, T. B., & Flint, H. J. (2006) Int. J. Syst. Evol.
  • Another example is the bacterial species is Roseburia hominis as described in Duncan, S. H., Aminov, R. I., Scott, K. P., Louis, P., Stanton, T. B., & Flint, H. J. (2006) Int. J. Syst. Evol. Microbiol. 56: 2437-2441.
  • polynucleotide sequence encoding the polypeptide FlaA1 refers a polynucleotide sequence encoding the flagellin protein FlaAl . Examples of such polynucleotide sequences include the gene FlaAl of R.
  • SEQ ID NO 1 has the following sequence:
  • the polynucleotide sequence encoding the polypeptide FlaA1 has at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to the polynucleotide sequence shown as SEQ ID NO 1 or SEQ ID No 5 or to variants, homologues, fragments or derivatives thereof.
  • the polynucleotide sequence encoding the polypeptide FlaA1 encodes a polypeptide shown as SEQ ID NO 2 or SEQ ID No 6 or a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to the polypeptide shown as SEQ ID NO 2 or SEQ ID No 6 or to variants, homologues, fragments or derivatives thereof.
  • the polypeptide FlaA1 is a truncated FlaA1 polypeptide.
  • the truncated polypeptide comprises at least 20, 30, 40, 50, 75, 100, 125, 150, 175 or 200 amino acids of polypeptide shown as SEQ ID NO 2 or SEQ ID No 6.
  • amino acids 79-1 17 of SEQ ID NO 2 N-D1 domain
  • amino acids 408-439 of SEQ ID NO 2 C- D1 domain
  • amino acid: A41 1 , Q412, S420 are important amino acids.
  • Examples of truncated FlaA1 polypeptides include: polypeptides which comprise amino acids 79-117 and amino acids 408-439 of SEQ ID NO 2; polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to amino acids 79-117 and amino acids 408-439 of SEQ ID NO 2; polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99%i identity to amino acids 79-117 and amino acids 408-439 of SEQ ID NO 2 wherein the amino acid at position 411 (or equivalent thereto) is alanine (A) and/or the amino acid at position 214 is glutamine (Q) and/or the amino acid at position 420 is serine (S); polypeptides comprising amino acids 79-439 of SEQ ID NO 2; polypeptides comprising amino acids 79- 439 of SEQ ID NO 2 wherein the amino acid at position 41 1 (or equivalent thereto)
  • the amino acids at positions 41 1 , 412, 420 of SEQ ID NO 2 (or equivalent thereof) in a truncated FlaA1 polypeptide are alanine (A), glutamine (Q) and serine (S) respectively.
  • the polynucleotide sequence encoding the polypeptide FlaA1 encodes a truncated FlaA1 polypeptide.
  • the polypeptide FlaA1 is a fusion polypeptide.
  • the polypeptide is fused to glutathione S-transferase (GST).
  • Roseburia bacteria are slightly curved rod-shaped cells that are strictly anaerobic and indigenous to the mammalian intestine. The bacteria are butyrate-producing and are actively motile through multiple flagella present along the concave side and in a cluster at one end (Stanton and Savage 1983).
  • Roseburia a commenamate of the plantar cells
  • Roseburia faecis a species of the plantar cells
  • Roseburia ominis Rosulfa intestinalis
  • Roseburia inulinivorans Stanton and Savage 1983, Duncan et al 2006.
  • Roseburia flagellin refers to a flagellin protein derived or derivable from a Roseburia bacterium such as Roseburia. hominis, Roseburia triocola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans.
  • the Roseburia flagellin may be flaA1 , flaA2, flaA3, flaA4 or combinations thereof.
  • Fla is used herein to encompass the polypeptides that may be flaA1 , flaA2, flaA3 flaA4 or fliC.
  • the present invention encompasses the use of at least one Roseburia flagellin.
  • the present invention encompasses the use of a combination of at least two, at least three, at least four, or at least five Roseburia flagellins.
  • the combination of Rosebuna flagellins comprises flagellins which are derived or derivable from at least two, three, four or five different Roseburia species.
  • Roseburia flagellins examples include flagellins derived or derivable from Roseburia bacterium such as Roseburia hominis, Roseburia triocola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans.
  • the flagellin is derived or derivable from Roseburia hominis.
  • the flagellin is derived or derivable from Roseburia intestinalis.
  • Roseburia flagellins examples include polypeptide sequences having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12 or variants, homologues, fragments or derivatives thereof.
  • the Roseburia flagellin has the polypeptide sequence shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
  • Roseburia hominis flagellins examples are Roseburia hominis Fla1 and Fla2.
  • An example of Roseburia hominis Fla1 is shown as SEQ ID NO 2.
  • Roseburia hominis Fla1 is also referred herein as RhFlaAI , RHFIaAI , RhFlal , RHFIal , RH1 or R 1.
  • SEQ ID NO 2 has the following sequence:
  • Roseburia hominis Fla2 is shown as SEQ ID NO 4.
  • Roseburia hominis Fla2 is also referred herein as RhFlaA2, RHFIaA2, RhFla2, RHFIa2, Rh2 or RH2.
  • SEQ ID NO 4 has the following sequence:
  • Roseburia intestinalis flagellins examples include Roseburia intestinalis Fla1 , Fla2, Fla3 and Fla4.
  • Roseburia intestinalis Fla1 An example of Roseburia intestinalis Fla1 is shown as SEQ ID No 6. Roseburia intestinalis is also referred herein as RiFlaAI , RIFIaAI , RiFlal , RIFIal , Ri1 or RIl
  • SEQ ID NO 6 has the following sequence:
  • Roseburia intestinalis Fla2 An example of Roseburia intestinalis Fla2 is shown as SEQ ID No 8. Roseburia intestinalis Fla2 is also referred herein as RiFlaA2 or RIFIaA2 or Ri2 or RI2.
  • SEQ ID NO 8 has the following sequence:
  • Roseburia intestinalis Fla3 An example of Roseburia intestinalis Fla3 is shown as SEQ ID No 10. Roseburia intestinalis Fla3 is also referred herein as RiFla3 or RIFIa3 or Ri3 or RI3.
  • SEQ ID NO 10 has the following sequence:
  • Roseburia intestinalis Fla4 is shown as SEQ ID No 12.
  • Roseburia intestinalis Fla4 is also referred herein as RiFla4 or RIFIa4 or Ri4 or RI4.
  • SEQ ID NO 12 has the following sequence:
  • polypeptide FlaA1 polypeptide FlaA1
  • FlaA1 polypeptide polypeptide Fla1
  • Fla1 polypeptide polypeptide Fla1
  • Fla1 polypeptide polypeptide Fla1
  • Fla1 polypeptide polypeptide Fla1
  • Fla1 polypeptide polypeptide Fla1
  • Fla1 polypeptide polypeptide Fla1
  • Fla1 polypeptide polypeptide Fla1
  • Fla1 polypeptide are used interchangeably herein.
  • polypeptide Fla3 and “Fla3 polypeptide”
  • polypeptide Fla4 polypeptide are used interchangeably herein.
  • the Roseburia flagellin is selected from the group consisting of Fla1 , Fla2, Fla3 and Fla4. In one embodiment, the Roseburia flagellin is selected from the group consisting of Fla2, Fla1 , Fla4 and combinations thereof. In a further embodiment, the Roseburia flagellin is Fla2.
  • the Roseburia flagellin is selected from the group consisting of Roseburia hominis Fla1 , Roseburia hominis Fla2, Roseburia intestinalis Fla1 , Roseburia intestinalis Fla2, Roseburia intestinalis Fla3 and Roseburia intestinalis Fla4.
  • the Roseburia flagellin is selected from the group consisting of Roseburia hominis Fla2, Roseburia intestinalis Fla2, Roseburia intestinalis Fla1 , Roseburia intestinalis Fla4 and combinations thereof.
  • the Roseburia flagellin is selected from the group consisting of Roseburia hominis Fla2, Roseburia intestinalis Fla2 and combinations thereof.
  • the Roseburia flagellin is Roseburia intestinalis Fla2.
  • the present invention encompasses the use of at least one polynucleotide sequence encoding a Roseburia flagellin.
  • the present invention encompasses the use of a combination of at least two, at least three, at least four, or at least five polynucleotide sequences encoding Roseburia flagellins.
  • the present invention encompasses the use of a polynucleotide sequence encoding at least one Roseburia flagellin.
  • the present invention encompasses the use of a polynucleotide sequence encoding a combination of at least two, at least three, at least four, or at least five polypeptide sequences encoding Roseburia flagellins.
  • the polynucleotide sequence encoding a Roseburia flagellin may encode flaA1 , flaA2, fla3, fla4 or combinations thereof.
  • the combination of polynucleotide sequences encoding Roseburia flagellins comprises polynucleotide sequences encoding flagellins which are derived or derivable from at least two, three, four or five different Roseburia species.
  • the polynucleotide sequence encodes a combination of Roseburia flagellins which are derived or derivable from at least two, three, four or five different Roseburia species.
  • the present invention encompasses the use of a combination of at least one Roseburia flagellin and at least one polynucleotide sequence encoding a Roseburia flagellin.
  • Examples of polynucleotide sequence encoding Roseburia flagellins include flagellins derived or derivable from Roseburia bacterium such as Roseburia hominis, Roseburia triocola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans.
  • the polynucleotide sequence encodes a Roseburia flagellin derived or derivable from Roseburia hominis.
  • the polynucleotide sequence encodes a Roseburia flagellin derived or derivable from Roseburia intestinalis.
  • polynucleotide sequences encoding Roseburia flagellin include the polynucleotide sequences encoding a polypeptide which has at least 75% identity to SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12 or variants, homoiogues, fragments or derivatives thereof and polynucleotide sequences having at least 75% identity to SEQ ID NO 1 , SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7, SEQ ID NO 9 or SEQ ID NO 11 or variants, homoiogues, fragments or derivatives thereof.
  • the polynucleotide sequence encoding Roseburia flagellin has the polynucleotide sequence encoding a polypeptide which has the sequence shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
  • the polynucleotide sequence encoding the Roseburia flagellin has the polynucleotide sequence shown as SEQ ID NO 1 , SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7, SEQ ID NO 9 or SEQ ID NO 11.
  • polynucleotide sequences encoding Roseburia hominis flagellins are polynucleotide sequences encoding Roseburia hominis Fla1 and Fla2.
  • An example of a polynucleotide sequence encoding Roseburia hominis Fla1 is shown as SEQ ID NO 1.
  • SEQ ID No 1 has the following sequence:
  • SEQ ID NO 3 An example of a polynucleotide sequence encoding Roseburia hominis Fla2 is shown as SEQ ID NO 3.
  • SEQ ID No 3 has the following sequence:
  • polynucleotide sequences encoding Roseburia intestinalis flagellins are polynucleotide sequences encoding Roseburia intestinalis Fla1 , Fla2, Fla3 and Fla4.
  • SEQ ID NO 5 An example of a polynucleotide sequence encoding Roseburia intestinalis Fla1 is shown as SEQ ID NO 5.
  • SEQ ID No 5 has the following sequence:
  • SEQ ID No 7 has the following sequence:
  • SEQ ID NO 9 An example of a polynucleotide sequence encoding Roseburia intestinalis Fla3 is shown as SEQ ID NO 9.
  • SEQ ID No 9 has the following sequence.
  • SEQ ID No 1 has the following sequence:
  • the polynucleotide sequence encodes a Roseburia flagellin selected from the group consisting of Fla2, Fla1 , Fla4 and combinations thereof. In a further embodiment, the polynucleotide sequence encodes the Roseburia flagellin Fla2.
  • the polynucleotide sequence encoding Roseburia flagellin is selected from the group consisting of a polynucleotide sequence encoding Roseburia hominis Fla1 , a polynucleotide sequence encoding Roseburia hominis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla1 , a polynucleotide sequence encoding Roseburia intestinalis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla3 and a polynucleotide sequence encoding Roseburia intestinalis Fla4.
  • the polynucleotide sequence encoding Roseburia flagellin is selected from the group consisting of a polynucleotide sequence encoding Roseburia hominis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla1 , a polynucleotide sequence encoding Roseburia intestinalis Fla4 and combinations thereof.
  • the polynucleotide sequence encoding Roseburia flagellin is selected from the group consisting of a polynucleotide sequence encoding Roseburia hominis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla2 and combinations thereof.
  • the polynucleotide sequence encoding Roseburia flagellin is a polynucleotide sequence encoding Roseburia intestinalis Fla2. The therapeutic effect of flagellins were evaluated by the inventors by functional assays.
  • the Roseburia flagellin is a truncated Roseburia flagellin.
  • the truncated Roseburia flagellin comprises at least 20, 30, 40, 50, 75, 100, 125, 150, 175 or 200 amino acids of polypeptide shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
  • the truncated Roseburia flagellin is a truncated Roseburia hominis flagellin or a truncated Roseburia intestinalis flagellin.
  • the polynucleotide sequence encoding the Roseburia flagellin encodes a truncated FlaA1 , Fla2, Fla3 or Fla4.
  • the polynucleotide sequence encodes a truncated Roseburia flagellin comprising at least 20, 30, 40, 50, 75, 100, 125, 150, 175 or 200 amino acids of polypeptide shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
  • the polynucleotide sequence encoding the Roseburia flagellin encodes a truncated FlaA1 or Fla3.
  • the Roseburia flagellin is a fusion polypeptide.
  • the polypeptide is fused to glutathione S-transferase (GST).
  • the term “modulation” refers to an increase and/or induction and/or promotion and/or activation. In an alternative embodiment, the term “modulation” refers to a decrease and/or reduction and/or inhibition. In one embodiment, the term “regulation” refers to an upregulation. In an alternative embodiment, the term “regulation” refers to a downregulation.
  • the Roseburia flagellin, and/or Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), reduces the inflammation of a tissue or an organ.
  • Fla such as FlaA1 or FlaA2
  • inflammation of the alimentary canal or part thereof is reduced.
  • inflammation refers to one or more of the following: redness, swelling, pain, tenderness, heat, and disturbed function of a tissue or organ due to an inflammatory process triggered by over-reaction of the immune system.
  • a reduction in inflammation in a subject can be determined by determining the levels of proinflammatory cytokines and chemokines in tissue, serum and/or faecal samples in a subject before, and after, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the Roseburia flagellin such as FlaA1 or FlaA2
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the levels of one or more of the following can be monitored: IL-1 , IL-4, IL5, IL6, IL- 8, IL-12, IL-13, IL-17, IL-21 , IL-22, IL23, TNFcc, IFNy, CXCL1 , CXCL10, CCL2, CCL20 serum and faecal calprotectin, SA1009/SA1008 calcium binding proteins, and Type 1 interferons, CD markers such as CD163, CD14, inflammatory transcription factors such as NF-kB, STAT, and MAPkinases, c-reactive protein (CRP), erythrocyte sedimentation rate (ESR), complement proteins, serum albumin, histological evaluation of target tissues and organs, disease activity indices.
  • CD markers such as CD163, CD14
  • inflammatory transcription factors such as NF-kB, STAT, and MAPkinases
  • CRP c-reactive protein
  • ESR erythrocyte sedimentation rate
  • complement proteins serum album
  • quality of life (QoL) questionnaires can be carried out before, and after, the Roseburia flagellin, and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the Roseburia flagellin, and/or polypeptide Fla such as FlaA1 or FlaA2
  • polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla such as FlaA1 or FlaA2
  • the vector comprising said polynucleotide sequence
  • the amount of a tissue or organ which is inflamed in a subject is at least 10%, 20%, 30%, 40% or 50% lower when compared to the amount of tissue or organ which is inflamed in a subject before the Roseburia flagellin, and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla such as FlaA
  • the Roseburia flagellin, and/or Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), reduces the inflammation by epithelial cells of the tissue or the organ.
  • the epithelial cells are epithelial cells of the alimentary canal or part thereof (such as the intestine).
  • the Roseburia flagellin, and/or Fla increases the production of T cells in a subject.
  • FlaA1 or FlaA2 polypeptide increases the production of T cells in a subject.
  • the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia increases the production of T cells in a subject.
  • the T cells are regulatory T cells (also referred to as Tregs) such as regulatory T cells capable of expressing TLR5 (Toll-like receptor 5).
  • Tregs regulatory T cells
  • TLR5 Toll-like receptor 5
  • Treg numbers will combat the effects of other effector T cells (also referred to as Teffs), such as Th1 , Th17 and Th2 which drive inflammation, autoimmunity and allergic/atopic conditions.
  • Teffs effector T cells
  • the production of T cells in a subject is increased such that there are at least 10%, 20%, 30%, 40% or 50% more T cells, or greater than 100% more T cells, when compared to the number of T cells in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla such
  • the term "immune system” as used herein may refer to the adaptive immune system and/or the innate immune system.
  • the invention relates to the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the adaptive immune system of a subject.
  • the Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla such as FlaA1 or FlaA2 polypeptide
  • adaptive immune system otherwise known as the "specific immune system” refers to highly specialized, systemic cells and processes that eliminate or prevent pathogenic growth.
  • the adaptive immune response provides the vertebrate immune system with the ability to recognize and remember specific pathogens (to generate immunity), and to mount stronger attacks each time the pathogen is encountered.
  • the term "regulating the adaptive immune system” means inducing the activity of the adaptive immune system, and/or promoting immune homeostatic mechanisms by increasing the level of activity relative to the baseline level of activity.
  • the adaptive immune system is modulated towards immune regulation (and not immune activation therefore reducing inflammation).
  • T cell responses associated with Th1 , Th2 and Th17 are associated with atopic, inflammatory and autoimmune diseases.
  • Therapies which improve or increase T regulatory (Tregs) cell populations are important in controlling diseases driven by excessive Th1 , Th2 and Th17 cell responses.
  • Another aspect of the invention relates to the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the innate immune system of a subject.
  • the Fla such as FlaA1 or FlaA2
  • the term "innate immune system”, also known as the non-specific immune system, comprises the cells and mechanisms that provide the host with immediate defence against infection by other organisms in a non-specific manner. This means that the cells of the innate system recognize and respond to pathogens in a generic way, but unlike the adaptive immune system, it does not confer long-lasting or protective immunity to the host.
  • the term "regulating the innate immune system” means inducing the activity of the innate immune system, and/or increasing the level of activity relative to the baseline level of activity such that it promotes immune homeostasis.
  • Loss or dysregulation of the innate immune function either due to loss of epithelial barrier, innate immune peptides such as defensins, chemokines and cytokines or defective TLR signalling are associated with increased risk of inflammatory diseases, in several body organs including the gut. Such diseases include inflammatory bowel disease.
  • the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), restores immunological tolerance.
  • Fla such as FlaA1 or FlaA2
  • the term "immunological tolerance” refers to the process by which the immune system does not attack an antigen such as a self-antigen.
  • the term "restoring immunological tolerance” refers to a restoration in immunological tolerance to one or more antigens (such as a self-antigen) in a subject such that the level of immunological tolerance to the antigen is higher when compared to the levels in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • antigens such as a self-antigen
  • the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), activates dendritic cells and/or epithelial cells.
  • the term "activates dendritic cells” refers to an up-regulation of one or more cells markers (such as l-A/l-E cell markers, CD80 and CD86 and CD40) and/or an increase in the production of one or more cytokines (such as IL-10 and TGFp) by cells (such as dendritic cells) in a subject when compared to the levels in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is
  • l-A/l-E refers to cell markers of MHC class II.
  • CD40 has an essential role in immunity, and is one of the best characterized of the costimulatory molecules. This receptor, a member of the tumor necrosis factor receptor family, is expressed by professional antigen-presenting cells, such as dendritic cells. CD40 binds its ligand CD40L, which is transiently expressed on T cells and other non-immune cells under inflammatory conditions.
  • CD40L is an example of a T cell marker.
  • CD3, CD4, CD25, FoxP3, CTLA-4, Ly6g and CD1 1 b are further examples of T cell markers.
  • CD80 and CD86 are expressed on antigen-presenting cells (such as dendritic cells) and are required for the development and costimulation of T cell responses.
  • the CD28 and CTLA-4 molecules on T cells serve as receptors for the CD80 and CD86 costimulatory antigens.
  • CD3, CD4, CD25, FoxP3, CTLA-4, Ly6g and CD1 1 b are examples of markers of colonic T regulatory cells.
  • the depletion of Ly6g increases infection risk, both gut and respiratory tract and is associated with diseases such as neutropenia.
  • the Roseburia flagellin, and/or the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaA1 or FlaA2
  • the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia is for use in treating neutropenia.
  • Another aspect of the invention relates to the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in maintaining immune homeostasis in a subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaA1 or FlaA2
  • the vector comprising said polynucleotide sequence
  • the host cell comprising said vector
  • maintaining immune homeostasis refers to the self-regulation of the body's immune system to maintain oral tolerance or immune stability in response to changing conditions.
  • Oral tolerance refers to the normal immune responses to food and commensal bacteria in a healthy gut. These are lost in coeliac disease and Inflammatory Bowel Diseases such as Crohn's disease and ulcerative colitis.
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is for use in treating coeliac disease and Inflammatory Bowel Diseases such as Crohn's disease and ulcerative colitis.
  • coeliac disease and Inflammatory Bowel Diseases such as Crohn's disease and ulcerative colitis.
  • the numbers of a cell marker on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of the cell marker on the cell(s), or greater than 100% more of the cell marker on the cell(s), when compared to the number of the cell marker on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the number of cells in a subject which have the cell marker are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have the cell marker, or greater than 00% more cells which have the cell marker, when compared to the number of cell with the cell marker in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FIaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the cells are T cells.
  • the cells are cells of the alimentary canal (such as cells of the intestine).
  • the cells are colonic and/or small intestinal T regulatory cells and may be either CD4 or CD8 positive.
  • the cell marker is a T cell marker. In another aspect, the cells marker is a colonic T cell marker.
  • the level of a cytokine in a subject is increased such that the cytokine level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the cytokine level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the
  • the term "activates epithelial cells” refers to an increase in the expression of one or more pro-inflammatory genes by epithelial cells in a subject when compared to the expression levels in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as Fla
  • pro-inflammatory gene refers to a gene which, when expressed, promotes inflammation.
  • pro-inflammatory genes include genes encoding but not limited to ⁇ _1- ⁇ , IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-a.
  • the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), upregulates the production of a cytokine.
  • Fla such as FlaA1 or FlaA2
  • the term "upregulates the production of a cytokine” as used herein refers to an increase in the level of a cytokine in a subject compared to the level of the cytokine in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the level of the cytokine is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaA1
  • the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), upregulates the production of IL-10 and/or TGFp.
  • Fla such as FlaA1 or FlaA2
  • the term "upregulates the production of IL-10" as used herein refers to an increase in the level of IL-10 in a subject compared to the level of IL-10 in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla such as FlaA
  • the level of IL-10 is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaA1 or FlaA2
  • IL-10 is produced by dendritic cells such as bone marrow derived dendritic cells and gut mucosal dendritic cells in particular CD103+ subsets.
  • the Roseburia flagellin, and/or the Fla polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla such as FlaA1 or FlaA2 polypeptide
  • the vector comprising said polynucleotide sequence and/or the host cell comprising said vector, and
  • cell surface markers involved in immune responses and antigen recognition include CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent.
  • Cell surface markers (e.g. CD317/BST-2) may be referred by different names in different species or the cell surface marker may not yet have been identified on the cells of a particular species.
  • the term "species equivalent” as used herein encompasses these cell surface markers.
  • the term "upregulates the production CD40" as used herein refers to an increase in the level of CD40 in a subject compared to the level of CD40 in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaAI or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla such as FlaAI or FlaA2
  • the number of cells bearing the cell marker CD40 is increased and/or the number of CD40 markers on a cell is increased.
  • the numbers of the CD40 cell marker on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of the cell marker on the cell(s), or greater than 100% more of the cell marker on the cell(s), when compared to the number of the cell marker on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis,
  • the number of cells in a subject which have the cell marker CD40 are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have the cell marker, or greater than 100% more cells which have the cell marker, when compared to the number of cell with the cell marker in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaAI or FlaA2
  • the term "upregulates the production l-A/l-E" as used herein refers to an increase in the level of l-A/l-E in a subject compared to the level of l-A/l-E in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the number of cells bearing one or more l-A/l-E cell markers is increased and/or the number of l-A l-E cell
  • the numbers of the l-A l-E cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of l-A l-E cell markers on the cell(s), or greater than 100% more of l-A l-E cell markers on the cell(s), when compared to the number of l-A/l-E cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the
  • the number of cells in a subject which have l-A/l-E cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have l-A/l-E cell markers, or greater than 100% more cells which have l-A/l-E cell markers, when compared to the number of cell with l-A l-E cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla
  • the term "upregulates the production of CD317/BST-2" as used herein refers to an increase in the level of CD3 7/BST-2 in a subject compared to the level of CD317/BST-2 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the number of cells bearing one or more CD317/BST-2 cell markers is increased and/or the number of CD317/BST-2 cell markers on a cell is increased.
  • the numbers of the CD317/BST-2 cell markers on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD317/BST-2 cell markers on the cell(s), or greater than 100% more of CD317/BST-2 cell markers on the cell(s), when compared to the number of CD317/BST-2 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species
  • the number of cells in a subject which have CD317/BST-2 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD317/BST-2 cell markers, or greater than 100% more cells which have CD317/BST-2 cell markers, when compared to the number of cell with CD317/BST-2 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA
  • the term "upregulates the production of CD103" as used herein refers to an increase in the level of CD103 in a subject compared to the level of CD103 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the number of cells bearing one or more CD103 cell markers is increased and/or the number of CD103 cell markers on a cell is increased.
  • the numbers of the CD103 cell markers on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD103 cell markers on the cell(s), or greater than 100% more of CD103 cell markers on the cell(s), when compared to the number of CD 103 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis),
  • the number of cells in a subject which have CD103 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD103 cell markers, or greater than 100% more cells which have CD103 cell markers, when compared to the number of cell with CD103 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the term "upregulates the production of CD80" as used herein refers to an increase in the level of CD80 in a subject compared to the level of CD80 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the number of cells bearing one or more CD80 cell markers is increased and/or the number of CD80 cell markers on a cell is increased.
  • the numbers of the CD80 cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD80 cell markers on the cell(s), or greater than 100% more of CD80 cell markers on the cell(s), when compared to the number of CD80 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the number of cells in a subject which have CD80 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD80 cell markers, or greater than 100% more cells which have CD80 cell markers, when compared to the number of cell with CD80 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the term "upregulates the production of CD86" as used herein refers to an increase in the level of CD86 in a subject compared to the level of CD86 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the number of cells bearing one or more CD86 cell markers is increased and/or the number of CD86 cell markers on a cell is increased.
  • the numbers of the CD86 cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD86 cell markers on the cell(s), or greater than 100% more of CD86 cell markers on the cell(s), when compared to the number of CD86 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the number of cells in a subject which have CD86 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD86 cell markers, or greater than 100% more cells which have CD86 cell markers, when compared to the number of cell with CD86 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the term "upregulates the production of CD83" as used herein refers to an increase in the level of CD83 in a subject compared to the level of CD83 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the number of cells bearing one or more CD83 cell markers is increased and/or the number of CD83 cell markers on a cell is increased.
  • the numbers of the CD83 cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD83 cell markers on the cell(s), or greater than 100% more of CD83 cell markers on the cell(s), when compared to the number of CD83 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the number of cells in a subject which have CD83 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD83 cell markers, or greater than 100% more cells which have CD83 cell markers, when compared to the number of cell with CD83 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the term "upregulates the production of Siglec-H” as used herein refers to an increase in the level of Siglec-H in a subject compared to the level of Siglec-H in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the number of cells bearing one or more Siglec-H cell markers is increased and/or the number of Siglec-H cell markers on a cell is increased.
  • the numbers of the Siglec-H cell markers on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of Siglec-H cell markers on the cell(s), or greater than 100% more of Siglec-H cell markers on the cell(s), when compared to the number of Siglec-H cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis,
  • the number of cells in a subject which have Siglec- H cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have Siglec-H cell markers, or greater than 100% more cells which have Siglec-H cell markers, when compared to the number of cell with Siglec-H cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the production of CD40 l-A/l-E, CD317/BST-2, CD80, CD86, CD83 and/or Siglec-H is by dendritic cells (such as tolerogenic CD103 + dendritic cells expanded by FLT3L).
  • the expression of one or more Type I IFN genes in a cell or cells of a subject is downregulated.
  • the expression level of one or more Type I IFN genes is decreased such that the level is at least 10%, 20%, 30%, 40% or 50% lower when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaAI or FlaA2
  • Type I IFN genes include but not limited to IFN- ⁇ , IFN-p3, Ifi202b, ⁇ 203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, lr ⁇ 3 and Irf4.
  • the expression of one or more pro-inflammatory genes in a cell or cells of a subject is downregulated.
  • the expression level of one or more pro-inflammatory genes is decreased such that the level is at least 10%, 20%, 30%, 40% or 50% lower when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaAI or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaAI or FlaA2
  • the vector comprising said
  • intestinal microbiota refers to microorganisms that live in the digestive tract of the host animals. These microorganisms perform a wide variety of metabolic, structural, protective and other beneficiary functions.
  • the term "improving intestinal microbiota” refers to increasing the number and/or type of microorganisms present in the intestine of a subject (e.g. the host), and/or increasing the activity of said microorganisms in terms of their metabolic, structural, protective and other beneficiary functions. For example, the numbers (i.e. levels) of Clostridium cluster XlVa bacteria are increased and the numbers of E.
  • coli are reduced; such an improvement in intestinal microbiota may occur in subjects with inflammatory bowel disease (IBD) once the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), has been administered to the subject.
  • IBD inflammatory bowel disease
  • the number of microorganisms present in the intestine of a subject is increased such that the number of microorganisms is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the types of microorganisms present in the intestine of a subject are increased such that there are at least 5%, 10%, or 15% more types of microorganisms when compared to the types in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such
  • the term "regulating appetite” refers to the ability to modulate (i.e. increase or decrease) the desire for a subject to eat food. In one embodiment, the appetite in the subject is stimulated (i.e. increased).
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), exerts a stimulatory effect on the appetite of a subject by downregulating the expression of genes associated with the suppression of appetite (such as genes encoding satiety hormones).
  • Agt, Cartpt, Cck, Cxcl12 and Gcg are examples of genes associated with regulating appetite and the downregulation of one or more of these genes is associated with the suppression of appetite.
  • Cck and Gcg are examples of
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), stimulates the appetite in the subject such that the subject consumes at least 5%, 10%, or 15% more food when compared to the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2),
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), stimulates the appetite in the subject such that after 1 month from administration the weight of the subject is at least 2%, 5%, or 10% higher when compared to the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or Fla
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), reduces the level of cholecystokinin (Cck) and/or glucagon (Gcg) in the blood of a subject.
  • Cck cholecystokinin
  • Gcg glucagon
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), reduces the level of cholecystokinin (Cck) and/or glucagon (Gcg) in the blood of a subject by at least 5%, 10%, 15% or 20% when compared to the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), downregulates the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
  • Cck cholecystokinin
  • Gcg glucagon
  • the Roseburia flagellin, and/or the polypeptide Fla decreases the expression of the gene encoding cholecystokinin (Cck) such that the expression level is at least 5%, 10%, 15% or 20% lower when compared to the expression level in the subject before the Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2) and/or the polynucleotide sequence encoding said Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), decreases the expression of the gene encoding cholecystokinin (Cck) such that the expression level is at least 5%, 10%, 15% or 20% lower when compared to the expression level in the subject before the Roseburia flagellin and/or the
  • the Roseburia flagellin, and/or the polypeptide Fla decreases the expression of the gene encoding glucagon (Gcg) such that the expression level is at least 5%, 10%, 15% or 20% lower when compared to the expression level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or
  • the term "improving alimentary canal health” as used herein refers to reducing the level of inflammation in the alimentary canal or part thereof and/or improving intestinal microbiota.
  • the level of inflammation in the alimentary canal is at least 10%, 20%, 30%, 40% or 50% lower when compared to the level of inflammation in the alimentary canal of a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaA1 or FlaA2
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), regulates the expression of at least one gene selected from Tlr5, Tir1, Vnn1, Defb37, Pla2g, Muc16, Itln, Sprrla, Cldn4, Pmp22, Crb3, Magi3, Man/eld3, Mpp7, Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a. Many of these genes are gut
  • the expression of one or more genes selected from the group consisting of TLR-related genes e.g. Tlr5, Tlr1, and Vnn1
  • genes encoding anti-microbial peptides e.g. Defb37, Pla2g, Muc16, and Itln
  • gut barrier function genes e.g. Sprrla, Cldn4, Pmp22, Crb3, and Mag/3
  • innate immune genes e.g. Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a
  • TLR-related genes e.g. Tlr5, Tlr1, and Vnn1
  • genes encoding anti-microbial peptides e.g. Defb37, Pla2g, Muc16, and Itln
  • gut barrier function genes e.g. Sprrla, Cldn4, Pmp22, Crb3, and Mag/3
  • innate immune genes e.g. Defcr20, Pcgf
  • Tlr5, Tlr1, and Vnn1 genes encoding anti-microbial peptides (e.g. Defb37, Pla2g, Mud 6, and Itln), gut barrier function genes (e.g. Sprrla, Cldn4, Pmp22, Crb3, and Magi3), innate immune genes (e.g.
  • Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
  • the polypeptide Fla such as FlaA1 or FlaA2
  • the expression of one or more genes selected from the group consisting of Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, Itln, Sprrla, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a in a cell or cells of a subject is upregulated.
  • the expression level of one or more genes selected from the group consisting of Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, Itln, Sprrla, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/
  • the expression of one or more genes selected from the group consisting of genes encoding acetyl-CoA acetyltransferase, 3-hydroxyacyl-CoA dehydrogenase, butyryl- CoA dehydrogenase and phosphoenolpyruvate carboxykinase [ATP] in a cell or cells of a subject is modulated.
  • the expression level of one or more genes selected from the group consisting of genes encoding acetyl-CoA acetyltransferase, 3-hydroxyacyl-CoA dehydrogenase, butyryl-CoA dehydrogenase and phosphoenolpyruvate carboxykinase [ATP] is modulated such that the level is at least 10%, 20%, 30%, 40% or 50% higher or lower when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis
  • the present invention relates to a transformed microorganism (such as a Firmicutes e.g. a Roseburia spp such as R. hominis or R. intestinalis) in which the expression of a flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2 is enhanced compared to the equivalent microorganism prior to transformation, and uses thereof for various therapeutic and nutritional uses as described herein.
  • a flagellin e.g. Roseburia flagellin
  • FlaA1 or FlaA2 e.g. Roseburia flagellin
  • FlaA1 or FlaA2 e.g. Roseburia flagellin
  • FlaA1 or FlaA2 e.g. Roseburia flagellin
  • FlaA1 or FlaA2 e.g. Roseburia flagellin
  • FlaA1 or FlaA2 e.g. Roseburia flagellin
  • FlaA1 or FlaA2 e.g. Roseburia flagelli
  • the transformed microorganism may have be transformed with an expression vector comprising a nucleotide sequence encoding a flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2 operably linked to a regulatory sequence (such as a promoter) such that the microorganism is capable of overexpressing the gene encoding the flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2.
  • a flagellin e.g. Roseburia flagellin
  • FlaA1 or FlaA2 operably linked to a regulatory sequence (such as a promoter) such that the microorganism is capable of overexpressing the gene encoding the flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2.
  • the term "expression vector” refers to a DNA construct containing a DNA coding sequence (e.g., gene sequence) that is operably linked to one or more suitable control sequence(s) capable of affecting expression of the coding sequence in a host.
  • control sequences include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences which control termination of transcription and translation.
  • the vector may be a plasmid, a phage particle, or simply a potential genomic insert. Once transformed into a suitable host, the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself.
  • the plasmid is the most commonly used form of expression vector.
  • operably linked refers to juxtaposition wherein the elements are in an arrangement allowing them to be functionally related.
  • a promoter is operably linked to a coding sequence if it controls the transcription of the coding sequence.
  • the tissue or organ is the alimentary canal or a section thereof (e.g. the oesophagus, the stomach or the intestine such as the small intestine or the large intestine and colon) or another mucosal sites (such as the nasal passages and the lungs).
  • the tissue or organ is the alimentary canal or part thereof.
  • parts of the alimentary canal include the oesophagus, the stomach and the intestine (such as the small intestine (e.g. the duodenum, the jejunum and the ileum) and/or the large intestine (e.g. the caecum, ascending colon, transverse colon, descending colon, and sigmoid colon)).
  • the small intestine e.g. the duodenum, the jejunum and the ileum
  • large intestine e.g. the caecum, ascending colon, transverse colon, descending colon, and sigmoid colon
  • the subject is a monogastric animal.
  • Examples of monogastric animals include poultry, humans, rats, pigs, dogs, cats, horses and rabbits.
  • the subject is a mammal such as a monogastric mammal.
  • monogastric mammals examples include omnivores (such as humans, rats, and pigs), carnivores (such as dogs and cats), and herbivores (such as horses and rabbits).
  • the subject is a human.
  • TLR5 is capable of being expressed in the cells of said subject.
  • Roseburia flagellin, and/or polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), may be used in treating a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
  • a disorder is an inflammatory disorder and/or an autoimmune disorder.
  • the inflammatory disorder and/or an autoimmune disorder affects the alimentary canal, or a section thereof, of said subject.
  • the inflammatory disorder and/or an autoimmune disorder affects a mucosal site of a subject.
  • mucosal sites include the alimentary canal or a section thereof (e.g. the oesophagus, the stomach or the intestine such as the small intestine or the large intestine and colon), the nasal passages and the lungs.
  • the inflammatory disorder and/or an autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes, coeliac disease, atopic dermatitis, rhinitis, irritable bowel syndrome (IBS), colitis, inflammatory bowel disorder (IBD), ulcerative colitis, pouchitis, Crohn's disease, functional dyspepsia, atopic diseases, necrotising enterocolitis, and combinations thereof.
  • the inflammatory disorder is colitis.
  • the inflammatory disease is Crohn's disease, ulcerative colitis or pouchitis.
  • the inflammatory disorder and/or an autoimmune disorder affects the intestine.
  • the intestinal disorder is IBS.
  • the precise pathophysiology of IBS remains to be elucidated. Recent studies have described mucosal inflammation and alterations in intestinal microbiota in IBS patients and a disease correlation with intestinal infections.
  • the intestinal disorder is Crohn's disease.
  • the disorder is an autoimmune disorder.
  • the autoimmune disorder is selected from the group consisting of ulcerative colitis, pouchitis, rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes, allergies (including coeliac disease), atopic dermatitis and rhinitis.
  • the autoimmune diseases, rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes are of particular relevance.
  • the term “medicament” encompasses medicaments for both human and animal usage in human and veterinary medicine.
  • the term “medicament” as used herein means any substance, which provides a therapeutic and/or beneficial effect.
  • the term “medicament” as used herein is not necessarily limited to substances, which need Marketing Approval, but may include substances which, can be used in cosmetics, nutraceuticals, food (including feeds and beverages for example), probiotic cultures, nutritional supplements and natural remedies.
  • the term “medicament” as used herein encompasses a product designed for incorporation in animal feed, for example livestock feed and/or pet food.
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), according to the invention may also be used in prophylactic applications.
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), according to the invention are administered to a patient susceptible to, or otherwise at risk of, a particular disease in an amount that is sufficient to at least partially reduce the risk of developing a disease. Such an amount is defined to be "a prophylactic effective dose". The precise amounts depend on a number of specific factors such as the subject's state of health and weight. Encapsulation
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin of the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated.
  • the pharmaceutical composition comprising the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated.
  • the pharmaceutical composition comprising the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and
  • the nutritional supplement comprising the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated.
  • the feedstuff, food product, dietary supplement, or food additive is encapsulated.
  • the term "encapsulated” as used here refers to a means for protecting the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), from an incompatible environment by physical separation so that it can be delivered to the target site (e.g. the intestine) without degradation or significant degradation in order that the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell, and/or the Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), can have an effect on the target site.
  • An example is an enteric coated capsule.
  • the protective coating or shell must be ruptured at the time of desired action.
  • the rupturing of the protective coating or shell is typically brought about through the application of chemical and physical stimuli such as pressure, enzyme attack, chemical reaction and physical disintegration.
  • the encapsulation ensures that the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell, and/or the Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), can be ingested so that the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell and/or the Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), can be delivered to the intestine (i.e. the target site) in an amount which is effective to produce an effect in the intestine.
  • the intestine i.e. the target site
  • the pharmaceutical composition may be any pharmaceutical composition.
  • the pharmaceutical composition is to be administered orally, enterally or rectally.
  • the composition may be an edible composition.
  • Edible means a material that is approved for human or animal consumption.
  • compositions may be for human or animal usage in human and veterinary medicine.
  • Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985).
  • suitable carriers include lactose, starch, glucose, methyl cellulose, magnesium stearate, mannitol, sorbitol and the like.
  • suitable diluents include ethanol, glycerol and water.
  • compositions may comprise as, or in addition to, the carrier, excipient or diluent any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s).
  • Suitable binders include starch, gelatin, natural sugars such as glucose, anhydrous lactose, free-flow lactose, beta-lactose, corn sweeteners, natural and synthetic gums, such as acacia, tragacanth or sodium alginate, carboxymethyl cellulose and polyethylene glycol.
  • Suitable lubricants include sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like.
  • Preservatives, stabilizers, dyes and even flavouring agents may be provided in the pharmaceutical composition.
  • preservatives include sodium benzoate, sorbic acid and esters of p-hydroxybenzoic acid.
  • Antioxidants and suspending agents may be also used.
  • Nutritionally acceptable carriers, diluents and excipients include those suitable for human or animal consumption and that are used as standard in the food industry. Typical nutritionally acceptable carriers, diluents and excipients will be familiar to the skilled person in the art.
  • a further aspect of the invention relates to feedstuffs, food products, dietary supplements and food additives containing Roseburia flagellin, and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis),.
  • the polypeptide Fla such as FlaAl or FlaA2
  • a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla such as FlaAl or FlaA2
  • the vector comprising said polynucleotide sequence
  • the host cell
  • feedstuff', “food product” “food additive” and “dietary supplement” as used herein are intended to cover all consumable products that can be solid, jellied or liquid.
  • Suitable food products may include, for example, functional food products, food compositions, pet food, livestock feed, health foods, feedstuffs and the like.
  • the food product is a health food.
  • the term "functional food product” means food that is capable of providing not only a nutritional effect, but is also capable of delivering a further beneficial effect to the consumer. Accordingly, functional foods are ordinary foods that have components or ingredients (such as those described herein) incorporated into them that impart to the food a specific functional - e.g. medical or physiological benefit - other than a purely nutritional effect.
  • Examples of specific food products that are applicable to the present invention include milk- based products, ready to eat desserts, powders for re-constitution with, e.g., milk or water, chocolate milk drinks, malt drinks, ready-to-eat dishes, instant dishes or drinks for humans or food compositions representing a complete or a partial diet intended for pets or livestock.
  • the feedstuff, food product, dietary supplement or food additive according to the present invention are intended for humans, pets or livestock such as monogastric animals.
  • the feedstuff, food product, dietary supplement or food additive may be intended for animals selected from the group consisting of dogs, cats, pigs, horses, or poultry.
  • the food product, dietary supplement or food additive is intended for adult species, in particular human adults.
  • milk-based product as used herein means any liquid or semi-solid milk or whey based product having a varying fat content.
  • the milk-based product can be, e.g., cow's milk, goat's milk, sheep's milk, skimmed milk, whole milk, milk recombined from powdered milk and whey without any processing, or a processed product, such as yoghurt, curdled milk, curd, sour milk, sour whole milk, butter milk and other sour milk products.
  • milk beverages such as whey beverages, fermented milks, condensed milks, infant or baby milks; flavoured milks, ice cream; milk-containing food such as sweets.
  • the feedstuffs, food products, dietary supplements or food additives of the present invention may be - or may be added to - food supplements, also referred to herein as dietary or nutritional supplements or food additives.
  • the feedstuffs, food products, dietary supplements or food additives according to the invention may also be used in animal nutrition (e.g. in pig nutrition), particularly in the early- weaned period and growing fattening period.
  • animal nutrition e.g. in pig nutrition
  • the feedstuffs, food products, dietary supplements or food additives are expected to enhance immune function reduce and prevent infectious diseases, beneficially alter the microbiota composition, and improve growth and performance of animals, for example, through increased feed conversion efficiency.
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), may be used in a probiotic or live biotherapeutic product.
  • Another aspect of the invention relates to a probiotic composition
  • a probiotic composition comprising the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis).
  • the term "probiotic” means microbial cell preparations or components of microbial cells with a beneficial effect on the health or well-being of the host. (Salminen S, Ouwehand A. Benno Y. et al "Probiotics: how should they be defined” Trends Food Sci. Technol. 1999: 10 107-10).
  • the probiotic composition is an orally administrable composition of metabolically active, i.e., live and/or or lyophilized, or non-viable heat-killed, irradiated or lysed probiotic bacteria.
  • the probiotic composition may contain other ingredients.
  • the probiotic composition can be administered orally, i.e., in the form of a tablet, capsule or powder.
  • the probiotic composition may comprise the bacterial species R. hominis or R. intestinalis. Encapsulated products are favoured for R. hominis and R. intestinalis as they are anaerobes. Other ingredients (such as vitamin C, for example), may be included as oxygen scavengers and prebiotic substrates (such as these improve the colonisation and survival in vivo).
  • the probiotic composition of the invention may be administered orally as a food or nutritional product, such as milk or whey based fermented dairy product, or as a pharmaceutical product.
  • a suitable daily dose of the probiotic bacteria is from about 1 x 10 3 to about 1 x 10 11 colony forming units (CFU); for example, from about 1 x 10 7 to about 1 x 10 10 CFU; in another example from about 1 x 10 6 to about 1 x 10 0 CFU.
  • CFU colony forming units
  • the probiotic composition contains the bacterial species and/or cellular components thereof, as active ingredients, in an amount of from about 1 x 10 6 to about 1 x 10 11 CFU/g, respect to the weight of the composition; for example, from about 1 x 10 8 to about 1 x 10 10 CFU/g.
  • the dose may be of 1 g, 3g, 5g, and 10g.
  • a probiotic is optionally combined with at least one suitable prebiotic compound.
  • a prebiotic is usually a non-digestible carbohydrate such as an oligo- or polysaccharide, or a sugar alcohol, which is not degraded or absorbed in the upper digestive tract.
  • Known prebiotics include commercial products such as inulin and transgalacto-oligosaccharides.
  • the probiotic composition of the present invention includes a prebiotic in an amount of from about 1 to about 30% by weight, respect to the total weight composition, (e.g. from 5 to 20% by weight).
  • Carbohydrates may be selected from the group consisting of: fructo- oligosaccharides (or FOS), short-chain fructo-oligosaccharides, inulin, isomalt- oligosaccharides, pectins, xylo-oligosaccharides (or XOS), chitosan-oligosaccharides (or COS), beta-glucans, arable gum modified and resistant starches, polydextrose, D-tagatose, acacia fibers, carob, oats, and citrus fibers.
  • the prebiotics are the short-chain fructo-oligosaccharides (for simplicity shown herein below as FOSs-c.c); said FOSs-c.c. are not digestible carbohydrates, generally obtained by the conversion of the beet sugar and including a saccharose molecule to which three glucose molecules are bonded.
  • FOSs-c.c short-chain fructo-oligosaccharides
  • compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives of the present invention may be adapted for oral, rectal, vaginal, parenteral, intramuscular, intraperitoneal, intraarterial, intrathecal, intrabronchial, subcutaneous, intradermal, intravenous, nasal, buccal or sublingual routes of administration.
  • the pharmaceutical compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives of the present invention are adapted for oral, rectal, vaginal, parenteral, nasal, buccal or sublingual routes of administration.
  • the pharmaceutical compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives of the present invention are adapted for oral administration.
  • compositions of the present invention may also be in form of suppositories, pessaries, suspensions, emulsions, lotions, ointments, creams, gels, sprays, solutions or dusting powders.
  • the active ingredient can be incorporated into a cream consisting of an aqueous emulsion of polyethylene glycols or liquid paraffin.
  • the active ingredient can also be incorporated into an ointment consisting of a white wax or white soft paraffin base together with such stabilisers and preservatives as may be required.
  • Pharmaceutical compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives may be formulated in unit dosage form, i.e., in the form of discrete portions containing a unit dose, or a multiple or sub-unit of a unit dose.
  • Roseburia flagellin, and/or the polypeptide Fla such as FlaA1 or FlaA2
  • a polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla such as FlaAl or FlaA2
  • the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • a physician will determine the actual dosage which will be most suitable for an individual patient and it will depend on a variety of factors including the activity of the specific bacterial strain employed, the metabolic stability and length of action of that strain, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the individual undergoing therapy.
  • the dosages disclosed herein are exemplary of the average case. There can of course be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention.
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), are administered in combination with at least one or two, or three or four or five other active agents.
  • the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), may be administered consecutively, simultaneously or sequentially with the one or more other active agents.
  • the Roseburia flagellin, and/or the polypeptide Fla such as FlaAl or FlaA2
  • a polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla such as FlaAl or FlaA2
  • the vector comprising said polynucleotide sequence
  • the at least one or two, or three or four or five other active agents may be selected from the group consisting of: Roseburia flagellins, the polypeptide Fla (such as FlaAl or FlaA2), polynucleotide sequence(s) encoding said Roseburia flagellin, polynucleotide sequence(s) encoding said polypeptide Fla (such as FlaAl or FlaA2), vector(s) comprising said polynucleotide sequence(s), host cell(s) comprising said vector(s), host cell(s) comprising said polynucleotide sequence(s), and microorganisms (e.g. Roseburia such as R. hominis and/or R. intestinalis).
  • Rosaburia flagellins such as FlaAl or FlaA2
  • the polypeptide Fla such as FlaAl or FlaA2
  • polynucleotide sequence(s) encoding said Roseburia flagellin polynucleotide sequence(s)
  • the at least one or two, or three or four or five other active agents may be a microorganism (e.g. a Roseburia such as R. hominis and/or R. intestinalis).
  • a microorganism e.g. a Roseburia such as R. hominis and/or R. intestinalis.
  • suitable microorganisms include: Roseburia hominis A2-183 and Roseburia intestinalis L1 -82.
  • polypeptide polypeptide sequence
  • protein protein and amino acid sequence
  • polynucleotide sequence and “nucleotide sequence” are used interchangeably herein.
  • the present invention also encompasses the use of sequences having a degree of sequence identity or sequence homology with amino acid sequence(s) of a polypeptide described herein (e.g. variants, homologues and derivatives) or of any nucleotide sequence encoding such a polypeptide (hereinafter referred to as a "homologous sequence(s)").
  • homologue means an entity having a certain homology with the subject amino acid sequences and the subject nucleotide sequences.
  • the term “homology” can be equated with "identity”.
  • a homologous sequence is taken to include an amino acid or a nucleotide sequence which may be at least 50, 60, 70, 75, 80, 85 or 90% identical, in some embodiments at least 95, 96, 97, 98 or 99% identical to the subject sequence.
  • homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
  • a homologous sequence is taken to include an amino acid sequence or nucleotide sequence which has one or several additions, deletions and/or substitutions compared with the subject sequence.
  • the present invention relates to the use of a protein whose amino acid sequence is represented herein or a protein derived from this (parent) protein by substitution, deletion or addition of one or several amino acids, such as 2, 3, 4, 5, 6, 7, 8, 9 amino acids, or more amino acids, such as 10 or more than 10 amino acids in the amino acid sequence of the parent protein and having the activity of the parent protein.
  • the present invention relates to the use of a nucleic acid sequence (or gene) encoding a protein whose amino acid sequence is represented herein or encoding a protein derived from this (parent) protein by substitution, deletion or addition of one or several amino acids, such as 2, 3, 4, 5, 6, 7, 8, 9 amino acids, or more amino acids, such as 10 or more than 10 amino acids in the amino acid sequence of the parent protein and having the activity of the parent protein.
  • a homologous sequence is taken to include a nucleotide sequence which may be at least 50, 60, 70, 75, 85 or 90% identical, in some embodiments at least 95, 96, 97, 98 or 99% identical to a nucleotide sequence encoding a polypeptide described herein (the subject sequence).
  • the homologues will comprise the same or equivalent sequences that code for the domain(s) etc. as the subject sequence.
  • homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity.
  • the homologous amino acid sequence and/or nucleotide sequence may provide and/or encode a polypeptide which retains the functional activity and/or enhances the activity of the polypeptide.
  • an amino acid sequence as described herein has at least 50, 60, 70, 75, 80, 85 or 90% identity, in some embodiments at least 95, 96, 97, 98 or 99% identity to the subject sequence.
  • a nucleotide sequence as described herein has at least 50, 60, 70, 75, 80, 85 or 90% identity, in some embodiments at least 95, 96, 97, 98 or 99% identity to the subject sequence.
  • Homology comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate % homology between two or more sequences.
  • % homology may be calculated over contiguous sequences, i.e. one sequence is aligned with the other sequence and each amino acid in one sequence is directly compared with the corresponding amino acid in the other sequence, one residue at a time. This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues. Although this is a very simple and consistent method, it fails to take into consideration that, for example, in an otherwise identical pair of sequences, one insertion or deletion will cause the following amino acid residues to be put out of alignment, thus potentially resulting in a large reduction in % homology when a global alignment is performed. Consequently, most sequence comparison methods are designed to produce optimal alignments that take into consideration possible insertions and deletions without penalizing unduly the overall homology score. This is achieved by inserting "gaps" in the sequence alignment to try to maximize local homology.
  • % homology can be measured in terms of identity
  • the alignment process itself is typically not based on an all-or-nothing pair comparison.
  • a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance.
  • An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs.
  • Vector NTI programs generally use either the public default values or a custom symbol comparison table if supplied (see user manual for further details). For some applications, it is preferred to use the default values for the Vector NTI package.
  • percentage homologies may be calculated using the multiple alignment feature in Vector NTI (Invitrogen Corp.), based on an algorithm, analogous to CLUSTAL (Higgins DG & Sharp PM (1988), Gene 73(1), 237-244).
  • CLUSTAL Higgins DG & Sharp PM (1988), Gene 73(1), 237-244
  • CLUSTAL may be used with the gap penalty and gap extension set as defined above.
  • the degree of identity with regard to a nucleotide sequence is determined over at least 20 contiguous nucleotides, for example over at least 30 contiguous nucleotides, for example over at least 40 contiguous nucleotides, for example over at least 50 contiguous nucleotides, for example over at least 60 contiguous nucleotides, for example over at least 100 contiguous nucleotides, for example over at least 200 contiguous nucleotides, for example over at least 300 contiguous nucleotides.
  • the degree of identity with regard to a nucleotide sequence may be determined over the whole sequence.
  • the Roseburia flagellin polypeptide and/or polynucleotide sequence for use in the present invention is a recombinant sequence - i.e. a sequence that has been prepared using recombinant DNA techniques.
  • the Roseburia flagellin polynucleotide sequence for use in the present invention is a synthetic sequence - i.e. a sequence that has been prepared by in vitro chemical or enzymatic synthesis. It includes, but is not limited to, sequences made with optimal codon usage for host organisms - such as the methylotrophic yeasts Pichia and Hansenula. Expression of enzymes
  • the nucleotide sequence for use in the present invention may be incorporated into a recombinant replicable vector.
  • the vector may be used to replicate and express the nucleotide sequence, in protein form, in and/or from a compatible host cell.
  • Expression may be controlled using control sequences e.g. regulatory sequences.
  • the protein produced by a host recombinant cell by expression of the nucleotide sequence may be secreted or may be contained intracellular ⁇ depending on the sequence and/or the vector used.
  • the coding sequences may be designed with signal sequences which direct secretion of the substance coding sequences through a particular prokaryotic or eukaryotic cell membrane.
  • the present invention relates to a vector (such as an expression vector) comprising at least one polynucleotide sequence encoding at least one Roseburia flagellin.
  • expression vector means a construct capable of in vivo or in vitro expression.
  • the expression vector is incorporated into the genome of a suitable host organism.
  • the term "incorporated” in one aspect covers stable incorporation into the genome.
  • the nucleotide sequence of the present description may be present in a vector in which the nucleotide sequence is operably linked to regulatory sequences capable of providing for the expression of the nucleotide sequence by a suitable host cell or host organism.
  • the vectors for use in the present invention may be transformed into a suitable host cell or host organism as described herein to provide for expression of a polypeptide of the present description.
  • a suitable host cell or host organism as described herein to provide for expression of a polypeptide of the present description.
  • the choice of vector e.g. a plasmid, cosmid, or phage vector will often depend on the host cell into which it is to be introduced.
  • the vectors for use in the present invention may contain one or more selectable marker genes- such as a gene, which confers antibiotic resistance e.g. ampicillin, kanamycin, chloramphenicol or tetracyclin resistance.
  • selectable marker genes such as a gene, which confers antibiotic resistance e.g. ampicillin, kanamycin, chloramphenicol or tetracyclin resistance.
  • the selection may be accomplished by co-transformation (as described in W091/17243).
  • Vectors may be used in vitro, for example for the production of RNA or used to transfect, transform, transduce or infect a host cell.
  • the description provides a method of making nucleotide sequences of the present description by introducing a nucleotide sequence of the present description into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector.
  • the vector may further comprise a nucleotide sequence enabling the vector to replicate in the host cell in question.
  • a nucleotide sequence enabling the vector to replicate in the host cell in question.
  • sequences are the origins of replication of plasmids pUC19, pACYC177 : pUB1 10, pE194, pAMB1 and plJ702.
  • An expression vector may comprise at least two, three, four or five polynucleotide sequences encoding Roseburia flagellins. Examples of expression vectors include pGEX-6P-1 , pCR-Blunt ll-TOPO and T7-MAT- Tag-FLAG-.
  • the expression vector pGEX-6P-1 may be used for cloning recombinant flagellins.
  • the expression vector pGEX-6P-1 comprises a tac promoter for chemically inducible, high- level expression of GST-tagged recombinant proteins, an internal laclq gene for use in any E. coli host, an AmpR gene for ampicillin selection and a PreScission Protease site for cleaving, if desired, the protein from the fusion product .
  • the cloning vector pCR-Blunt ll-TOPO may be used for cloning recombinant flagellins, in particular those which are insoluble after cell lysis. Typically this vector allows high-efficiency DNA cloning of blunt-end PCR products.
  • the vector comprises Kanamycin and Zeocin resistance genes for selection in E. coli, and the insert is flanked by multiples restriction sites for excision.
  • Expression vector T7-MAT-Tag-FI_AG- may be used for cloning recombinant flagellins, in particular those which insoluble after cell lysis.
  • the multi cloning site (MCS) is flanked by MAT (Metal Affinity Tag) sequence and FLAG peptide (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys) sequence, which results in the production of double-tagged flagellin, which can be further purified by affinity columns.
  • This expression vector also comprises a pT7/lac (phage T7 lac operon) promoter for IPTG inducible, high-level expression of MAT-ORF-FLAG recombinant flagellins, an internal lacl gene that represses transcription at basal state in any E. coli host, and an AmpR gene for ampicillin selection.
  • pT7/lac phage T7 lac operon
  • the nucleotide sequence for use in the present invention is operably linked to a regulatory sequence which is capable of providing for the expression of the nucleotide sequence, such as by the chosen host cell.
  • the present invention covers a vector comprising the nucleotide sequence of the present invention operably linked to such a regulatory sequence, i.e. the vector is an expression vector.
  • operably linked refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner.
  • a regulatory sequence "operably linked” to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under condition compatible with the control sequences.
  • regulatory sequences includes promoters and enhancers and other expression regulation signals.
  • promoter is used in the normal sense of the art, e.g. an RNA polymerase binding site.
  • Enhanced expression of the nucleotide sequence encoding a flagellin of the present description may also be achieved by the selection of heterologous regulatory regions, e.g. promoter, secretion leader and terminator regions.
  • heterologous regulatory regions e.g. promoter, secretion leader and terminator regions.
  • the nucleotide sequence according to the present description is operably linked to at least a promoter.
  • promoters may even be used to direct expression of the polypeptide of the present description.
  • promoters for directing the transcription of the nucleotide sequence in a bacterial, fungal or yeast host are well known in the art.
  • the promoter can additionally include features to ensure or to increase expression in a suitable host.
  • the features can be conserved regions such as a Pribnow Box or a TATA box.
  • construct which is synonymous with terms such as “conjugate”, “cassette” and “hybrid” - includes a nucleotide sequence for use according to the present invention directly or indirectly attached to a promoter.
  • An example of an indirect attachment is the provision of a suitable spacer group such as an intron sequence, such as the Sh1-intron or the ADH intron, intermediate the promoter and the nucleotide sequence of the present description.
  • intron sequence such as the Sh1-intron or the ADH intron
  • fused in relation to the present description which includes direct or indirect attachment.
  • the terms do not cover the natural combination of the nucleotide sequence coding for the protein ordinarily associated with the wild type gene promoter and when they are both in their natural environment.
  • the construct may even contain or express a marker, which allows for the selection of the genetic construct.
  • the construct of the present description comprises at least the nucleotide sequence of the present description operably linked to a promoter.
  • host cell in relation to the present description includes any cell that comprises the nucleotide sequence and/or an expression vector as described herein. Typically the host cell is capable of the recombinant production of a protein having the specific properties as defined herein.
  • Examples of host cells include bacteria such as Roseburia spp. and competent cells.
  • Examples of Roseburia spp are Roseburia hominis, Roseburia triocola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans.
  • Examples of competent cells include competent E. coli cells (such as E. coli BL21 (DE3) pLysS and/or E. coli B21 Rosetta).
  • a further embodiment of the present description provides host cells transformed or transfected with a nucleotide sequence of the present description.
  • a further embodiment of the present description provides host cells transformed or transfected with a nucleotide sequence (e.g. a promoter such as a heterologous promoter or an exogenous) that is capable of upregulating (overexpressing) the expression of a nucleotide sequence (e.g. gene - such as a homologous gene or an endogenous gene) encoding a flagellin of the present description when compared to the equivalent microorganism prior to transformation.
  • the cells will be chosen to be compatible with the said vector and may for example be bacterial (e.g. prokaryotic), fungal, or yeast cells.
  • nucleotide sequence encoding the flagellin of the present description may be
  • heterologous or homologous to the host cell typically when the nucleotide sequence encoding the flagellin is homologous to the host cell the host cell comprises multiple copies of the nucleotide sequence.
  • the nucleotide sequence encoding the flagellin is operably linked to a heterologous promoter; typically said promoter is capable of upregulating (overexpressing) the homologous nucleotide sequence encoding the flagellin.
  • the host cell comprises the nucleotide sequence coding for the flagellin polypeptide of the present description (such as a homologous or endogenous nucleotide sequence) under the control of a heterologous or exogenous promoter.
  • the host cell is transformed or transfected with one or more nucleotide sequences that encodes at least one flagellin (e.g. Roseburia flagellin) selected from the group consisting of Fla1 , Fla2, Fla3 and Fla4.
  • the host cell is transformed or transfected with one or more nucleotide sequences that encode at least one flagellin (e.g. Roseburia flagellin) selected from the group consisting of Fla2, Fla1 and Fla4.
  • the host cell is transformed or transfected with a nucleotide sequences that encodes the flagellin (e.g. Roseburia flagellin) Fla2.
  • the host cell may comprise multiple copies of polynucleotide sequences encoding Roseburia flagellins.
  • a host cell may comprise at least 1 , 2, 3, 4 or 5 polynucleotide sequences encoding at least 1 , 2, 3, 4 or 5 Roseburia flagellins.
  • the host cell comprises a polynucleotide sequence encoding at least one Roseburia flagellin derived or derivable from one Roseburia species and at least one further polynucleotide sequence encoding at least one Roseburia flagellin derived or derivable from a different Roseburia species.
  • the host cell comprises at least one polynucleotide sequence encoding an R. hominis flagellin (e.g. Fla1 or Fla2) and at least one polynucleotide sequence encoding a R. intestinalis flagellin (e.g. Fla1 or Fla 2).
  • a host cell may comprise at least 1 , 2, 3, 4 or 5 expression vectors comprising at least 1 , 2, 3, 4 or 5 polynucleotide sequences encoding Roseburia flagellin.
  • the host cell comprises an expression vector comprising a polynucleotide sequence encoding Roseburia flagellins derived or derivable from one Roseburia species and at least one further expression vector comprising a polynucleotide sequence encoding Roseburia flagellins derived or derivable from a different Roseburia species.
  • the host cell comprises at least one expression vector comprising a polynucleotide sequence encoding an R. hominis flagellin (e.g. Fla1 or Fla2) and at least one expression vector comprising a polynucleotide sequence encoding a R. intestinalis flagellin (e.g. Fla1 or Fla 2).
  • the nucleotide sequence encoding the flagellin may be endogenous or exogenous to the host cell. Typically when the nucleotide sequence encoding the flagellin is endogenous to the host cell the host cell comprises multiple copies of the nucleotide sequence.
  • the nucleotide sequence encoding the flagellin is operably linked to an exogenous promoter; typically said promoter is capable of upregulating (overexpressing) the endogenous nucleotide sequence encoding the flagellin.
  • Suitable bacterial host organisms are gram positive or gram negative bacterial species.
  • the host cell is a microorganism.
  • the host cell is a lactic acid bacterium species, Lactococcus species, a Bifidobacterium species, a Lactobacillus species or a Propionibacterium species.
  • lactic acid bacteria examples include, but are not limited to, Lactobacillus spp., Leuconostoc spp., Pediococcus spp. , Lactococcus spp., Streptococcus spp., Aerococcus spp., Carnobacterium spp., Enterococcus spp., Oenococcus spp., Sporolactobacillus spp., Tetragenococcus spp., Vagococcus spp. , and Weisella spp.
  • Lactobacillus spp examples include Lactobacillus paracasei, L. acidophilus, L. fermentum, L brevis, L. gasseri, L plantarum, L. bulgaricus, L. helveticus, L. reuteri, L. casei, L. jensenii,
  • L. rhamnosus L. crispatus, L. johnsonii, L. salivarius, L. acetotolerans, L. acidifarinae, L acidipiscis, L. agilis, L. algidus, L. alimentarius, L. amylolyticus, L amylophilus, L.
  • amylotrophicus L. amylovorus
  • L. animalis L. antri
  • L. apodemi L aviarius
  • L. bifermentans
  • L. harbinensis L. hayakitensis, L. hilgardii, L. homohiochii, L. iners, L. ingluviei, L. intestinalis, L kalixensis, L. kefiranofaciens, L. kefiri, L. kimchii, L. kitasatonis, L. kunkeei, L. leichmannii,
  • pantheris L. parabrevis, L. parabuchneri, L. paracollinoides, L. parafarraginis, L. parakefiri, L. paralimentarius, L paraplantarum, L. pentosus, L. perolens, L. pontis, L. psittaci, L. rennini, L. rimae, L. rogosae, L. rossiae, L. ruminis, L. saerimneri, L. sakei, L. sanfranciscensis, L. satsumensis, L. secaliphilus, L. sharpeae, L. siliginis, L. spicheri, L. suebicus, L.
  • Propionibacterium examples include, but are not limited to Propionibacterium
  • PAB freudenrechli subsp. shermanii
  • Propionibacterium acidifaciens Propionibacterium acidipropionici
  • Propionibacterium acnes Propionibacterium austraiiense
  • Propionibacterium avidum Propionibacterium cyclohexanicum
  • Propionibacterium is Propionibacterium freudenrelchli subsp.
  • PAB shermanii
  • Bifidobacterium examples include, but are not limited to, Bifidobacterium adoiescentis, B. breve, B. longum, B. animalis, B. infantis, B. thermophilum, B. bifidum, Bifidobacterium catenulatum, Bifidobacterium pseudocatenulatum, Bifidobacterium angulatum and B. lactis.
  • the host cell is a Firmicute - for example a Roseburia species such as Roseburia hominis, Roseburia triocola, Roseburia faecis, Roseburia intestinalis, or Roseburia inulinivorans).
  • the host cell comprises at least one heterologous polynucleotide sequence encoding a Roseburia flagellin.
  • the host cell comprises at least two copies of a homologous polynucleotide sequence encoding a Roseburia flagellin; for instance, the host cell comprises at least 3, 4 or 5 homologous copies of a polynucleotide sequence encoding a Roseburia flagellin.
  • eukaryotic hosts such as yeasts or other fungi may be used.
  • yeast cells are used over fungal cells because they are easier to manipulate.
  • some proteins are either poorly secreted from the yeast cell, or in some cases are not processed properly (e.g. hyperglycosylation in yeast). In these instances, a different fungal host organism should be selected.
  • suitable host cells - such as yeast, fungal and plant host cells - may provide for post-translational modifications (e.g. myristoylation, glycosylation, truncation, lipidation and tyrosine, serine or threonine phosphorylation) as may be needed to confer optimal biological activity on recombinant expression products of the present description.
  • the host cell may be a protease deficient or protease minus strain. This may for example be the protease deficient strain Aspergillus oryzae JaL 125 having the alkaline protease gene named "alp" deleted. This strain is described in W097/35956.
  • the term "host cell” does not cover native nucleotide coding sequences in their natural environment when they are under the control of their native promoter which is also in its natural environment.
  • organism in relation to the present description includes any organism that could comprise the nucleotide sequence coding for the polypeptide according to the present description and/or products obtained therefrom, and/or wherein a promoter can allow expression of the nucleotide sequence according to the present description when present in the organism.
  • Suitable organisms may include a bacterium (such as a prokaryote), a fungus, a yeast or a plant.
  • the term "transgenic organism” in relation to the present description includes any organism that comprises the nucleotide sequence coding for the polypeptide according to the present description and/or the products obtained therefrom, and/or wherein a promoter can allow expression of the nucleotide sequence according to the present description within the organism.
  • the nucleotide sequence is incorporated in the genome of the organism.
  • transgenic organism does not cover native nucleotide coding sequences in their natural environment when they are under the control of their native promoter which is also in its natural environment.
  • the transgenic organism of the present description includes an organism comprising any one of, or combinations of, the nucleotide sequence coding for the polypeptide according to the present description, constructs according to the present description, vectors according to the present description, plasmids according to the present description, cells according to the present description, or the products thereof.
  • the transgenic organism may comprise the nucleotide sequence coding for the polypeptide of the present description (such as a homologous nucleotide sequence) under the control of a heterologous promoter.
  • the host organism can be a prokaryotic or a eukaryotic organism.
  • suitable prokaryotic hosts include Roseburia hominis, Roseburia triocola, Roseburia faecis, Roseburia intestinalis, Roseburia inulinivorans, E. coli and Bacillus subtilis.
  • Teachings on the transformation of prokaryotic hosts is well documented in the art, for example see Sambrook et al (Molecular Cloning: A Laboratory Manual, 2nd edition, 1989, Cold Spring Harbor Laboratory Press). If a prokaryotic host is used then the nucleotide sequence may need to be suitably modified before transformation - such as by removal of introns.
  • Filamentous fungi cells may be transformed using various methods known in the art - such as a process involving protoplast formation and transformation of the protoplasts followed by regeneration of the cell wall in a manner known.
  • Aspergillus as a host microorganism is described in EP 0 238 023.
  • Another host organism can be a plant.
  • a review of the general techniques used for transforming plants may be found in articles by Potrykus (Annu Rev Plant Physiol Plant Mol Biol [1991] 42:205-225) and Christou (Agro-Food-Industry Hi-Tech March/April 1994 17-27). Further teachings on plant transformation may be found in EP-A-0449375.
  • a host organism may be a fungus - such as a mould.
  • suitable such hosts include any member belonging to the genera Thermomyces, Acremonium, Aspergillus, Penicillium, Mucor, Neurospora, Trichoderma and the like.
  • the host organism may be a filamentous fungus.
  • Transforming filamentous fungi is discussed in US-A-5741665 which states that standard techniques for transformation of filamentous fungi and culturing the fungi are well known in the art. An extensive review of techniques as applied to N. crassa is found, for example in Davis and de Serres, Methods Enzymol (1971) 17A: 79-143. Further teachings which may also be utilised in transforming filamentous fungi are reviewed in US-A-5674707.
  • the present description encompasses the production of transgenic filamentous fungi according to the present description prepared by use of these standard techniques.
  • the host organism can be of the genus Aspergillus, such as Aspergillus niger.
  • a transgenic Aspergillus according to the present description can also be prepared by following, for example, the teachings of Turner G. 1994 (Vectors for genetic manipulation. In: Martinelli S.D., Kinghorn J.R.( Editors) Aspergillus: 50 years on. Progress in industrial microbiology vol 29. Elsevier Amsterdam 1994. pp. 641-666).
  • the transgenic organism can be a yeast.
  • yeast - such as the species Saccharomyces cerevisi or Pichia pastoris (see FEMS Microbiol Rev (2000 24(1 ):45-66), may be used as a vehicle for heterologous gene expression.
  • transgenic Saccharomyces can be prepared by following the teachings of Hinnen et al., (1978, Proceedings of the National Academy of Sciences of the USA 75, 1929); Beggs, J D (1978, Nature, London, 275, 104); and Ito, H et al (1983, J Bacteriology 153, 163-168).
  • the transformed yeast cells may be selected using various selective markers - such as auxotrophic markers dominant antibiotic resistance markers.
  • a host organism suitable for the present description may be a plant.
  • the basic principle in the construction of genetically modified plants is to insert genetic information in the plant genome so as to obtain a stable maintenance of the inserted genetic material.
  • a review of the general techniques may be found in articles by Potrykus (Annu Rev Plant Physiol Plant Mol Biol [1991] 42:205-225) and Christou (Agro-Food-Industry Hi-Tech March/April 1994 17-27).
  • Plant cells may be grown and maintained in accordance with well-known tissue culturing methods such as by culturing the cells in a suitable culture medium supplied with the necessary growth factors such as amino acids, plant hormones, vitamins, etc.
  • the present description relates to a vector system which carries a nucleotide sequence or construct according to the present description and which is capable of introducing the nucleotide sequence or construct into the genome of an organism, such as a plant.
  • the vector system may comprise one vector, but it may comprise two vectors. In the case of two vectors, the vector system is normally referred to as a binary vector system.
  • Binary vector systems are described in further detail in Gynheung An et al., (1980), Binary Vectors, Plant Molecular Biology Manual A3, 1-19.
  • T-DNA for the transformation of plant cells, at least the right boundary and often however the right and the left boundary of the Ti- and Ri-plasmid T-DNA, as flanking areas of the introduced genes, can be connected.
  • T-DNA for the transformation of plant cells has been intensively studied and is described in EP-A-120516; Hoekema, in: The Binary Plant Vector System Offset-drukkerij Kanters B.B., Alblasserdam, 1985, Chapter V; Fraley, et al., Crit. Rev. Plant Sci., 4:1-46; and An ef al., EMBO J. (1985) 4:277-284.
  • Host cells transformed with the nucleotide sequence of the present description and/or an expression vector of the present description may be cultured under conditions conducive to the production of the encoded polypeptide and which facilitate recovery of the polypeptide from the cells and/or culture medium.
  • the medium used to cultivate the cells may be any conventional medium suitable for growing the host cell in questions and obtaining expression of the polypeptide.
  • the protein produced by a recombinant cell may be displayed on the surface of the cell.
  • the protein may be secreted from the host cells and may conveniently be recovered from the culture medium using well-known procedures. Secretion
  • the protein is secreted from the expression host into the culture medium from where the protein may be recovered.
  • the secretion leader sequence may be selected on the basis of the desired expression host.
  • Hybrid signal sequences may also be used with the context of the present description.
  • heterologous secretion leader sequences are those originating from the fungal amyloglucosidase (AG) gene (g/aA - both 18 and 24 amino acid versions e.g. from Aspergillus), the a-factor gene (yeasts e.g. Saccharomyces, Kluyveromyces and Hansenula) or the a-amylase gene (Bacillus).
  • AG fungal amyloglucosidase
  • ELISA enzyme-linked immunosorbent assay
  • RIA radioimmunoassay
  • FACS fluorescent activated cell sorting
  • Suitable reporter molecules or labels include those radionuclides, enzymes, fluorescent, chemiluminescent, or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles and the like.
  • Patents teaching the use of such labels include US-A- 3,817,837; US-A-3,850,752; US-A-3,939,350; US-A-3,996,345; US-A-4,277,437; US-A- 4,275, 149 and US-A-4,366,241.
  • recombinant immunoglobulins may be produced as shown in US-A-4, 816,567. Fusion proteins
  • the amino acid sequence for use according to the present description may be produced as a fusion protein, for example to aid in extraction and purification.
  • fusion protein partners include glutathione-S-transferase (GST), 6xHis, GAL4 (DNA binding and/or transcriptional activation domains) and ( ⁇ -galactosidase). It may also be convenient to include a proteolytic cleavage site between the fusion protein partner and the protein sequence of interest to allow removal of fusion protein sequences.
  • the fusion protein will not hinder the activity of the protein sequence.
  • the amino acid sequence may be ligated to a heterologous sequence to encode a fusion protein.
  • a heterologous sequence for example, for screening of peptide libraries for agents capable of affecting the substance activity, it may be useful to encode a chimeric substance expressing a heterologous epitope that is recognised by a commercially available antibody.
  • Flagellins from Roseburia genus bacteria in particular, Roseburia hominis and
  • Roseburia intestinalis were cloned, expressed, purified and analysed.
  • Figure B1A and B1 B show an SDS-Analysis of recombinant flagellins.
  • Roseburia hominis FlaA1 (This is also referred herein as RhFlaAI or Rh1 )
  • RhFlaA2 Roseburia hominis FlaA2 (This is also referred herein as RhFlaA2 or Rh2)
  • Roseburia intestinalis FlaA1 (This is also referred herein as RiFlaAI or RM or RM)
  • Roseburia intestinalis FlaA2 (This is also referred herein as RiFlaA2 or Ri2 or RI2)
  • Roseburia intestinalis FlaA3 (This is also referred herein as RiFlaA3 or Ri3 or RI3)
  • Roseburia intestinalis FlaA4 (This is also referred herein as RiFlaAI or
  • a family of six flagellin genes contributes to the Caulobacter crescentus flagellar filament. Journal of Bacteriology, 182(17), pp. 5001 -5004.
  • IBRAHIM G.F., FLEET, G.H., LYONS, M.J. and WALKER, R.A., 1985. Method for the isolation of highly purified Salmonella flagellins. Journal of clinical microbiology, 22(6), pp. 1040-1044.
  • NEVILLE B.A., FORDE, B.M., CLAESSON, M.J., DARBY, T., COGHLAN, A., NALLY, K., ROSS, R.P. and OTOOLE, P.W., 2012. Characterization of pro-inflammatory flagellin proteins produced by Lactobacillus ruminis and related motile Lactobacilli. PloS one, 7(7), pp. e40592.
  • C3H/HeN and C57BI/6 were purchased from Harlan Laboratories.
  • GF C3H/HeN were provided and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France).
  • GF TLR5KO and wild type C57BI/6 were provided by Andrew Gewirtz (Center for Inflammation, Immunity, and Infection and Department of Biology, Georgia State University, Atlanta, GA 30303, USA) and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas.
  • Germfree animal experiments were performed in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France).
  • animals in the treatment group were given 100 ⁇ _ of R. hominis culture by gavage, while control animals were given 100 ⁇ _ YCFA media. Ileum, ascending colon and caecum samples were collected at 14d and 28d.
  • Six GF C3H/HeN male mice were treated with E.
  • mice were inoculated with R. hominis culture as described above to evaluate the functional importance of R. hominis flagellins. After 28d these animals were sacrificed together with their GF counterparts. Twenty-two female C57BL/6 mice were dosed daily with 50 ⁇ _ of 10 9 CFU R. hominis for 14 days. Control animals were dosed with culture medium alone. From day 8, mice were given DSS (MW 50kDa, 30g/l) in their drinking water for 6 days. The animals were euthanized on day 14 and tissue sampling was performed as described above. Tissue culture experiments
  • Caco-2 (Homo sapiens epithelial colorectal adenocarcinoma cells) and HT29 ⁇ Homo sapiens colorectal adenocarcinoma) cells were grown in transwell plates within an anaerobic workstation.
  • R. hominis A2-183 culture or R. intestinalis L1-82 T was harvested at exponential phase, and 100 ⁇ !_ of bacterial suspension (10 8 CFU/mL) was added to experimental wells.
  • Bacterial (non-adherent and adherent) and eukaryotic cells (Caco-2 and HT-29) were harvested after 2h and 4h incubation and stored in RNAIater.
  • FISH analysis was performed on neutral buffered formalin-fixed gut tissue sections using a general bacterial probe Eub338 and a newly designed R. hominis A2-183-specific probe and a R. intestinalis L1-82 T specific probe.
  • the R. ?om/n/s-specific primers 5'-CCCACTGACAGAGTATGTAATGTAC-3' and 5'- GCACCACCTGTCACCAC-3' were used for PCR analysis of faecal samples to validate gut colonization levels.
  • Real-time PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the Power SYBR Green PCR Master Mix (Applied Biosystems). All samples were run in triplicate. GyrA was used as a reference gene for normalization.
  • total eukaryotic RNA isolated from the ileum and ascending colon was reverse-transcribed into cDNA using the High Capacity cDNA Reverse Transcription Kit (Applied Biosystems).
  • Real-time PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the QuantiFast SYBR Green PCR Kit (Qiagen) and QuantiTect Primer Assays (Qiagen). All samples were run in triplicate. Hprt was selected as a reference gene for normalization. All RT-PCR data were analyzed on a logarithmic scale with base 2 by one-way ANOVA with a significance cut-off of P ⁇ 0.05. Differences were back-transformed to calculate fold changes. Western blot
  • FlaA1 and FlaA2 antibodies were used at 1 :1000 and loading control anti-DNA gyrase A (Abeam) at 1 :300, followed by alkaline phosphatase conjugated anti-rabbit. Detection was by substrate colour development relative to loading control colour development.
  • T cell markers were examined on sequential 8 ⁇ cryosection. Fixed tissue sections were incubated with Ly6G-FITC, CD3-FITC, CD1 1 b-FITC (BD Biosciences), double-labelled with FoxP3 (Abeam) and CD3-FITC (BD Biosciences) primary antibody or isospecific IgG. Sections were counterstained with DAPI and mounted with Vectashield (Vector Laboratories). For quantification of positive cells, a minimum of five fields of view from each mouse section was examined.
  • Flagellin genes were isolated from liquid bacterial cultures of R. hominis, R. intestinalis, S. typhimurium, S. enteritidis, Eubacterium rectale 33656 and E. coli K12 by PCR amplification and purification. Caco-2 cells were incubated with recombinant flagellins at a final concentration of 100 ng/ ⁇ . for 2h at 37°C in a 75% humidified atmosphere of 5% C02. Isolation of intestinal and MLN cells
  • Bone marrow was harvested from femur and tibia of C3H/HeN and C57BI6 mice.
  • GMCSF-derived dendritic cells bone marrow cells were resuspended at 1x10 6 /mL in RPMI supplemented with 10% FCS and 20ng/mL rmGM-CSF and seeded at 10ml_/plate in 100mm 2 tissue culture plates. After three days culture, loosely adherent cells were collected and replated with GM-CSF supplemented media at 1x10 6 /mL in 12 well tissue culture plates. At day 5, cells were stimulated with 100ng/mL flagellins before being harvested on day 6.
  • Flt3L-derived dendritic cells bone marrow cells were resuspended at 2x10 6 /ml_ in RPMI supplemented with 10% FCS and 200ng/mL rmFlt3 and seeded at 2mL/well in 12-well tissue culture plates. Cells were cultured for 10 days with Flt3 supplemented media added to each well on day 4. At day 9, cells were stimulated with 100ng/ml_ flagellins before being harvested on day 10 and analyzed by flow cytometry.
  • GMCSF-derived dendritic cells were labelled with antibodies CD11c-PE-Cy7, CD1 1-PerCP Cy5, l-A l-E -APC-Cy7, CD80-PE, CD86-APC, CD8-FITC, B220-BV570.
  • Flt3 derived dendritic cells were labelled with CD11 c-PE-Cy7-, CD1 1 b- or Siglec-H-PerCP Cy5-, l-A/l-E -APC-Cy7, CD317 -PE, CD40-APC, CD103-FITC, B220-BV570 Cells were analyzed using a FACSArria (BD Biosciences) and FlowJo software version 7.2.5.
  • CBA Cytometric Bead Array
  • flagellin e.g. Roseburia flagellin
  • CBA analysis was performed on cell supernatants using the Cytometric Bead Array Mouse Enhanced Sensitivity Master Buffer Kit (BD Biosciences). Standards and samples were loaded onto a 96-well plate for measurement in a FACSArray (BD Biosciences). Results were analyzed using BD FCAP software (BD Biosciences).
  • Ascending colon tissue samples were fixed in neutral buffered formalin (Sigma), embedded in cold-curing resin, and 4 m tissue sections were stained using standard haemotoxylin/eosin methods.
  • a complete transverse cross sectional area of colon from each animal was imaged at x200 magnification on a Zeiss Axioskop microscope using a Qlmaging camera controlled by Image Pro Plus software.
  • Each field of view was then scored from 0-4 according to a method based on Berg et al. (Berg et al. 1996). The mean percentage of fields of view at a given grade was calculated and treatment groups were compared using student t-test analysis.
  • R. hominis was grown in YCFA media overnight at 37 " C. The culture was spun down and the pellet was resuspended in one mL of YCFA media, supplemented with 2% cysteine (w/v, Sigma-Aldrich) and 3% ascorbic acid (w/v, Sigma-Aldrich).
  • C3H/HeN and C57BI/6 were purchased from Harlan Laboratories. Mice were housed within HEPA-filtered flexi-film isolators (Bell Isolation Systems) at the University of Aberdeen. GF C3H/HeN were provided and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France).
  • Germfree TLR5KO and wild type C57BI/6 were provided by Andrew Gewirtz (Center for Inflammation, Immunity, and Infection and Department of Biology, Georgia State University, Atlanta, GA 30303, USA) and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas. The management and experimental procedures were approved by the respective Local Ethical Review Committees. Mouse experiments
  • mice Twenty-two female C57BL/6 mice (6 weeks old) were used to evaluate the therapeutic effect of R. hominis during DSS-induced colitis. After an acclimatization period of 7- 0 days, the mice were dosed daily with 50 ⁇ _ of 10 9 CFU R. hominis for 14 days. Control animals were dosed with culture medium alone. From day 8, mice were given DSS (MW 50kDa, 30g/l) in their drinking water for 6 days. The animals were euthanized on day 14 and tissue sampling was performed as described above.
  • R. hominis A2-183 culture was harvested at exponential phase by centrifugation at 3,500xg for 5 min. The pellet was washed and resuspended in 0.8 ml_ anaerobic DMEM. One hundred microliters of bacterial suspension (10 8 CFU/mL) was added to experimental wells. The control wells received the same amount of medium without bacterial cells. Additional controls included bacterial cells incubated without Caco-2 or HT29 cells. Bacterial and eukaryotic cells were harvested after 2h and 4h incubation. Both non-adherent and adherent bacteria were aspirated and stored in RNAIater (Ambion). The viability of R. hominis cells was tested by plating onto YCFA plates.
  • Caco-2 cells or HT-29 cells were harvested from the wells and also stored in RNAIater.
  • One hundred microliters of bacterial suspension (10 8 CFU/mL) was added to experimental wells. The control wells received the same amount of medium without bacterial cells. Additional controls included bacterial cells incubated without Caco-2 or HT29 cells.
  • Bacterial and eukaryotic cells were harvested after 2h and 4h incubation.
  • RNAIater Both nonadherent and adherent bacteria were aspirated and stored in RNAIater (Ambion). The viability of R. intestinalis cells was tested by plating onto YCFA plates. Caco-2 cells or HT-29 cells were harvested from the wells and also stored in RNAIater. For tissue culture experiments with recombinant flagellins, 5x10 4 Caco-2 cells were seeded in 24-well plates in DMEM (high glucose, HEPES) medium supplemented with heat- inactivated fetal bovine serum (Gibco), penicillin, streptomycin, amphotericin B and L- glutamine at 37°C in a 75% humidified atmosphere of 5% C02.
  • DMEM high glucose, HEPES
  • DNA was mechanically sheared using a Nebulizer Kit (Invitrogen) and fractionated by gel electrophoresis, DNA fragments of desired size were excised from the gel and purified using a Wizard® SV Gel and PCR Clean-Up System (Promega). End-repair was done with a DNA Terminator End Repair Kit (Lucigen). 1.5-3.5 kb fragments were cloned using the CloneSmart® LCAmp Kit (Lucigen) and a 4-8 kb library was constructed using the pJAZZ®- OC Vector (Lucigen).
  • Fosmid libraries were constructed using the CopyControlTM Fosmid Library Production Kit (Epicentre Biotechnologies).
  • Colonies were picked using an automated colony picker (BioRobotics BioPick, Genomic Solutions) and archived into 384-well microtitre plates containing 70 2xLB medium supplemented with 10% glycerol and corresponding antibiotic. Cells were grown overnight at 37 °C with shaking and stored at -80 °C.
  • Templates for sequencing of small-size libraries were generated by PCR using one ⁇ of clone biomass and primers SL1 and SR2 surrounding the cloning site of pSMART-LCAmp. PCR products were purified using Multiscreen PCR Clean-up filter plates (Millipore).
  • FosmidMAXTM DNA Purification Kit (Epicentre). End-reads of DNA fragments from R.
  • hominis was also sequenced using 454 GS20 (454 Life Sciences) and 454 FLX sequencers (Roche). The Sanger and 454 data were assembled with MIRA version 3
  • coli plasmid RA8 library of R. hominis were arrayed in duplicate on aminosilane-coated microscope slides (Corning) using a MicroGrid II TAS (BioRobotics). Amplified fragments of the housekeeping genes rpoD and gyrA were randomly distributed on the array as controls. Microarray hybridization was performed in the GeneTAC hybridization station (Genomic Solutions). Dye labelling was swapped for a second hybridization, and a separate RNA purification was also labelled and hybridized twice, to ensure reproducibility and to obtain statistically significant results. In total, four slides were hybridized for each comparison, for a total of 12 hybridizing spots per amplified clone.
  • RNAIater Ileum and ascending colon tissue was removed from RNAIater and lyzed in Trizol (Invitrogen). RNA was isolated using standard chloroform/isopropanol steps. Total RNA was further purified with the RNeasy Kit (Qiagen), including an RNase-free DNase I (Qiagen) digestion step. RNA integrity was determined using the Agilent 2100 Bioanalyzer (Agilent Technologies). Total RNA was processed into biotin-labelled cRNA using the One-Cycle Target Labeling Kit (Affymetrix) or biotin-labelled aRNA using the 3' IVT Express Kit (Affymetrix).
  • Microarray data were submitted to the National Center for Biotechnology Information (NCBI) Gene Expression Omnibus (accession number GSE25544;http://www.ncbi. nlm.nih.gov/geo).
  • the R. hominis-specif ⁇ c primers 5'-CCCACTGACAGAGTATGTAATGTAC-3' and 5'- GCACCACCTGTCACCAC-3' were used for semi-quantitative and Real-time PCR analysis of faecal samples to validate gut colonization levels. Further bacterial PCR primers were designed using the on-line tool Primer3Plus (4) and purchased from Sigma-Aldrich. Realtime PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the Power SYBR Green PCR Master Mix (Applied Biosystems). PCR was performed as follows: one cycle at 95°C for 10 min, followed by 40 cycles at 95°C for 15 sec and 60°C for 1 min, ending with a dissociation step. All samples were run in triplicate. GyrA was used as a reference gene for normalization due to its low variation between samples.
  • RNA For host gene expression, 2 g of total eukaryotic RNA isolated from the ileum and ascending colon was reverse-transcribed into cDNA using the High Capacity cDNA Reverse Transcription Kit (Applied Biosystems) with random primers.
  • Real-time PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the QuantiFast SYBR Green PCR Kit (Qiagen) and QuantiTect Primer Assays (Qiagen). PCR cycling conditions were as follows: one cycle at 95°C for 5 min, followed by 40 cycles at 95°C for 10 seconds and at 60°C for 30 seconds, ending with a dissociation step. All samples were run in triplicate. Hprt was selected as a reference gene for normalization because of its low variation between samples.
  • Immuno-purified rabbit polyclonal antibodies against Roseburia hominis Fla1 and Fla2 was produced as described in Duck ei al. (5). In brief, New Zealand white female rabbits were immunized with synthetic peptide in complete Freund's adjuvant and boosted several times. For R. hominis Fla1 , peptide NH2-CRSQVRGLNKASDNA-CONH 2 and peptide NH2- IDGNFTSKKLQVGSLC-COOH were used, while for R. hominis Fla2, peptide C- AQYNDDAKSVLEILK-COOH and peptide C-GLNKASRNSQDGIS-CONH 2 were used.
  • Fla1 and Fla2 antibodies were diluted 1 :1000 and loading control anti-DNA gyrase A (Abeam) diluted 1 :300 in antibody diluent and incubated overnight at 4°C, followed by 1h at room temperature with alkaline phosphatase conjugated anti-rabbit. Detection was by substrate colour development relative to loading control colour development.
  • Abeam anti-DNA gyrase A
  • Tissues fixed in neutral buffered formalin were embedded in Technovit 8100 (Heraeus Kulzer). Two-micron sections were cut using a rotary microtome (Leica/Reichert Autocut). Three sections were taken per slide at 100 ⁇ , 200 ⁇ and 300 ⁇ into the tissue, resulting in nine sections per animal.
  • the 16S rRNA FISH probes used were a general bacterial probe Eub338 (GCTGCCTCCCGTAGGAGT; Cy3) and a newly designed R. hominis A2-183- specific probe (GTACATTACATACTCTGTCAGTG; FITC), which was extensively tested for specificity against a panel of intestinal bacterial isolates.
  • Ten microliter probe (30 ng/ ⁇ .) in 100 ⁇ . hybridization buffer was applied to the dehydrated sample and incubated at probe- specific temperature.
  • the slides were washed in washing buffer at 50 ° C for 30 min, dipped in ice-cold water to remove residual washing buffer and dried under compressed air flow. Counterstaining was performed with 4',6-diamidino-2-phenylindole (DAPI; Vector Laboratories Inc) and slides were mounted with Vectashield Mounting Medium for fluorescence (Vector Laboratories Inc) to prevent fading.
  • DAPI 4',6-diamidino-2-phenylindole
  • Bacteria were visualized using a Leica DM RBE fluorescence microscope (Leitz GMBH) and photographed with a Penguin 600CL camera (Pixera) and Viewfinder 3.0 software (Studio Lite). High-magnification images (x630) were retrieved using the Apochromatics system (Leica).
  • Sections were fixed in pre-cooled methanol for 30 min at -20 °C. Immuno-localization of T cell markers was examined on sequential cryosections (8 ⁇ ). Sections were fixed either in pre-cooled methanol for 30 min at -20 °C (Ly6G FITC, CD3 FITC, CD1 1 b FITC, all at 1 :50 (BD Biosciences)), or, for the double-labelled FoxP3 (1 :500, Abeam) with CD3 FITC (1 :100, BD Biosciences) fixed in 1% paraformaldehyde (PFA) for 2 min at RT followed by 3 min in 0.01% Triton X in PBS.
  • PFA paraformaldehyde
  • Ascending colon tissue samples were fixed for three hours in neutral buffered formalin (Sigma) at room temperature with constant agitation. The samples rinsed in PBS and then transferred to 70% ethanol and stored at room temperature until orientated for transverse sectioning and embedded in cold-curing resin using Technovit 8100 (Heraeus Kulzer) according to the manufacturer's instructions. The embedded tissue was mounted onto Histoblocs using Technovit 3040 (Heraeus Kulzer). Four micron sections were cut using a rotary microtome (Leica Autocut) fitted with a glass knife (TAAB Laboratories Equipment Ltd.). Tissue sections were stained using standard haemotoxylin/eosin methods.
  • a complete transverse cross sectional area of an ascending colon from each animal was imaged at x200 magnification on a Zeiss Axioskop microscope using a Qlmaging camera controlled by Image Pro Plus software. Each field of view was then scored from 0-4 according to a method based on Berg et ai. (6).
  • Flagellin genes were isolated from liquid bacterial cultures of R. hominis, R. intestinalis, S. typhimurium, S. enteritidis, Eubacterium rectale 33656 and E. coli K 2 by PCR amplification and purification.
  • the purified flagellin fragment from R. hominis was inserted into expression vector pT7-MAT-Tag-FLAG (Sigma) and flagellin fragments from S. enteritidis and £ coli K12 were inserted into expression vector pGEX-6P-1 (GE Healthcare). Recombinant flagellin was expressed by transformation of plasmid DNA into E.
  • Flagellins were recovered from cell lysates with FLAG beads (Sigma) and Ni-NTA (nickel- nitriloacetic) beads (Clontech, Takara) as per the manufacturer's instructions. The purity of the preparation was assessed by SDS-PAGE stained with coomassie blue solution. Activity of the flagellins fragments was determined by Luciferase Assay (Promega) according to the manufacturer's instructions using the NF- ⁇ transformed Caco-2 cell line.
  • Caco-2 cells were incubated with recombinant flagellins at a final concentration of 100 ng/pL for 2h at 37°C in a 75% humidified atmosphere of 5% C02. After the treatment the cells were washed with PBS solution twice and harvested for total RNA isolation.
  • Bone marrow was harvested from femur and tibia of C3H/HeN and C57BI6 mice as previously described (8-1 1 ).
  • GMCSF-derived dendritic cells bone marrow cells were resuspended at 1x10 6 /mL in RPMI supplemented with 10% FCS and 20ng/mL rmGM-CSF and seeded at 10mL/plate in 100mm 2 tissue culture plates. After three days culture, loosely adherent cells were collected and replated with GM-CSF supplemented media at 1x10 6 /mL in 12 well tissue culture plates. At day 5, cells were stimulated with 100ng/mL flagellins before being harvested on day 6.
  • Flt3L-derived dendritic cells bone marrow cells were resuspended at 2x 0 6 /mL in RPMI supplemented with 10% FCS and 200ng/mL rmFlt3 and seeded at 2mL/well in 12-well tissue culture plates. Cells were cultured for 10 days with an additional 2ml_ of Flt3 supplemented media added to each well on day 4. At day 9, cells were stimulated with 100ng/mL flagellins before being harvested on day 10. Cells were harvested from plates by gentle pipetting and analyzed by flow cytometry. Flow Cytometry
  • Lamina propria cells were labelled with antibodies to mouse CD4-FITC and CD25-APC (eBioscience), CD8- APC-Cy7, CD3-PerCP Cy5.5 and B220-BV570 (Biolegend). Intracellular FoxP3-PE (eBioscience) labelling was performed after extracellular staining and cell fixation/permeabilisation according to the manufacturer's instructions (eBioscience).
  • GM-CSF derived dendritic cells were labelled with antibodies CD1 1 b-PerCP Cy5.5 (BD Biosciences), CD1 1 c-PE-Cy7, l-A/l-E -APC-Cy7, CD80-PE, CD86-APC, CD8-FITC, B220-BV570 (Biolegend).
  • Flt3L derived dendritic cells were labelled with CD1 1 c-PE-Cy7-, CD11 b- or Siglec-H-PerCP Cy5.5 (Bioegend), l-A/l-E -APC-Cy7, CD317-PE, CD40-Alexa Fluor 647, CD103-FITC, B220-BV570.
  • Cells were analyzed using a FACSAriall (BD Biosciences) and FlowJo software version 7.2.5. Cytometric Bead Array (CBA)
  • flagellin e.g. Roseburia flagellin
  • CBA analysis was performed on cell supernatants using the Cytometric Bead Array Mouse Enhanced Sensitivity Master Buffer Kit (BD Biosciences) according to the manufacturer's instructions. Standards and samples were loaded onto a 96-well plate for measurement in a FACSArray (BD Biosciences). Results were analyzed using BD FCAP software (BD Biosciences).
  • Eviscerated mouse carcass was weighed, lyophilized to constant weight and then milled for analysis. Lipid content was determined by extraction (1 :100 w/v) with chloroform/methanol (2:1 v/v) as described previously (12).
  • Gram-positive bacteria RH (Roseburia hominis) was incubated for 10 min with a lysozyme concentration of 3 mg/mL. Three hundred and fifty microliters of lysis buffer containing 1 % ⁇ -mercapto-ethanol were then added to the tube to disrupt the cells by vortexing and 250 pL of 100 % ethanol (Molecular grade, Merck) were added. Seven hundreds microliters of the resulting suspension was applied to the RNeasy mini column fitted with a catching tube, centrifuged for 15 seconds at 8.000 x g and the catch emptied. Again, 350 pL of wash buffer was applied to the column, which was centrifuged for 15 s at 8.000 x g and the flow-through discarded.
  • DNA digestion was carried out by adding to each column, 30 units of DNase I mixed with 70 pL of RDD buffer, and incubating at RT for 15 min.
  • the column was washed again as previously described with 350 ⁇ _ of wash buffer, then twice with 500 pL of RPE buffer.
  • 40 ⁇ [_ of RNase-free water were added directly onto the column and incubated 1 min at RT to be centrifuged for 1 min at 8.000 x g.
  • the eluate containing the total RNA was measured spectrophotometrically using Nanodrop technique to determine the concentration.
  • RNA integrity was checked by the RINH genomic department (University of Aberdeen, UK) with an Agilent 2100 Bioanalyzer (Agilent Technologies). RNA with integrity number (RIN) was between 9.5 and 10 was considered excellent quality. Total RNA was stored at -80°C until later use.
  • Total RNA was reverse transcribed using the Quantitect reverse Transcription kit (Qiagen), according to the manufacturer's instructions. Briefly, one microgram of total RNA in a total volume of 12 pL was incubated for 2 min at 42°C with 1 X gDNA wipeout buffer and further mixed with 1X Quantiscript RT buffer (3 ⁇ _), RT primer mix (2 ⁇ _) and Quantiscript reverse transcriptase (1 ⁇ _) in a final volume of 20 ⁇ [_. The reverse transcription program was 15 min at 42°C followed by 3 min at 95°C to inactivate the enzyme. The resulting complementary DNA (cDNA) concentration was 50 ng/ L and the cDNA was stored at -20°C until later use.
  • forward and reverse primers were manually designed and purchased to Sigma- Aldrich (Poole, UK). The amplification by PCR of flagellin fragments was performed with forward primer inserting a Bglll restriction site at 5' end, and reverse primer inserting a Xhol restriction at the 3' end.
  • Reverse primer CTTAGATCTTTTC AAAATCTCAAG CAC
  • Reverse primer (5'-3'): AATGTGGTG GTGGTGGTG GTG CTG CAG AATCTG CAA Roseburia intestinalis (Fla2)
  • Reverse primer CTTAGATCTTTTTAACATTTCCAACAC Roseburia intestinalis (Fla3)
  • Reverse primer (5'-3') CTTAGATCTCTGTAACAGAGAAAGTA
  • Reverse primer (5'-3') TTAGTG GTG GTG ATGATG ATG CTGTAAC AG AGAAAG
  • the flagellin genes were amplified by PCR.
  • the thermal program for amplification was adapted from Fermentas (Fermentas GMBH, Germany) for optimum KOD polymerase (Novagen, Madison, Wl) functions and was 95°C for 2 min for polymerase activation followed by 34 cycles of amplification, 95°C for 20 s, annealing temperature for 10s and 70°C for 20 s ending with 2 min at 70°C using KOD polymerase.
  • the details of the PCR mix are given in Table 1.
  • the PCR products were run on a 1 % agarose gel for 30 min at 120 V and the bands of interest were excised and purified.
  • the insert was first cloned into the cloning vector pCRTM-Blunt ll-TOPO using Zero Blunt TOPO PCR cloning kit (Invitrogen) according to the manufacturer's instructions and by mixing as described in Figure 1A and Table 1.
  • Table 1 Composition of the mix for the insertion of PCR product into pCR-Blunt ll-TOPO cloning vector. Salt solution and vector-enzyme mix were ready-to-use solutions.
  • the PCR reaction was mixed with 1 X Blue-orange loading dye (Promega) and loaded onto a 1% agarose gel (made of agarose 1% diluted in TAE buffer (40 mM Tris base, 0.1 % (v/v) acetic acid, 1 mM EDTA) boiled and poured in a gel tray) containing 0.5 pg/mL of Ethidium bromide to stain nucleic acids. Samples migrated for 30 min under 120 V using TAE as running buffer. When migration was finished, the gel was visualized under ultra-violet (UV) and the product was identified using a reference standard and excised with a clean scalpel.
  • 1 X Blue-orange loading dye Promega
  • the gel slice was then transferred into a pre-weighed eppendorf tube and its weight recorded by subtraction from the empty tube weight.
  • the PCR product was purified.
  • Membrane binding solution was added to the gel slice in a ratio of 10 pL of solution per 10 mg of agarose gel slice.
  • the mixture was then incubated at 65°C for 10 min with frequent vortexing until the gel slice was completely dissolved.
  • the tube was centrifuged briefly at RT to ensure all contents were at the bottom of the tube before progressing to DNA purification. From this point onward the purification PCR involved using Wizard® SV Gel and PCR Clean-up system (Promega, Southampton, UK) according to the manufacturer's instructions.
  • One SV minicolumn per PCR product was placed into a collection tube.
  • the PCR product were added to the SV minicolumn assembly and incubated for 1 min at room temperature (RT).
  • the column was centrifuged at 16.000 x g for 1 min, and the flow-through discarded.
  • the column was then washed by adding 700 ⁇ _ of membrane wash solution and centrifuged for 5 min at RT.
  • the flow-through was discarded and the assembly spun again for 1 min and dried at RT for 2 min to evaporate any residual ethanol.
  • the column was then transferred into a fresh 1.5 mL nuclease-free tube.
  • 25 ⁇ _ of nuclease-free water was applied to the centre of the column and DNA was eluted by 1 min incubation at RT and 1 min spin at 16.000 x g.
  • the concentration of the eluate was measured spectrophotometrically using Nanodrop (Thermo Fisher Scientific) and stored at -20°C.
  • SOC Medium (Sigma) is a rich media used primarily in the recovery step of Escherichia coli competent cell transformations. Use of SOC maximizes the transformation efficiency of competent cells.
  • the positive clones were prepared as minipreps, nanodropped and digested with BamH1 and Xho1 for 2 hours to excise the flagellin.
  • Ligation products were plated on LB agar supplemented with ampicillin 100 pg/mL. Positives clones were prepared as minipreps and transformed into E.coli BL21 (DE3) competent cells. The positives colonies were sequenced with appropriate primers to check the presence of the insert. Glycerol aliquots were made out the positive clones.
  • the expression vectors encoding Roseburia flagellins were further prepared as minipreps and transformed into E.coli competent cells to improve the yield of the purification; for Rh1 , Rh2 and Ri2 the E. coli competent cells were E.coli BL21 Rosetta and for RI3, Ri1 Ri4, Se, St, K12, and Er the £ coli competent cells were E.coli BL21 (DE3).
  • the transformed E.coli e.g. BL21 Rosetta
  • encoding the flagellin gene RH1 or FLaA1
  • ampicillin 100 g mL
  • chloramphenicol 50 g/YnL
  • the culture was induced for 3 hours with 1 mM IPTG under the same conditions, to allow the specific expression of flagellin protein.
  • Bacteria were pelleted by centrifugation 4.000 x g, 4°C, for 10 min and resuspended in 60 mL of buffer 1 (50 mM Tris (pH 7.4), 150 mM NaCI) and sonicated with a Soniprep 150 (Sanyo, Japan), for 1 min when using BL21 (DE3), or 3 min when using Rosetta with 1 min rest after each minute. Cell lysate was centrifuged at 9.000 x g for 10 min at 4°C and the supernatant discarded.
  • buffer 1 50 mM Tris (pH 7.4), 150 mM NaCI
  • Soniprep 150 Soniprep 150
  • the pellet which contains insoluble proteins was resuspended in 60 mL of buffer 2 (50 mM Tris (pH 8.0), 100 mM NaCI, 5 mM EDTA, 0.5% Triton-X100, 1 mM DTT) sonicated again until complete resuspension, and centrifuged at 5.000 x g for 15 min at 4°C.
  • the insoluble fraction was washed a second and a third time with buffer 2. A last wash was carried out using buffer 2 without Tx-100 and DTT, as described above.
  • the insoluble fraction was resuspended using sonication in 4 mL of urea buffer (2 M urea, 50 mM Tris (pH 7.4), 150 mM NaCI) and centrifuged at 5.000 x g, 5 min at RT. The supernatant was discarded by decanting and the pellet was resuspended in 2 mL of 4 M urea, 50 mM Tris (pH7.4), 150 mM NaCI by sonication and centrifuged at 5.000 x g, 5 min at RT.
  • urea buffer 2 M urea, 50 mM Tris (pH 7.4), 150 mM NaCI
  • the supernatant was collected by decanting and the pellet was resuspended in 2 mL of 8 M urea, 50 mM Tris (pH7.4), 150 mM NaCI solution by sonication and centrifuged at 5.000 x g, 5 min at RT.
  • the supernatant was collected by decanting and mixed to the 4M urea fraction, to make a 6M urea solution containing solubilized flagellins.
  • One milliliter of Talon resin (Clontech, Takara, UK) was washed twice with 2 mL of buffer 1 (50 mM Tris (pH7.4), 150 mM NaCI) and centrifugated at 1.000 x g, 2 min at RT.
  • the resin was incubated for 10 min with 300 L of elution buffer (360 mM Tris- HCI, 680 mM imidazole, 360 mM NaCI, 0,35 N HCI, 1.43 M urea), gently mixed, and the eluate was collected after centrifugation at 2.000 x g for 2 min at RT. The elution was repeated once and the two eluates mixed.
  • a second purification step using anti-FLAG M2 magnetic beads (Sigma) was performed to improve the purity of the protein preparation. Four hundred microliters of ultra pure water were slowly added to the eluate of the Talon resin, to obtain a final concentration of 0.9 M urea, suitable for FLAG beads.
  • the nucleotide sequence encoding Fla1 is shown in SEQ ID NO 1 and the amino acid sequence of Fla1 is shown in SEQ ID NO 2.
  • the flagellin structure consists of four domain DO, D1 , D2 and D3. See Figure 4A.
  • N-terminal a-helix starts from Gin 2 and extends up to Ser 32 (NDO).
  • C-terminal a-helix starts from Ala 459 and extends down to Ser 491 (CDO).
  • the spoke region which connects DO and D1 domains, consists of two chains (Ns and Cs), one from Ser 32 to Ala 44 and the other from Glu 454 to Ala 459.
  • N-terminal segment extends from Ala 44 to Gin 176 and the C-terminal segment from Asn 406 to Glu 454.
  • N-terminal segment is made of an a-helix (from Ala 44 to Ala 99) (ND1a), followed up by a loop connecting to the second, shorter a-helix (ND1 b) which goes down and the chain continues to two ⁇ -turns, a ⁇ -hairpin pointing down and an extended chain going up, and the rest of the chain finally goes into domain D2.
  • the C-terminal a-helix in domain 1 (CD1) starts from Asn 406 and extends to Glu 454.
  • Domain DO and D1 are packed into the protofilament structure so that N-DO is oriented to the outside and C-DO exposed to the central channel.
  • D2 domain comprises two segments: N-terminal segment from Lys 177 to Gly 189 and C- terminal segment from Ala 284 to Glu 405. It is made mostly of ⁇ strands excepting two helix 285-289 and 288-298.
  • D3 domain comprises a central segment from Tyr 90 to Val 283. Usually made of ⁇ strands with one short stretch of helical fold (199-209).
  • two essential regions of flagellin protein involved in the recognition and activation of TLR5 are thought to be amino acids at positions 79-117 of SEQ ID NO 2 (N-D1 domain) and amino acids at positions 408-439 of SEQ ID NO 2 (C- D1 domain), as well as the amino acid alanine (A) at position 41 1 of SEQ ID NO 2, the amino acid glutamine (Q) at position 412 of SEQ ID NO 2 and the amino acid serine (S) at position 420 of SEQ ID NO 2.
  • C3H/HeN germfree (GF) mice were inoculated with three gavages of R. hominis on consecutive days.
  • the inventors report the first successful mono-colonization of germfree mice with a single bacterial species from the Firmicutes phylum. Successful colonization was achieved using an inoculation medium containing 3% ascorbic acid and 2% cysteine to protect this oxygen sensitive bacterium.
  • Analysis of gut tissue by fluorescent in situ hybridization (FISH) revealed that R. hominis colonized both the ileum and colon, but was found in much higher numbers in the colon. Bacteria were also found closely associated with the colonic mucosa (Fig. S1A). Colonization was further validated and quantified by PCR using R. hominis-specif c primers with numbers approximating 1x10 10 bacteria/g faeces (Fig. S1 B-C). Faeces of GF animals tested negative for the presence of any bacteria.
  • the R. hominis genome reveals unique genes promoting host interactions
  • R. hominis whereas flagellar basal-body rod protein FIgC, flagellar hook-basal body complex protein FliE, flagellin protein FlaB and flagellar motor switch protein FliG were unique to R. hominis (Table S1). The two bacterial genomes also differed by 42 carbohydrate genes, reflecting their divergent nutritional requirements. Interestingly, R. hominis is unique in that it expresses two flagellin genes that are both FLA type as opposed to flagellins homologous to FliC expressed by Salmonella and E. coli bacterial species.
  • Table S1 B Genes present in E. rectale but absent in R. hominis.
  • R. hominis responds to the gut environment by up-regulating motility, mobilization and chemotaxis genes
  • bacterial RNA was isolated from four different experimental conditions: (i) in vivo, from the caecum of mono-associated mice; (ii) in vitro, from bacteria grown in culture media; (iii) in vitro, from bacteria grown in the presence of dietary components; and (iv) from bacteria incubated on the surface of confluent Caco-2 and HT-29 cells.
  • Table S2 Real-time PCR analysis on bacterial RNA using R. hominis specific primers.
  • Bacterial PCR primers were designed for differentially expressed genes using Primer3Plus. All samples were run in triplicate. GyrA was used as a reference gene for normalization.
  • FIG. 2B Other gut environment-induced subsystems included Membrane Transport, in particular magnesium transport, and Motility and Chemotaxis including multiple methyl-accepting chemotaxis proteins and genes of the flagellar operon (Fig. 2B).
  • R. hominis possesses multiple flagellin genes flaA 1, flaA2, flaA3, and flaB.
  • flagellin expression was verified by Western-blot and immunocytochemistry using bacteria isolated from both in vivo colonized mice and from in vitro cultures grown in the presence of diet, with specific antibodies raised against recombinant flagellin proteins FlaA1 and FlaA2 (RH1 and RH2) (Fig. 2C).
  • Colonization of GF mice with R. hominis correlated with increased host gene expression, which was highest in the colon (Fig. 3A and Table S4). Differential expression was most profound at 28d after colonization, with 159 genes up-regulated and 143 genes down- regulated. The number of differentially expressed genes in the ileum at 14d was similar to the ascending colon, with 79 genes up-regulated and 119 genes down-regulated. Differential expression in the ileum was very low at 28d, consistent with reduced colonization levels. The transcriptomic response differed at the two time-points, as shown by the clear separation of significant transcripts by heatmap analysis (Fig. 3B). Positive Real-time PCR validation of Affymetrix data is shown in Fig. 3C.
  • A Transcripts differentially expressed in the ascending colon at 14d.
  • B Transcripts differentially expressed in the ascending colon at 28d.
  • C Transcripts differentially expressed in the ileum at 14d.
  • D Transcripts differentially expressed in the ileum at 28d.
  • Table S4A Transcripts differentially expressed in the ascending colon at 14d between R. hominis inoculated animals and germfree animals.
  • Table S4B Transcripts differentially expressed in the ascending colon at 28d between R. hominis inoculated animals and germfree animals.
  • Table S4C Transcripts differentially expressed in the ileum at 14d between R. hominis inoculated animals and germfree animals.
  • Table S4D Transcripts differentially expressed in the ileum at 28d between R. hominis inoculated animals and germfree animals. Genes involved in innate immunity and gut barrier function were significantly induced by the presence of R. hominis in the ascending colon.
  • the GO-process 'innate immune response' (GO:0045087) was up-regulated and included the important TLR-related genes Tlr5, 77/ and Vnn1.
  • the up-regulation of Tlr5 was of particular interest, given the corresponding induction of flagellar genes and flagellin protein in R. hominis during gut colonization, and may infer a role for this innate signalling pathway in mediating innate and adaptive immune responses. Other innate immune genes affected in the colon by R.
  • hominis included the antimicrobial peptides Defb37, Pla2g3, Mud 6 and Itln and the gut barrier function genes Sprrla, Cldn4, Pmp22, Crb3 and Magi3. Innate immune genes showing up-regulation in the ileum in response to R. hominis included Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a. Interestingly, herein it is shown negative regulation of the NF- ⁇ pathway (GO:0043124) (Fig, S2) by R. hominis, which, like B. thetaiotaomicron (Kelly et al. 2004), may contribute to immune homeostasis by down-regulating this inflammatory cascade.
  • R. hominis affects T cell pathways mostly in the colon The majority of pathways affected at 14d grouped into the categories cell differentiation, cell cycle regulation and tissue remodelling. Importantly, immune response was a major pathway induced at 28d in the ascending colon. The significantly affected pathways in this category were mostly involved in T cell function, including IL-10 signalling and regulation of T cell function by CTLA-4 (Table S5). The genes involved in these pathways showed both up- regulation and down-regulation, so while these pathways were significantly affected by the presence of R. hominis, the precise net functional effects on T cell differentiation required further investigation. To clarify the role of R. hominis in relation to T cell differentiation, conventional mice with R.
  • the GO-process for 'actin polymerization' (GO:0030041 ) (Arpc3, Capg, Cdc42ep5 and Rhoc) was up-regulated at 28d in the colon in R. hominis colonized mice (Fig. S2). Actin polymerization at the immune synapse is required for T cell activation and effector function. Overall, this data indicates that R. hominis actively effects the adaptive immune response in the colon by positively influencing T cell regulation.
  • Ly6g6c GPI-anchored gene product of Ly6g6c was up-regulated 25-fold
  • Ly6g6e was up-regulated two-fold at 28d.
  • a possible role of Ly6 in T eel! activation, differentiation and maturation has been proposed (Mallya, Campbell & Aguado 2006). Immunocytochemistry confirmed increased presence of Ly6G + , CD1 1 b + and CD3 + FoxP3 + cells in R. ?om/n s-colonized mice (Fig. 5B).
  • TLR5 signalling The influence of bacteria on the differentiation of T cells may reflect the array of TLR ligands displayed.
  • flagellin can prime a range of T cell responses including Th1 , Th2, Th17 and Treg responses (Wilson ef al. 2012).
  • the functionality of bacterial flagellins FlaAI (RH1) and FlaA2 (RH2) was investigated using novel soluble recombinant flagellin proteins, generated against the unique R. hominis flagellin sequences.
  • RH1 and RH2 were compared and contrasted with various commensal and pathogenic flagellins, generated using identical protocols, to activate signalling responses in intestinal epithelial cell lines and bone marrow derived dendritic cells expanded with either FLT3L or GM-CSF.
  • Epithelial cells treated with identical concentrations of different bacterial flagellins revealed distinct patterns of gene expression (Fig. 6A). Importantly, no endotoxin contamination was detected in the recombinant protein preparations. Salmonella enteritidis (SE) was more potent than E. coli K12 (EC) or RH1 flagellin. RH 1 flagellin also showed a strong response but clustered in a distinct clad along with commensal EC. The responses were shown to be TLR5-dependent using epithelial cells expressing dominant-negative TLR5.
  • SE Salmonella enteritidis
  • EC E. coli K12
  • RH1 flagellin also showed a strong response but clustered in a distinct clad along with commensal EC. The responses were shown to be TLR5-dependent using epithelial cells expressing dominant-negative TLR5.
  • RH2 was shown to be minimally active; it was generally not pro-inflammatory nor did it activate the conserved gene signature (IL-8, CXCL-1 , CXCL-2 and CXCL-10) induced by other recombinant bacterial flagellins.
  • RH1 flagellin protein is more biologically active than RH2 in vitro; although both recombinant proteins were expressed in vivo, RH1 was also significantly up-regulated at the gene expression level in vivo. It was demonstrated that the RH1 flagellin from R. hominis induced different responses in Flt3L and GM-CSF derived dendritic cells relative to commensal E. coli and pathogenic Salmonella enteritidis (Fig. 6B-C).
  • RH1 was unique in its ability to activate Flt3L-expanded DCs, with up-regulation of l-A/l-E and CD40 and the production of IL-10 by bone marrow derived DCs from both C3H/HeN and C57BI/6 mice.
  • the IL-10/IL-12 ratio was particularly elevated in C57BI/6 DCs (Fig. 6D), which were found to be CD103+ Siglec-H+. Consistent with the observations herein, a number of recent reports have also shown that flagellin can activate CD103+DC populations (Flores- Langarica et al. 2012, Kinnebrew et al. 2012).
  • Table S6 Immune system response pathway analysis of transcripts differentially expressed in the ascending colon between TLR5 KO mice and WT mice, mono- colonized with R. hominis. Differentially expressed genes (P ⁇ 0.05) were imported into GeneGo MetaCore analytical software to determine significantly enriched canonical pathways in each group. * The number of genes on each map that are differentially expressed in the specific treatment comparison. ** The total number of genes on each map. # Maps pValue Ral tio
  • the DSS mouse model was used to test the therapeutic efficacy of R. hominis, due to the control of inflammatory pathways as well as the positive effects on Treg induction in mono- associated mice.
  • Mice were dosed ( ⁇ 50 ⁇ _, 10 9 CFU) daily for a period of 14 days, and given DSS (MW 50kDa, 30g/l) in their drinking water from day 8 onwards.
  • DSS MW 50kDa, 30g/l
  • Gene expression of a panel of pro-inflammatory biomarkers showed that untreated DSS mice had strong elevation of all investigated genes compared to wild-type mice, with gene induction ranging from 4- to 49-fold (Fig. 7A).
  • Pro-inflammatory gene induction was significantly lower in R. hominis- treated compared to untreated mice, indicating strong therapeutic benefits of oral administration of R. hominis.
  • hominis exerts a stimulatory effect on host appetite.
  • the genes involved in these processes were Agt, Cartpt, Cc c and Cxcl12, with fold-changes ranging from 2- to 12- fold.
  • Cck in particular, plays a major role in digestion and satiety as a hunger suppressant.
  • Gcg also showed down-regulation at this gut site.
  • dry carcass weight and composition analyses were performed. The dry carcass weights of R. /?om/n/s-associated mice were significantly heavier compared to GF animals, and the differences were most discernible at 14d (Fig. S6A). Further carcass lipid analysis showed that total adiposity was also significantly higher in R.
  • R. hominis an anaerobic bacterium
  • the extreme oxygen sensitivity of bacteria like Roseburia requires strict anaerobic culture techniques, making it difficult to perform functional characterization.
  • the stable mono-colonization of R. hominis in germfree mice has been established and the complete annotated genomic sequence to uncover its metabolic organization, physiology, and symbiotic properties has been produced. It was found that the transcriptional responses of R. hominis following colonization could be attributed to both the host gut environment and diet. The host-driven effects dominated the response of R. hominis following mono-association.
  • hominis other commensals, such as Bacteroides thetaiotaomicron and Lactobacillus acidophilus, also enhance mucosal barrier function (Hooper et al. 2001 , Ukena et al. 2007), inferring probiotic opportunities with these bacteria in human IBD.
  • the effects of hominis on the gut immune system are intriguing. The strongest effects were noted in the ascending colon and genes such as Ly6g6c were strongly up-regulated, as well as pathways involved in T cell regulation and differentiation and actin polymerization at the immune synapse, which are implicated in T cell activation and effector functions.
  • the most affected T cell pathways included those related to IL-10, ICOS and CTLA-4, which are all involved in supporting Treg differentiation.
  • Flagellin signals are perceived by host TLR5 receptors and many pathogenic flagellin structures induce strong pro-inflammatory responses (Hayashi et al. 2001). Signalling through TLR5 in response to resident flagellated commensals may be important for homeostasis, since deletion of TLR5 results in spontaneous colitis in mice (Vijay-Kumar et al. 2007).
  • the enhanced expression of R. hominis flagellin FlaA1 (RH1) in vivo and its potency in activating epithelial cells and BMDCs is of great interest. Other work has shown that E.
  • coli flagellin mutants have a colonization advantage over wild-type flagellated strains, possibly due to absence of innate recognition by TLR5 signalling (De Paepe ef al. 2011 , Giraud et al. 2008).
  • the expression or possibly up-regulation of flagellin is a natural response to gut colonization.
  • R. hominis flagellin protein remains expressed in vivo and correlates with sustained colonization, absence of overt inflammation and expansion of T cells of regulatory phenotype.
  • SFB Prakash ef al. 2011 , Sczesnak ef al.
  • certain commensal flagellin structures may help to direct immune tolerance responses through TLR5 expressed on either CD103+DC or Treg subsets (Flores-Langarica et al. 2012, Kinnebrew et al. 2012, Crellin ef al. 2005).
  • the immune homeostatic effect of R. hominis was confirmed in DSS-treated mice, although other signalling moieties, such as butyrate, may also contribute to immune tolerance. This data suggests a potential therapeutic benefit of R. hominis in IBD.
  • CCL20 gene expression (a pro-inflammatory gene) after stimulation of lECs to different recombinant flagellins (Figure D.2) pathogenic flagellins (SE, ST, LF, and HM) induced similar but not identical levels of CCL20 mRNA, commensal flagellins displayed much more variable levels of induction.
  • ER Escherichia coli K12
  • RI and RI4 had intermediate stimulatory activity
  • RI2 had no observable activity in both cell lines.
  • the inventors distinguished three categories of TLR5 agonists (i) those with no or very low immunostimulatory activity, (ii) those with intermediate immunostimulatory activity and (iii) those with high immunostimulatory activity.
  • Table D2 indicates significant differences between each treatment calculated with paired t test in HT-29 (upper right) and Caco-2 (lower left). T tests used were unilateral to compare treatments to unstimulated cells (unstim) and bilateral to compare one treatment with another. NS (non significant); *(p ⁇ 0.05); ** (p ⁇ 0.01); *** (p ⁇ 0.001).
  • the flagellins ST, SE, K12, ER, RI3 and RH1 induced the secretion of variable but similar levels of IL-8, IP-10 and MCP-1 chemokines, while RI1 , RI2, RI4 and RH2, especially in Caco-2 behaved as low agonists of TLR5, inducing significantly lower amounts of secreted chemokines.
  • Tables D3a, D3b, D3c and D3d indicate significant differences between each treatment calculated with paired t test.
  • the upper right side of Table D3a and D3b give t values for IL-8 and the lower left side for IP-10, and Tables D3c and D3d give t values for MCP-1.
  • NS non significant; *(p ⁇ 0.05); ** (p ⁇ 0.01); ** * (p ⁇ 0.001).
  • Bone marrow-derived dendritic cells and cultures Bone marrow was harvested from femur and tibia of C3H/HeN and C57BI6 mice.
  • GMCSF-derived dendritic cells bone marrow cells were resuspended at 1x10 s /mL in RPMI supplemented with 10% FCS and 20ng/ml_ rmGM-CSF and seeded at 10mL/plate in 100mm 2 tissue culture plates. After three days culture, loosely adherent cells were collected and replated with GM-CSF supplemented media at 1x10 6 /ml_ in 12 well tissue culture plates. At day 5, cells were stimulated with 100ng/mL flagellins before being harvested on day 6.
  • Flt3L-derived dendritic cells bone marrow cells were resuspended at 2x10 6 /mL in RPMI supplemented with 10% FCS and 200ng/mL rmFlt3 and seeded at 2ml_/well in 12-well tissue culture plates. Cells were cultured for 10 days with Flt3 supplemented media added to each well on day 4. At day 9, cells were stimulated with 100ng/mL flagellins before being harvested on day 10 and analyzed by flow cytometry.
  • Flagellin Rh1 was most potent at inducing cellular response in GM-CSF/IL-4 derived dendritic cells with Ri4 and Ri3 having a similar response to commensal flagellins K12 and Er and pathogenic flagellins SE and ST.
  • Rh2 and Ri2 did not induce cellular response with the GM-CSF/IL-4 derived dendritic cells but significantly increase cellular responses to Flt3L derived dendritic cells.
  • flagellins and in particular Ri1 are distinctive in their ability to elicit difference in responses with the activation of Flt3L -derived dendritic cells. This response signifies the specificity of the flagellins to a specific subset of dendritic cells.
  • Flt3L derived dendritic cells are categorised as plasmocytoid dendritic cells which play an important role in immunological tolerance.
  • BOY/J WT and TLR5KO mice were used to evaluate the functional importance of R. hominis and its flagellins.
  • the mice were colonised with R. hominis.
  • the animals were euthanized and intestinal tissue sampling was performed. Small intestine was collected for immunological analysis by flow cytometry.
  • T regulatory (Treg) cells in small intestine lamina basement membrane surface potential (B) cells.
  • the percentage of FoxP3+CD25+ cells in CD4+ T cell population was significantly higher in the BOY/J WT mice in comparison to the TLR5KO mice. This indicates that R. hominis and more specifically the flagellins influences T regs by promoting CD4+ FoxP3+CD25+ regulatory T cells Therefore it can be concluded that flagellins are important in directing host immune response through TLR5 interactions.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in regulating the immune system of a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 1 for use in regulating the adaptive immune system of a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 1 for use in regulating the innate immune system of a subject. 4.
  • Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in maintaining immune homeostasis in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in treating an immune disorder in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence
  • the immune disorder is selected from ulcerative colitis, pouchitis, other autoimmune conditions including rheumatoid arthritis, psoriasis, multiple sclerosis, allergies including coeliac disease, atopic dermatitis and rhinitis.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in treating a disorder selected from an inflammatory disorder, an immune disorder and an intestinal disorder in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence
  • the disorder is selected from irritable bowel syndrome (IBS), colitis, inflammatory bowel disorder (IBD), including Crohn's disease and ulcerative colitis, pouchitis, functional dyspepsia, functional constipation, functional diarrhoea (including antibiotic associated diarrhoea, traveller's diarrhoea and pediatric diarrhoea), functional abdominal pain, functional bloating, Epigastric Pain Syndrome, Postpra
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in improving intestinal microbiota in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in regulating appetite in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in promoting gut health in a subject.
  • Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in promoting Tregs cells and tolerance mechanisms in the immune system of a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any one of clauses 1 to 12, which regulates the induction and/or expression of at least one mobilization or chemotaxis gene.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to clause 13, which upregulates the expression of at least one mobilization or chemotaxis gene, and wherein said gene is selected from MobA and MobL.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which regulates at least one gene selected from FlaA1, Fla2, FlaA3, and FlaB.
  • Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which regulates the expression of at least one of the following: acetyl-CoA acetyltransferase, 3-hydroxyacyl-CoA dehydrogenase, butyryl-CoA dehydrogenase, electron transfer flavoprotein beta subunit, electron transfer flavoprotein alpha subunit.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which downregulates the expression of at least one gene selected from Agt, Cartpt, Cck, Cxcl12 and Gcg.
  • Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which activates at least one immune response gene in the colon or ileum. 19.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which activates the adaptive immune response by regulating the induction and/or expression of genes associated with T-cell regulation.
  • any preceding clause which activates the adaptive immune response by regulating the induction and/or expression of genes associated with T-cell regulation.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause which upregulates expression of at least one gene selected from Ly6g6c and Ly6g6e in the ascending colon.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, in the preparation of a medicament for regulating the immune system of a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 22 in the preparation of a medicament for regulating the innate immune system of a subject.
  • Roseburia such as a bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 22 in the preparation of a medicament for regulating the adaptive immune system of a subject. 25.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • a polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, in the preparation of a medicament for maintaining immune homeostasis in a subject.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • a method of regulating the immune system of a subject comprising administering to the subject a composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide
  • a method of activating the innate immune system of a subject comprising administering to the subject a composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleo
  • a method of activating the adaptive immune system of a subject comprising administering to the subject a composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • a method of treating an immune disorder in a subject comprising administering to the subject a pharmaceutically effective amount of Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
  • Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence for use according to any one of clauses 1 to 21 , or a method according to any one of clauses 27 to 30, or a use according to any one of clauses 22 to 26, wherein the subject is a mammal.
  • Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in medicine.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector compris
  • a pharmaceutical composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and a pharmaceutically acceptable excipient, carrier or diluent.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide
  • a nutritional supplement comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and a nutritionally acceptable excipient, carrier or diluent.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleo
  • a probiotic composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • a feedstuff, food product, dietary supplement, nutritional supplement or food additive comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide
  • a process for producing a pharmaceutical composition according to clause 32 comprising admixing Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, with a pharmaceutically acceptable excipient, carrier or diluent.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • a process for producing a nutritional supplement according to clause 33 comprising admixing Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, with a nutritionally acceptable excipient, carrier or diluent.
  • Roseburia such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis
  • said epithelial cells are epithelial cells of the alimentary canal.
  • polypeptide or the polynucleotide according to paragraph 7 for use in regulating the innate immune system of a subject.
  • polypeptide or the polynucleotide according to paragraph 10 wherein said disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes, coeliac disease, atopic dermatitis, rhinitis, irritable bowel syndrome (IBS), colitis, inflammatory bowel disorder (IBD), ulcerative colitis, pouchitis, Crohn's disease, functional dyspepsia, atopic diseases, necrotising enterocolitis, and combinations thereof.
  • 21. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the expression of one or more Type I IFN genes in a cell or cells of a subject.
  • 22. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the expression of one or more pro-inflammatory genes in a cell or cells of a subject.
  • a pharmaceutical composition comprising polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and a pharmaceutically acceptable excipient, carrier or diluent. 31. The pharmaceutical composition according to paragraph 30 wherein said polypeptide or polynucleotide is encapsulated. 32. A nutritional supplement comprising polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and a nutritional acceptable excipient, carrier or diluent.
  • a feedstuff, food product, dietary supplement, or food additive comprising polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide.
  • a process for producing a pharmaceutical composition according to paragraph 30, said process comprising admixing said polypeptide or polynucleotide with a pharmaceutically acceptable excipient, carrier or diluent; optionally said polypeptide or polynucleotide is encapsulated.
  • a process for producing a nutritional supplement according to paragraph 32 comprising admixing said polypeptide or polynucleotide with a nutritionally acceptable excipient, carrier or diluent; optionally said polypeptide or polynucleotide is encapsulated.
  • a method of modulating the inflammation of a tissue or an organ in a subject comprising administering to the subject polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, and wherein the inflammation of the tissue or organ in the subject is modulated.
  • a method of modulating the production of T cells in a subject comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, and wherein the production of T cells in the subject is modulated, in particular T regulatory cells.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Diabetes (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Dermatology (AREA)
  • Hematology (AREA)
  • Obesity (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Polymers & Plastics (AREA)
  • Food Science & Technology (AREA)
  • Rheumatology (AREA)
  • Pulmonology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Nutrition Science (AREA)
  • Child & Adolescent Psychology (AREA)
  • Pain & Pain Management (AREA)
  • Endocrinology (AREA)
  • Otolaryngology (AREA)
  • Biomedical Technology (AREA)

Abstract

The present invention relates to Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in modulating the inflammation of a tissue or an organ in a subject.

Description

ROSEBURIA FLAGELLIN AND IMMUNE MODULATION
FIELD OF THE INVENTION The present invention relates to Roseburia flagellins, and/or polynucleotide sequences encoding said Roseburia flagellins, and/or vectors comprising said polynucleotide sequences, and/or host cells, including bacteria, comprising said vectors, and/or host cells, including bacteria, comprising said polynucleotide sequences, for various therapeutic and nutritional uses.
BACKGROUND
The human intestine is thought to be sterile in utero, but is exposed to a large variety of maternal and environmental microbes immediately after birth. Thereafter, a dynamic period of microbial colonization and succession occurs which is influenced by factors such as delivery mode, environment, diet and host genotype, all of which impact upon the composition of the gut microbiota, particularly during early life. Subsequently, the microbiota stabilizes and becomes adult-like (Spor, Koren & Ley 2011). The human gut microbiota contains more than 500-1000 different phylotypes belonging essentially to two major bacterial divisions, the Bacteroidetes and the Firmicutes (Eckburg ei al. 2005). The successful symbiotic relationships arising from bacterial colonization of the human gut have yielded a wide variety of metabolic, structural, protective and other beneficial functions. The enhanced metabolic activities of the colonized gut ensure that otherwise indigestible dietary components are degraded with release of byproducts providing an important nutrient source for the host. Similarly, the immunological importance of the gut microbiota is well-recognized and is exemplified in germfree animals which have an impaired immune system that is functionally reconstituted following the introduction of commensal bacteria (Macpherson ef al. 2001 , Macpherson, Martinic & Harris 2002, Mazmanian ei al. 2005). In sharp contrast to the production of secretory intestinal IgA, which is influenced by microbial colonization per se (Chung, Kasper 2010, Macpherson 2006), T cell development and differentiation seem to require colonization by specific commensal micro-organisms. Clostridium species, and in particular the spore-forming segmented filamentous bacteria (SFB), appear to be a potent stimulus for the differentiation and maturation of intestinal and colonic Th1 , Th17 and Tregs (Gaboriau-Routhiau ei al. 2009, Ivanov et al. 2009). Recent studies have now demonstrated that other gut bacteria, including those of Clostridium clusters IV and XlVa and the Altered Schaedler Flora (ASF), can induce de novo generation of Tregs while mono-colonization with Bacteroides fragilis can correct the Th1/Th2 imbalance in germfree mice by promoting the expansion of Tregs (Mazmanian et al. 2005, Geuking et al. 201 1 , Atarashi et al. 2011). These data infer important immune-regulatory effects of other resident gut bacteria. Clearly, the effects of commensal bacteria on T cell differentiation pathways is variable and as postulated previously may be influenced by the array of TLR ligands found associated with specific bacteria (Nutsch, Hsieh 2012). For example, the mechanism by which SFB influences T cell responses is currently unknown, but recent genome studies confirming the presence of flagellin genes suggest that innate responses mediated through TLR5-flagellin interactions may be important (Prakash et al. 2011 , Sczesnak et al. 2011). Furthermore, the Treg-enhancing effects of B. fragilis have been linked with PSA and mediation by TLR2 signalling events (Round et al. 201 1 ).
Dramatic changes in microbiota composition have been documented in gastrointestinal disorders such as inflammatory bowel disease (IBD). For example, the levels of Clostridium cluster XlVa bacteria are reduced in IBD patients whilst numbers of E. coli are increased, suggesting a shift in the balance of symbionts and pathobionts within the gut (Frank et al. 2007, Scanlan et al. 2006, Kang et al. 2010, Machiels K. er al. 2013). Interestingly, this microbial dysbiosis is also associated with imbalances in T effector cell populations. Roseburia belongs to the phylogenetic cluster XlVa of the Firmicutes phylum. Currently, within the Roseburia genus, five species have been identified and characterised: Roseburia cecicola, Roseburia faecis, Roseburia hominis, Roseburia intestinalis, Roseburia inulinivorans (Stanton and Savage 1983, Duncan et al 2006). The bacteria are flagellated commensal anaerobes and are also major butyrate producers (Duncan et al. 2006). Although precise numbers of these bacteria colonizing the human gut have not been accurately estimated, Roseburia spp. are dominant in the healthy human gut and are under-represented in IBD patients (Machiels K. er a/. 2013).
The roles of bacterial genes, in particular flagellin, participating in colonization and adaptation to the murine gut, as well as the host immune genes responding to colonization by Roseburia bacteria are disclosed. The inventors show that specific flagellin structures of Roseburia such as R. hominis and R. intestinalis induce distinct signalling responses in both epithelial cells and dendritic cells relative to other flagellate enteric bacteria. The importance of the TLR5-Roseburia, such as TLR5-R hominis, interactions in directing the host adaptive response, in particular Treg responses is demonstrated. The complete genome sequence and annotation for R. hominis described herein is shown in GenBank under accession number CP003040 (version 1). For R. intestinalis (GenBank Accession Number for 16S rRNA gene strain L1-82: AJ312385) described herein the reference genome sequence is shown in GenBank under accession number ABYJ02000000 (version 2) and consists of sequences ABYJ02000001- ABYJ02000409. STATEMENTS OF INVENTION
Surprisingly, the present inventors found that Roseburia flagellin proteins are important in modulating the immune response. In addition, the present inventors surprisingly found that the flagellin proteins derived or derivable from Roseburia hominis or Roseburia intestinalis are important in modulating the immune response.
The present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in modulating the inflammation of a tissue or an organ (such as the intestine) in a subject.
In another aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in modulating the production of T cells (e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5) in a subject.
The present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in restoring immunological tolerance. In a further aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the immune system of a subject. In another aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in treating a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
The present invention, in another aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in modulating dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in a tissue or an organ of a subject.
The present invention, in a further aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the production of IL-10 and/ or TGF in a cell or cells of a subject.
In a further aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A l-E, CD317/BST-2, CD 03, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject.
In another aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in regulating (e.g. downregulating) the expression of one of more Type I IFN genes (such as but not limited to one or more genes selected from the group consisting of IFN-βΙ , IFN-p3, Ifi202b, Ifi203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 and Irf4) in a cell or cells of a subject.
The present invention, in a further aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species
Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in regulating (e.g. downregulating) the expression of one or more pro-inflammatory genes (such as one or more genes selected from the group consisting of but not limited to ILI-β, IL4, IL5, IL6, IL8, IL12,
IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2 , CCL3, CCL5, CCL20, CXCL5, CXCL10,
CXCL12, CXCL13, and TNF-a) in a cell or cells of a subject.
The present invention, in another aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in improving intestinal microbiota in a subject.
In another aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in regulating appetite in a subject.
In a further aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), for use in regulating (e.g. downregulating) the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
The present invention, in a further aspect, relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in improving alimentary canal health in a subject.
The present invention, in another aspect, relates to a pharmaceutical composition comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and a pharmaceutically acceptable excipient, carrier or diluent.
In another aspect, the present invention relates to a nutritional supplement comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Rosebuna (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and a nutritional acceptable excipient, carrier or diluent. In a further aspect, the present invention relates to a feedstuff, food product, dietary supplement, or food additive comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis).
The present invention, in a further aspect, relates to a process for producing a pharmaceutical composition according to the present invention, said process comprising admixing a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), with a pharmaceutically acceptable excipient, carrier or diluent; optionally said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell comprising said vector, and/or said host cell comprising said polynucleotide sequence, and/or said Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated.
In a further aspect, the present invention relates to a process for producing a nutritional supplement according to the present invention, said process comprising admixing a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), with a nutritionally acceptable excipient, carrier or diluent; optionally said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell comprising said vector, and/or said host cell comprising said polynucleotide sequence, and/or said Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated.
In another aspect, the present invention relates to a method of modulating the inflammation of a tissue or an organ (such as the intestine) in a subject, said method comprising administering to the subject a Roseburia flagellin, or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the inflammation of the tissue or organ (such as the intestine) in the subject is modulated.
The present invention, in another aspect, relates to a method of modulating the production of T cells (e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5) in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the production of T cells (e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5) in the subject is modulated. The present invention, in a further aspect, relates to a method of regulating the immune system of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the immune system of the subject is regulated.
In a further aspect, the present invention relates to a method of treating a disorder in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
In another aspect, the present invention relates to a method of modulating dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in the subject are modulated.
In a further aspect, the present invention relates to a method of regulating the production of IL-10 and/or TGFp in a cell or cells of a subject, said method comprising administering a Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), to the subject, and wherein the production of IL-10 and/or TGFp in a cell or cells of the subject is regulated. The present invention, in another aspect, relates to a method of regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, I- A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), to the subject, and wherein the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of the subject is regulated. In another aspect, the present invention relates to a method of regulating (e.g. downregulating) the expression of one of more Type I IFN genes (such as one or more genes selected from the group consisting of but not limited to IFN-βΙ , IFN-p3, Ifi202b, lfi'203, IFI44, IFTI, MXI, OAS!, OAS2, OAS3, OASL, lr†3 and Irf4) in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), wherein the expression of one of more Type I IFN genes (such as one or more genes selected from the group consisting of but not limited to IFN-P1 , IFN- 3, Ifi202b, ΙΠ203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, Irf3 and Irf4) in a cell or cells of the subject is regulated.
In a further aspect, the present invention relates to a method of regulating (e.g. downregulating) the expression of one or more pro-inflammatory genes (such as one or more genes selected from the group consisting of but not limited to IL -β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-a in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), wherein the expression of one or more pro-inflammatory genes (such as one or more genes selected from the group consisting of but not limited to ILI-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-a) in a cell or cells of the subject is regulated.
The present invention, in a further aspect, relates to a method of improving intestinal microbiota in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the intestinal microbiota in a subject is improved.
In another aspect, the present invention relates to a method of regulating appetite in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the appetite in the subject is regulated.
The present invention, in another aspect relates to a method of regulating (e.g. downregulating) the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of the subject is regulated.
In a further aspect, the present invention relates to a method of improving alimentary canal health in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein alimentary canal health in a subject is improved. The present invention, in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for modulating the inflammation of a tissue or an organ (such as the intestine) in a subject.
The present invention, in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for modulating the production of T cells (e.g. regulatory T cells such as regulatory T cells capable of expressing TLR5) in a subject.
In a further aspect, the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating the immune system of a subject.
The present invention, in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for the treatment of a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
The present invention, in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for modulating dendritic cells (such as bone marrow dendritic cells) and/or epithelial cells in a tissue or an organ of a subject.
In another aspect, the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating the production of IL-10 and/or TGF in a cell or cells of a subject.
The present invention, in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject.
In a further aspect, the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating (e.g. downregulating) the expression of one of more Type I IFN genes (such as one or more genes selected from the group consisting of but not limited to IFN-βΙ , IFN-p3, Ifi202b, ΙΠ203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, lr†3 and Irf4) in a cell or cells of a subject.
In another aspect, the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating (e.g. downregulating) the expression of one or more proinflammatory genes (such as one or more genes selected from the group consisting of but not limited to ILI-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-cc) in a cell or cells of a subject.
The present invention, in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for improving intestinal microbiota in a subject.
The present invention, in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating appetite in a subject.
The present invention, in a further aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for regulating (e.g. downregulating) the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
The present invention, in another aspect, relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for improving alimentary canal health in a subject. In another aspect, the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in medicine.
In a further aspect, the present invention relates to a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in restoring immunological tolerance.
In another aspect, the present invention relates to use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for the manufacture of a medicament for restoring immunological tolerance in a subject.
The present invention relates to, in another aspect, a method of restoring immunological tolerance in a subject, said method comprising administering a Roseburia flagellin and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and wherein the immunological tolerance in a subject is restored.
FIGURES
Figure 1. Sequence and annotation of R. hominis genome. The complete genome sequence of R. hominis A2-183 was produced. It is represented by a single 3,592,125-bp chromosome with four ribosomal operons, 66 RNAs and 3,273 predicted proteins. (A) R. hominis circular genome map with the location of the PCR experiments (Table S1) indicated in the regions targeted by the primers. The tracks on the genome map, starting at the outer track 0, are: track 0 (blue) - Real-time PCR experiments indicated by numbered tick marks; track 1 (pale blue) - Forward CDS; track 2 (pale blue) - Reverse CDS; track 3 (grey) - rRNA; track 4 (green) - tRNA; track 5 (red) - STS marking regions targeted by Real-time PCR; graph 1 - GC content; graph 2 - GC bias. (B) Functional annotation of the R. hominis genome shows that the largest number of genes belong to Carbohydrates , Protein Metabolism and Amino acids and Derivatives.
Figure 2. R. hominis responds to the gut environment by up-regulating motility, mobilization and chemotaxis genes. Germfree GF C3H/HeN male mice were given R. hominis culture by gavage for 28d, and compared to germfree control animals. At 14d and 28d, R. hominis-treaied animals (N=5) and control animals (N=4) were sacrificed and ileum, colon and caecum were collected. (A) Real-time PCR validation of genes involved in conjugation/mobilization transfer. (B) Real-time PCR validation of genes involved in Motility and Chemotaxis. (C) Western blot of R. hominis grown in vitro in the presence of UV irradiated standard murine chow immuno-stained with affinity-purified Fla1 antibody, Fla2 specific antiserum and anti-DNA gyrase A antibody (lane 1 : no diet, lane 2: 0.01g diet/10 mL of R. hominis culture, lane 3: 0.02g diet/10 ml_, lane 4: 0.05g diet/10 ml_, lane 5: 0.1g diet/10 mL, lane 6: 0.2g diet/10 ml_, lane 7: 0.5g diet/10 mL, lane 8: 1g diet/10 ml_). Electron microscopy (EM) picture of R. hominis showing flagella (black arrows). Immunocytochemistry performed on bacteria from luminal contents of colonized mice and from R. hominis grown in vitro using FlaA1 and FlaA2 specific antiserum. Original magnification x1000. (D) Real-time PCR validation of genes involved in butyrate metabolism. (E) Real-time PCR analysis of R. hominis transcripts during in vitro exposure to human intestinal epithelial cells. Real-time PCR results are presented as fold change, *P<0.05, **P<0.01 , ***P<0.001. Figure 3. Identification of transcripts differentially expressed in the murine gut after mono-association with R. hominis. (A) Affymetrix microarray analysis of differentially expressed genes in R. hominis-co\on\zed mice (N=5) relative to GF (N=4). Bar graphs represent number of genes higher and lower expressed after 14 and 28 days. (B) Heatmap generated from differentially expressed genes with functional significance between GF and R.
Figure imgf000016_0001
mice at 14d and 28d. (C) Real-time PCR validation of genes shown to be significantly different between R. hominis-co\on\zed and GF mice. Real-time PCR results are presented as fold change, *P<0.05, **P<0.01 , ***P<0.001.
Figure 4. Induction of FoxP3+ Treg cells by Roseburia hominis. Flow cytometry analysis of FoxP3+ Treg cells in lamina propria (P=0.0425 between control and R. hominis treatment) and mesenteric lymph nodes (P=0.0683) of conventional C3H/HeN treated for 14 days with R. hominis.
Figure 5. Colonic T cell markers are significantly induced by R. hominis mono- colonization. (A) Immunofluorescence analysis of ascending colon lamina propria cells with anti-CD3 and anti-FoxP3 in germfree and R. hominis mono-colonized C3H/HeN (N=8) and C57BI/6 (N=3) mice. (B) Immunofluorescence analysis of lamina propria cells labelled with (i) anti-Ly6G, (ii) anti-CD11b, (iii) anti-CD3, and (iv) anti-CD3 and anti-FoxP3 in ascending colon of GF and R. hominis-treated C3H/HeN mice. Data expressed as number of positive cells per field of view in GF mice (N=7-8) and R. hominis-treated mice (N=8-10). *P<0.05. Original magnification x630. Figure 6. R. hominis flagellin RH1 has specific effects on intestinal epithelial cells and murine bone marrow-derived dendritic cells. (A) Heatmap generated from differentially expressed genes in Caco-2 intestinal epithelial cells (N=1) treated with different bacterial flagellins Salmonella enteritidis (SE), E. coli K12 (EC), RH1 and RH2. (B) Expression of (i) CD40; (ii) l-A/l-E and (iii) CD103 by CD1 1c+B220+CD317+ Flt3L- derived dendritic cells from conventional C3H/HeN, control (blue) and after 24hrs incubation with recombinant flagellin (SE, 12, RH1 , RH2; green) determined by flow cytometry. Histogram represents data from three experiments. (C) Frequencies of recombinant flagellin (SE, K12, RH1 , RH2) treated Flt3L- and GMCSF- derived dendritic cell populations from conventional C3H/HeN gated on CD 1c+B220+CD317+ cells and CD11c+CD11 b+B220- cells, respectively. Data presented as percentage of total, live and singlet cells, mean ± SEM from three experiments. (D) Protein expression of cytokines IL-10 and IL-12 was measured by CBA in supernatants from control (unstimulated DCs; N=3) and RH1 -treated DCs (N=3) derived from C3H/HeN and C57BI/6. Data is presented as mean ± SD. ***P<0.001. (E) Quantitative analysis of immunofluorescent labelling of ascending colon lamina propria cells with anti-CD3 and anti- FoxP3 in germfree and R. hominis mono-colonized TLR5KO mice (N=2).
Figure 7. R. hominis attenuates inflammation in an experimental model of colitis.
Twenty-two female C57BL/6 mice were used to assess the therapeutic effect of R. hominis during DSS-induced colitis. Treated mice were dosed daily with 109 CFU R. hominis for 14 days. From day 8, mice were given DSS in their drinking water for 6 days. The animals were euthanized on day 14 and intestinal tissue sampling was performed. (A) Untreated DSS mice (N=8) had strong elevation of all genes compared to control mice (N=4), while differential gene expression was lower in R. hominis-treated animals (N=10). Real-time PCR results are presented as fold change, ***P<0.001. (B) Histopathology tissue scoring presented as mean percentage of fields of view at a given grade. DSS treatment significantly altered all fields of view at grades 0, 2, 3, and 4. R. hominis significantly reduced the % fields of view for grade 4 pathology (p=0.02) and increased the % fields of view for grade 0. Data is presented as mean ± SD. (C) Ascending colon (haematoxylin/eosin stained) of control, DSS-treated and DSS/Pv. /7o/77//7/s-treated IL-10 O animals. Images shown are representative fields of view from each treatment group. Original magnification x100.
Supplementary Figures Figure S1. R. hominis preferentially colonizes the ascending colon of mono-colonized mice. (A) R. hominis colonized the ascending colon of the mouse gut with close association of bacteria to the host epithelium, detected by FISH using A2-183 (R. hominis-spedt c probe; FITC), Eub338 (universal 16S probe; Cy3) and DAPI (nuclei; blue). Overlays of A2-183 + Eub338 and Eub338 + DAPI are also shown. The gamma for the red channel was increased in the Eub338 + DAPI overlay to illustrate the labelled bacteria. Original magnification x630.
(B) PCR using R. hominis-spec\f\c primers showed a strong positive signal in faecal DNA post-colonization, while faeces of GF animals were negative for the presence of any bacteria.
(C) Real-time PCR analysis showing colonization levels of R. hominislg faeces. Bacterial DNA isolated from faeces was compared against known standard concentrations of R. hominis grown in culture. Similar bacterial levels were detected in all mono-colonized mice, approximating 1x10 D bacteria/g faeces. Faeces of GF animals tested negative for the presence of any bacteria.
Figure S2. Gene Ontology analysis performed on genes up-regulated at 28 days in the ascending colon. Gene Ontology (GO) based functional interpretation of the data was performed using DAVID (http://david.abcc.ncifcrf.gov). Significantly different transcripts (P<0.05) were allocated into the GO category 'Biological Process' to find significantly enriched GO terms. The GO biological processes for 'actin polymerization' (GO: 0030041) and 'negative regulation of l-kappaB kinase/NF-kappaB cascade' (GO:0043124) were affected. Figure S3. Identification of transcripts differentially expressed in the murine gut after mono-association with E. coli. (A) Affymetrix microarray analysis of differentially expressed genes in E. coli and R. hominis-colonlzed mice over time. Bar graphs represent number of genes higher and lower expressed after 22 and 28 day, respectively. (B) Heatmap generated from differentially expressed genes with functional significance in E. co//-colonized mice at 22d vs. 10d.
Figure S4. Identification of transcripts differentially expressed in TLR5KO mouse gut after mono-association with R. hominis. (A) Heatmap generated from differentially expressed genes in ascending colon of R ?om/n/'s-colonized TLR5KO (N=3) and wildtype mice (N=3) at 28d. (B) Heatmap generated from differentially expressed immune-associated genes in ascending colon of R.
Figure imgf000018_0001
TLR5KO and wildtype mice at 28d. (C) Heatmap generated from differentially expressed genes in ileum of R from/'n/s-colonized TLR5KO and wildtype mice at 28d. (D) Heatmap generated from differentially expressed immune-associated genes in ileum of R joAn/>j/s-colonized TLR5KO and wildtype mice at 28d.
Figure S5. Gene Ontology analysis performed on genes down -regulated at 28 days in the ascending colon. GO biological processes involved in appetite regulation, such as 'negative regulation of response to food' (GO:0032096), 'negative regulation of appetite' (GO:0032099) and 'regulation of catecholamine secretion' (GO:0050433) were mostly affected.
Figure S6. R. hominis colonization influences satiety genes and body weight. Dry body weight and lipid carcass analysis was performed. (A) Dry carcass weights of R. hominis- associated mice were significantly heavier compared to GF animals. (B) Carcass lipid analysis showed that total adiposity was also significantly higher in R. hominis-ireated animals at 14d. Data is presented as mean ± SD.
Figure 1A Representation of the cloning vector pCR-Blunt ll-TOPO used for cloning recombinant flagellins insoluble after cell lysis. It allows high-efficiency DNA cloning of blunt-end PCR products. It encodes Kanamycin and Zeocin resistance genes for selection in E. coli, and the insert is flanked by multiples restriction sites for excision.
Figure 2A Representation of the expression vector T7-MAT-Tag-FI_AG- used for cloning recombinant flagellins insoluble after cell lysis. The multi cloning site ( CS) is flanked by MAT (Metal Affinity Tag) sequence and FLAG peptide (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys) sequence, which results in the production of double-tagged flagellin, which can be further purified by affinity columns. This expression vector also encodes a pT7/lac (phage T7 lac operon) promoter for IPTG inducible, high-level expression of MAT-ORF-FLAG recombinant flagellins, an internal lacl gene that represses transcription at basal state in any E. coli host, and an AmpR gene for ampicillin selection.
Figure 3A Visualization on a SDS-PAGE of recombinant flagellin cloned with the pCR-Blunt ll-TOPO cloning vector and expressed through the pT7-MAT-Tag-FLAG-2 expression vector. Description of lanes: 1 , protein standard (kDa); 2, RH1 . Figure B1 A and B1 B show an SDS-Analysis of recombinant flagellins.
(A) K12 (Escherichia coli K12); ER (Eubacterium rectale 33656); RI1 (Roseburia intestinalis Fla 1);
RI2 (Roseburia intestinalis Fla 2);
(B) RH1 (Roseburia hominis Fla 1 ); RH2 (Roseburia hominis Fla 2); RI3 (Roseburia
intestinalis Fla 3);
RI4 (Roseburia intestinalis Fla 4). Figure C1-C4. Multiple sequence alignment confirming flagellin nucleotide sequence and accession number.
Figure D.2 Comparative analysis of CCL20 gene induction by different flagellins. HT-29 and Caco-2 cells were stimulated for 2 hours with a single recombinant flagellin at a concentration of 100 ng/mL Total RNA was extracted and subjected to real time quantitative PCR analysis for the genes CCL20 and β-actin. Experiments were done in triplicate on three separate occasions. Table D2 indicates significant differences between each treatment calculated with paired t test in HT-29.
Figure D.3 Flagellin-mediated chemokine secretion in HT-29 and Caco-2 cells. Tables D3a, D3b, D3c and D3d indicate significant differences between each treatment calculated with paired t test. Figure D4, neutralization of TLR5 with an anti-TLR5 specific antibody.
Figure D5A: Frequencies of GM-CSF/IL-4 derived dendritic cells stimulated with recombinant flagellins, data shown as fold change compared to unstimulated GM-CSF/IL-4 derived dendritic cells.
Figure D5B: Frequencies of Flt3L derived dendritic cells stimulated with recombinant flagellins, data shown as fold change compared to unstimulated Flt3L derived dendritic cells.
Figure D 6 A and B Flow cytometry analysis of FoxP3+ Tregs in lamina propria of BOY/J WT and TLR5KO mice treated with R. hominis.
DETAILED DESCRIPTION
Flagellin
Flagellin is the principal substituent of bacterial flagellum, and is present in large amounts on nearly all flagellated bacteria. Typically, flagellins are globular proteins which arrange into a hollow cylinder to form the filament in bacterial flagellum. The diversity of flagellin structural proteins and gene sequences is well recognized and vary according to bacterial species, geographical and clinical and environmental origins. There are thousands of flagellins and related flagellin genes. Some of the important ones in gut bacteria include the flagellins FLA, FliC, FlgC, FLiE, FlaB, Mo A and FliG.
There are several types of FLA (Fla) polypeptides. FlaA1 , FlaA2, FlaA3, FlaA4 and FlaB are examples of FLA polypeptides.
Polypeptide FlaA1
The term "polypeptide FlaA1 " as used herein refers to the flagellin protein FlaA1. Examples of such polypeptides include the FlaA1 polypeptide of Roseburia hominis, Roseburia cecicoia, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans; the polypeptide sequence shown as SEQ ID NO 2 or SEQ ID No 6; and polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to SEQ ID NO 2 or SEQ ID No 6 or variants, homologues, fragments or derivatives thereof. SEQ ID NO 2 has the following sequence:
MWQHNLTA NANRQLGITTGAQAKSSEKLSSGYKINRAADDAAGLTISEKMRSQV RGLNKASDNAQDGVSLIQVAEGALSETHSILQRMNELATQAANDTNTTSDRTAVQQ EINQLASEITRIASTTQFNTMNLIDGNFTSKKLQVGSLCGQAITIDISDMSATGLGVSG LWSSFSAAGKAMSAAQDAISYVSSMRSKLGALQNRLEHTISHLDNISEHTSSAESRI RDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ
SEQ ID NO 2 is deposited with NCBI under accession number ABI48297.1.
The terms "polypeptide FlaA1" and "FlaA1 polypeptide" are used interchangeably herein. The terms "FlaA1", "Fla1" and "RH1 " may be used interchangeably herein.
In one embodiment, the polypeptide FlaA1 has at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to SEQ ID NO 2 or to variants, homologues, fragments or derivatives thereof. In one aspect, the amino acids at positions 79 to 1 17 and positions 408 to 439 as well as 41 , 412, 420 of SEQ ID NO 2 (or equivalent thereof) are considered important. In one aspect, the amino acids at positions 41 1 , 412, 420 of SEQ ID NO 2 (or equivalent thereof) are alanine (A), glutamine (Q) and serine (S) respectively.
In one embodiment, the polypeptide FlaA1 is the polypeptide shown as SEQ ID NO 2 or SEQ ID No 6.
FlaA1 polypeptides can be derived from certain microorganisms. In one aspect, the FlaA1 polypeptide is derived from a bacterium such as a Firmicute. In a further aspect, the FlaA1 polypeptide is derived from a Roseburia spp such as a Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, or Roseburia inulinivorans. Roseburia hominis and Roseburia intestinalis are recently described commensal gut anaerobes of the phylogenetic cluster XlVa within the Firmicutes phylum, belonging to a dominant group of bacteria in the human gut and are also major butyrate producers. An example of Roseburia hominis is the strain deposited under the terms of the Budapest Treaty at National Collections of Industrial, Food and Marine Bacteria (NCIMB) at NCIMB Ltd, Ferguson Building, Craibstone Estate, Bucksburn, Aberdeen, UK, AB21 9YA, on 21 October 2004 by the Rowett Research Institute under the accession number NCIMB 14029T Roseburia hominis A2-183T (DSM = 16839T). Another example is the bacterial species is Roseburia hominis as described in Duncan, S. H., Aminov, R. I. , Scott, K. P., Louis, P., Stanton, T. B., & Flint, H. J. (2006) Int. J. Syst. Evol. Microbiol. 56: 2437-2441. An example of Roseburia intestinalis is the strain deposited under the accession number NCIMB 13810 Rosburia intestinalis L1 -82T (DSM = 14610 T) Another example is the bacterial species is Roseburia hominis as described in Duncan, S. H., Aminov, R. I., Scott, K. P., Louis, P., Stanton, T. B., & Flint, H. J. (2006) Int. J. Syst. Evol. Microbiol. 56: 2437-2441. The term "polynucleotide sequence encoding the polypeptide FlaA1 " as used herein refers a polynucleotide sequence encoding the flagellin protein FlaAl . Examples of such polynucleotide sequences include the gene FlaAl of R. hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, or Roseburia inulinivorans; the polynucleotide sequence shown as SEQ ID NO 1 or SEQ ID No 5; polynucleotide sequences encoding the polypeptide shown as SEQ ID NO 2 or SEQ ID No 6; polynucleotides sequences having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to SEQ ID NO 1 or SEQ ID No 5 or variants, homologues, fragments or derivatives thereof; and polynucleotides sequences encoding the polypeptide shown as SEQ ID NO 2 or SEQ ID No 6 or encoding a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to the polypeptide shown as SEQ ID NO 2 or SEQ ID No 6 or variants, homologues, fragments or derivatives thereof.
SEQ ID NO 1 has the following sequence:
ATGGTAGTACAGCACAATCTTACAGCAATGAACGCTAACAGACAGTTAGGTATCA CAACAGGCGCACAGGCTAAGTCTTCTGAGAAGTTATCTTCTGGTTACAAGATCAA CCGCGCAGCAGATGACGCAGCAGGTCTTACGATTTCCGAGAAGATGAGAAGCC AGGTTAGAGGCTTAAATAAAGCTTCTGACAACGCACAGGATGGTGTATCCCTTAT TCAGGTAGCTGAGGGTGCATTAAGTGAGACACACTCCATCTTACAGCGTATGAA TG AGTTAG CAACTCAG G C AG C AAACG ATACCAATACAACCTCAG ACAGAACTGC AGTTCAGCAGGAGATCAACCAGTTAGCATCTGAGATCACCAGAATCGCTTCTAC AACTCAGTTCAACACAATGAACCTGATCGATGGTAACTTCACAAGTAAGAAGCTT CAGGTAGGTTCCCTTTGCGGACAGGCTATCACAATCGATATCTCTGATATGTCTG CTACAGGTCTTGGCGTTAGCGGATTAGTAGTATCTTCCTTCTCTGCAGCTGGTAA GGCAATGTCTGCAGCTCAGGATGCTATCAGCTACGTATCTTCTATGCGTTCTAAG CTGGGTGCATTACAGAACAGACTTGAGCACACAATCTCCCACCTGGACAACATT TCTGAGCACACATCTTCTGCAGAGTCTCGTATCCGTGATACAGATATGGCTGAA GAGATGGTTGAGTACAGCAAGAACAACATCCTTGCTCAGGCAGGACAGTCTATG CTTGCTCAGGCTAACCAGTCTACTCAGGGTGTATTATCCTTATTACAGTAA SEQ ID NO 1 is deposited with NCBI under accession number DQ789140.1.
In one embodiment, the polynucleotide sequence encoding the polypeptide FlaA1 has at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to the polynucleotide sequence shown as SEQ ID NO 1 or SEQ ID No 5 or to variants, homologues, fragments or derivatives thereof.
In one embodiment, the polynucleotide sequence encoding the polypeptide FlaA1 encodes a polypeptide shown as SEQ ID NO 2 or SEQ ID No 6 or a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to the polypeptide shown as SEQ ID NO 2 or SEQ ID No 6 or to variants, homologues, fragments or derivatives thereof.
In one embodiment, the polypeptide FlaA1 is a truncated FlaA1 polypeptide. For example, the truncated polypeptide comprises at least 20, 30, 40, 50, 75, 100, 125, 150, 175 or 200 amino acids of polypeptide shown as SEQ ID NO 2 or SEQ ID No 6.
Without wishing to be bound by theory, two essential regions of flagellin protein involved in the recognition and activation of TLR5 are amino acids 79-1 17 of SEQ ID NO 2 (N-D1 domain) and amino acids 408-439 of SEQ ID NO 2 (C- D1 domain). Without wishing to be bound by theory, amino acid: A41 1 , Q412, S420 are important amino acids.
Examples of truncated FlaA1 polypeptides include: polypeptides which comprise amino acids 79-117 and amino acids 408-439 of SEQ ID NO 2; polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to amino acids 79-117 and amino acids 408-439 of SEQ ID NO 2; polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99%i identity to amino acids 79-117 and amino acids 408-439 of SEQ ID NO 2 wherein the amino acid at position 411 (or equivalent thereto) is alanine (A) and/or the amino acid at position 214 is glutamine (Q) and/or the amino acid at position 420 is serine (S); polypeptides comprising amino acids 79-439 of SEQ ID NO 2; polypeptides comprising amino acids 79- 439 of SEQ ID NO 2 wherein the amino acid at position 41 1 (or equivalent thereto) is alanine (A); polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to amino acids 79-439 of SEQ ID NO 2; and polypeptides having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to amino acids 79-439 of SEQ ID NO 2 wherein the amino acid at position 41 1 (or equivalent thereto) is alanine (A) and/or the amino acid at position 214 is glutamine (Q) and/or the amino acid at position 420 is serine (S).
In one aspect, the amino acids at positions 41 1 , 412, 420 of SEQ ID NO 2 (or equivalent thereof) in a truncated FlaA1 polypeptide are alanine (A), glutamine (Q) and serine (S) respectively. In one embodiment, the polynucleotide sequence encoding the polypeptide FlaA1 encodes a truncated FlaA1 polypeptide.
In one embodiment, the polypeptide FlaA1 is a fusion polypeptide. For example, the polypeptide is fused to glutathione S-transferase (GST).
Roseburia Genus
Roseburia bacteria are slightly curved rod-shaped cells that are strictly anaerobic and indigenous to the mammalian intestine. The bacteria are butyrate-producing and are actively motile through multiple flagella present along the concave side and in a cluster at one end (Stanton and Savage 1983). Currently, within the Roseburia genus, five species have been identified and characterised: Roseburia cecicola, Roseburia faecis, Roseburia ominis, Roseburia intestinalis, and Roseburia inulinivorans (Stanton and Savage 1983, Duncan et al 2006).
Stanton and Savage (1983 - Roseburia cecicola gen. nov., sp. nov., a motile, obligately anaerobic bacterium from a mouse cecum. Int. J. Syst. Bacteriol. , 1983, 33, 618-627.) describe Roseburia cecicola. Duncan ef al. (2006 - Proposal of Roseburia faecis sp. nov., Roseburia hominis sp. nov. and Roseburia inulinivorans sp. nov., based on isolates from human faeces. Int. J. Syst. Evol. Microbiol. , 2006, 56, 2437-2441 ) describe Roseburia faecis. Duncan et al. (2006 - Proposal of Roseburia faecis sp. nov., Roseburia hominis sp. nov. and Roseburia inulinivorans sp. nov., based on isolates from human faeces, int. J. Syst. Evol. Microbiol., 2006, 56, 2437-2441 ) describe Roseburia hominis.
Duncan e? al. (2002 - Roseburia intestinalis sp. nov., a novel saccharolytic, butyrate- producing bacterium from human faeces, int. J. Syst. Evol. Microbiol., 2002, 52, 1615-1620) describe Roseburia intestinalis. Duncan et al. (2006 - Proposal of Roseburia faecis sp. nov., Roseburia hominis sp. nov. and Roseburia inulinivorans sp. nov., based on isolates from human faeces. Int. J. Syst. Evol. Microbiol. , 2006, 56, 2437-2441) describe Roseburia inulinivorans.
Roseburia Flagellin
The term "Roseburia flagellin" as used herein refers to a flagellin protein derived or derivable from a Roseburia bacterium such as Roseburia. hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans. The Roseburia flagellin may be flaA1 , flaA2, flaA3, flaA4 or combinations thereof.
The terms "FlaA1", "Fla1", "flaA1" and "flal" are used interchangeably herein.
The terms "FlaA2", "Fla2", "flaA2" and "fia2" are used interchangeably herein.
The term Fla is used herein to encompass the polypeptides that may be flaA1 , flaA2, flaA3 flaA4 or fliC.
In one embodiment, the present invention encompasses the use of at least one Roseburia flagellin. For example, the present invention encompasses the use of a combination of at least two, at least three, at least four, or at least five Roseburia flagellins.
In some embodiments, the combination of Rosebuna flagellins comprises flagellins which are derived or derivable from at least two, three, four or five different Roseburia species.
Examples of Roseburia flagellins include flagellins derived or derivable from Roseburia bacterium such as Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans. In one embodiment, the flagellin is derived or derivable from Roseburia hominis. In another embodiment, the flagellin is derived or derivable from Roseburia intestinalis. Examples of Roseburia flagellins include polypeptide sequences having at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12 or variants, homologues, fragments or derivatives thereof. In one embodiment, the Roseburia flagellin has the polypeptide sequence shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
Examples of Roseburia hominis flagellins are Roseburia hominis Fla1 and Fla2. An example of Roseburia hominis Fla1 is shown as SEQ ID NO 2. Roseburia hominis Fla1 is also referred herein as RhFlaAI , RHFIaAI , RhFlal , RHFIal , RH1 or R 1.
SEQ ID NO 2 has the following sequence:
MWQHNLTAMNANRQLGITTGAQAKSSEKLSSGYKINRAADDAAGLTISEKMRSQVRGLN ASDNAQDGVSLIQVAEGALSETHSILQRMNELATQAANDTNTTSDRTAVQQEINQLASEITRI ASTTQFNTMNLIDGNFTSKKLQVGSLCGQAITIDISDMSATGLGVSGLWSSFSAAGKAMSA AQDAISYVSSMRSKLGALQNRLEHTISHLDNISEHTSSAESRIRDTDMAEEMVEYSKNNILAQ AGQSMLAQANQSTQGVLSLLQ SEQ ID NO 2 is deposited with NCBI under accession number ABI48297.1.
An example of Roseburia hominis Fla2 is shown as SEQ ID NO 4. Roseburia hominis Fla2 is also referred herein as RhFlaA2, RHFIaA2, RhFla2, RHFIa2, Rh2 or RH2. SEQ ID NO 4 has the following sequence:
MWNHNMAAICESRQLRYNVKKMEKSSK LATGYKLNTANDDAAGLQISETMRHHVKGLN ASRNSQDGISMLQTADAALQETQDVLDRMVELTTQAANDINTDSDRRAIQDELDQLNKEVD RIAYTTHFNQQYMLAEGTPQAAPGYYRIQSGALNGQAIDIHFVNASKESLGTDKVNVSSHAK ASESITMVQDAIEQAALWRDEFGSQQERLEHAVRNTDNTSQNTQSAESGIRDTNMNMEMV LYSTNRI LVHAS QSI LAQYN DDAKSVLE I LK
Examples of Roseburia intestinalis flagellins include Roseburia intestinalis Fla1 , Fla2, Fla3 and Fla4.
An example of Roseburia intestinalis Fla1 is shown as SEQ ID No 6. Roseburia intestinalis is also referred herein as RiFlaAI , RIFIaAI , RiFlal , RIFIal , Ri1 or RIl
SEQ ID NO 6 has the following sequence:
MRINYNVSAAIANKHLLGIEDNLSASMERLSSGLKINHSKDNPAGMAISNKMKAQIDGLNRAS QNASDGISVIQIADGALSETTSILQRMRELSVQAASDATMTPADKEAIQKEITSLKDEVDRIST DTEYNSKTLLDGSLDTRVYTKNATRVDISDHVKAGQYQLSIDTAATQAGPVTANQNYNSTAP VGASGTMSINGSKVEIEAADTYAEAFEKIRNAAETGETTVKIEKNGALSFTAEQYGMSSILEIA FDDKQLANALGFTADGGNSWEDPENKGSYVYGQIQNGKVIVPSGTDAEVTLTKPSDGTGF GDTATVKTDGNKITVTDRAGFEMSFLADAGYTGKLDFDVTDIGTMALHIGANEDQETRVRIP EVSCKSLYIDDADVTTVNGAGRGITQFDDAISKVSEVRSRLGAYQNRLESTVSSLDTFEENM TGAQSRLTDADMASEMTDYTHQNVLNQAAISVLTQANDLPQ
An example of Roseburia intestinalis Fla2 is shown as SEQ ID No 8. Roseburia intestinalis Fla2 is also referred herein as RiFlaA2 or RIFIaA2 or Ri2 or RI2.
SEQ ID NO 8 has the following sequence:
MWNHNMALICESRQLRCNVKNMEKSSKKLATGYKLLGANDDAAGLQISETMRHQTRGLN KASRNSQDGISMLQTADAALQETQEVLDRMTDLTTQAANDINTDADRRAIQDEIDQLNQEVD RIAYTTNFNQQYILADGTPQARPGYYMIQTGSLAGQGIEIKFVNASKESLGVDKVDVSSHAK ATESIAWQNAIEKAASFRDTFGAQQERLEHALRGTDNTSESTQRAESSRRDTNMNMEMV QYSTNRILVQASQSILAQYNDDAKYVLEMLKQVLQILQ
An example of Roseburia intestinalis Fla3 is shown as SEQ ID No 10. Roseburia intestinalis Fla3 is also referred herein as RiFla3 or RIFIa3 or Ri3 or RI3.
SEQ ID NO 10 has the following sequence:
MWQHNMTAMNANRMLGVTTSAQA SSEKLSSGYRINRAGDDAAGLTISEKMRSQIRGLN KASDNAQDGISLIQVAEGALSETHSILQRMNELATQAANDTNTTADRGAIQDEINQLTSEINRI SSTTQFNTQNLIDGTFANKNLQVGSICGQRITVSIDSMSAGSLNVSANLVKVNTFSAAGEAM SNIQGAISAISTQRSYLGALQNRLEHTISNLDNISENTQSAESRIRDTDMAEE VTYSKNNILA QAGQSMLAQANQSTQGVLSLLQ
An example of Roseburia intestinalis Fla4 is shown as SEQ ID No 12. Roseburia intestinalis Fla4 is also referred herein as RiFla4 or RIFIa4 or Ri4 or RI4. SEQ ID NO 12 has the following sequence:
MAMWQHNMSAMNANRNLGVTTGMQAKSSEKLSSGY INRAADDAAGLSISEKMRSQIR GLNKASDNAQDGISLIQTAEGALNESHSILQRMRELSVQAANGTETDDDREAVQNEVSQL QEELTRISETTEFNTMKLLDGSQSGSTSSTGSGPKFGWDATLDGALVTSNVKGIKVATAA ATTTKAGQETAIWAADGKTLTLNLSKNKVYTQDEIDDLIANAKQEDSSATGAPAEVKVSLK NGIFNADADTTAGTVTAGGVKAVSDEGTVTGFVGADTISFTANKYGAEFNDTVFKFKFDKA AGKEEVETNTAIEIDGANAVTAGEYTIHLAAGKEYTAEDLEDVLKTAGFDFDVKLSGNTPDE PNTLFATSGASTVTDITM GAGTAG AG LGSTDAMWGQAG YDSVSSGAG ITLQ I GANEGQT MSFSIDDMSARALGVDGNKVDLSTQAGAQKATDTIDAAIKKVSAQRGRMGAIQNRLEHTIS NLDTAAENTQTAESRIRDTDMAEEMVEYSKNNILAQAGQSMLAQANQSTQGVLSLLQ
The terms "polypeptide FlaA1", "FlaA1 polypeptide", "polypeptide Fla1" and "Fla1 polypeptide" are used interchangeably herein. The terms "polypeptide Fla2" and "Fla2 polypeptide" are used interchangeably herein. The terms "polypeptide Fla3" and "Fla3 polypeptide" are used interchangeably herein. The terms "polypeptide Fla4" and "Fla4 polypeptide" are used interchangeably herein.
In one aspect, the Roseburia flagellin is selected from the group consisting of Fla1 , Fla2, Fla3 and Fla4. In one embodiment, the Roseburia flagellin is selected from the group consisting of Fla2, Fla1 , Fla4 and combinations thereof. In a further embodiment, the Roseburia flagellin is Fla2.
In one aspect, the Roseburia flagellin is selected from the group consisting of Roseburia hominis Fla1 , Roseburia hominis Fla2, Roseburia intestinalis Fla1 , Roseburia intestinalis Fla2, Roseburia intestinalis Fla3 and Roseburia intestinalis Fla4. In one embodiment, the Roseburia flagellin is selected from the group consisting of Roseburia hominis Fla2, Roseburia intestinalis Fla2, Roseburia intestinalis Fla1 , Roseburia intestinalis Fla4 and combinations thereof. In a further embodiment, the Roseburia flagellin is selected from the group consisting of Roseburia hominis Fla2, Roseburia intestinalis Fla2 and combinations thereof. In another embodiment, the Roseburia flagellin is Roseburia intestinalis Fla2.
In one embodiment, the present invention encompasses the use of at least one polynucleotide sequence encoding a Roseburia flagellin. For example, the present invention encompasses the use of a combination of at least two, at least three, at least four, or at least five polynucleotide sequences encoding Roseburia flagellins. In one embodiment, the present invention encompasses the use of a polynucleotide sequence encoding at least one Roseburia flagellin. For example, the present invention encompasses the use of a polynucleotide sequence encoding a combination of at least two, at least three, at least four, or at least five polypeptide sequences encoding Roseburia flagellins.
The polynucleotide sequence encoding a Roseburia flagellin may encode flaA1 , flaA2, fla3, fla4 or combinations thereof. In some embodiments, the combination of polynucleotide sequences encoding Roseburia flagellins comprises polynucleotide sequences encoding flagellins which are derived or derivable from at least two, three, four or five different Roseburia species.
In some embodiments, the polynucleotide sequence encodes a combination of Roseburia flagellins which are derived or derivable from at least two, three, four or five different Roseburia species.
In another embodiment, the present invention encompasses the use of a combination of at least one Roseburia flagellin and at least one polynucleotide sequence encoding a Roseburia flagellin.
Examples of polynucleotide sequence encoding Roseburia flagellins include flagellins derived or derivable from Roseburia bacterium such as Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans. In one embodiment, the polynucleotide sequence encodes a Roseburia flagellin derived or derivable from Roseburia hominis. In another embodiment, the polynucleotide sequence encodes a Roseburia flagellin derived or derivable from Roseburia intestinalis.
Examples of polynucleotide sequences encoding Roseburia flagellin include the polynucleotide sequences encoding a polypeptide which has at least 75% identity to SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12 or variants, homoiogues, fragments or derivatives thereof and polynucleotide sequences having at least 75% identity to SEQ ID NO 1 , SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7, SEQ ID NO 9 or SEQ ID NO 11 or variants, homoiogues, fragments or derivatives thereof.
In one embodiment, the polynucleotide sequence encoding Roseburia flagellin has the polynucleotide sequence encoding a polypeptide which has the sequence shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
In one embodiment, the polynucleotide sequence encoding the Roseburia flagellin has the polynucleotide sequence shown as SEQ ID NO 1 , SEQ ID NO 3, SEQ ID NO 5, SEQ ID NO 7, SEQ ID NO 9 or SEQ ID NO 11.
Examples of polynucleotide sequences encoding Roseburia hominis flagellins are polynucleotide sequences encoding Roseburia hominis Fla1 and Fla2. An example of a polynucleotide sequence encoding Roseburia hominis Fla1 is shown as SEQ ID NO 1.
SEQ ID No 1 has the following sequence:
ATGGTAGTACAGCACAATCTTACAGCAATGAACGCTAACAGACAGTTAGGTATCACAAC AGGCGCACAGGCTAAGTCTTCTGAGAAGTTATCTTCTGGTTACAAGATCAACCGCGCAG CAG ATGAC G C AGCAGGTCTTACG ATTTC CG AG AAGATG AGAAG CCAG GTTAG AGG CTT AAATAAAGCTTCTGACAACGCACAGGATGGTGTATCCCTTATTCAGGTAGCTGAGGGTG CATTAAGTGAGACACACTCCATCTTACAGCGTATGAATGAGTTAGCAACTCAGGCAGCA AACGATACCAATACAACCTCAGACAGAACTGCAGTTCAGCAGGAGATCAACCAGTTAGC ATCTG AG ATC ACCAG AATC G CTTCTAC AACTCAGTTC AAC ACAATG AAC CTG ATCG ATG G TAACTTCACAAGTAAGAAGCTTCAGGTAGGTTCCCTTTGCGGACAGGCTATCACAATCG ATATCTCTGATATGTCTGCTACAGGTCTTGGCGTTAGCGGATTAGTAGTATCTTCCTTCT CTGCAGCTGGTAAGGCAATGTCTGCAGCTCAGGATGCTATCAGCTACGTATCTTCTATG C GTTCTAAG CTGG GTGCATTACAGAACAG ACTTG AG CACACAATCTCCCAC CTG G AC AA CATTTCTGAGCACACATCTTCTGCAGAGTCTCGTATCCGTGATACAGATATGGCTGAAG AGATGGTTGAGTACAGCAAGAACAACATCCTTGCTCAGGCAGGACAGTCTATGCTTGCT CAGGCTAACCAGTCTACTCAGGGTGTATTATCCTTATTACAGTAA
An example of a polynucleotide sequence encoding Roseburia hominis Fla2 is shown as SEQ ID NO 3.
SEQ ID No 3 has the following sequence:
ATGGTGGTTAATCATAATATGGCGGCAATCTGTGAGAGCAGGCAGCTGCGCTATAACGT GAAGAAGATGGAAA TCTTCCAAAAAGCTTGCGACAGGGTACAAGCTGAACACAGCAA ATGATGATGCGGCAGGCTTGCAGATATCAGAGACGATGCGGCATCATGTGAAAGGGCT GAACAAAGCCTCCCGGAATTCACAGGACGGCATCAGTATGCTGCAGACGGCGGATGCA GCGCTCCAAGAGACGCAGGATGTTCTCGATCGTATGGTGGAGCTGACGACGCAGGCAG CCAATGACATCAACACAGACTCGGATCGCAGGGCTATTCAGGATGAGTTGGATCAGCTG AACAAGGAAGTGGACCGCATCGCCTATACGACGCACTTCAATCAGCAGTATATGTTGGC GGAGGGAACGCCGCAGGCGGCACCGGGATATTACCGCATACAGTCCGGGGCACTGAA CGG ACAGG C G ATAG ATATC CATTTTGTAAATG C GAG CAAGG AGAG CCTTG GC AC AGAC AAAGTGAATGTATCTTCGCATGCGAAGGCGTCGGAATCCATCACGATGGTTCAGGACGC GATTGAACAGGCGGCGCTCTGGAGAGACGAGTTCGGCAGCCAGCAGGAGCGTCTGGA ACATGCCGTGCGCAATACGGACAACACATCACAAAATACGCAGAGTGCGGAGTCAGGG ATCAGAGACACCAACATGAATATGGAGATGGTATTATATTCGACCAACCGGATTCTGGT G CATG CATCC C AG AGTATTCTG G C AC AGTATAATG ATG ATG C AAAATCAGTG CTTG AG A TTTTGAAATAG
Examples of polynucleotide sequences encoding Roseburia intestinalis flagellins are polynucleotide sequences encoding Roseburia intestinalis Fla1 , Fla2, Fla3 and Fla4.
An example of a polynucleotide sequence encoding Roseburia intestinalis Fla1 is shown as SEQ ID NO 5.
SEQ ID No 5 has the following sequence:
ATG CGTG G CGG AG ACAATAGAAG G AG AAACAG AATG AG AATTAATTACAATGTGTCAG C AGCGATTGCGAATAAACATTTACTTGGAATTGAGGATAATTTAAGTGCATCGATGGAACG GCTTTCATCGGGACTTAAGATCAACCATTCCAAGGACAATCCGGCAGGAATGGCTATTT CCAACAAGATGAAAGCACAGATTGATGGTTTAAACCGGGCTTCCCAGAATGCATCGGAT GGTATTTCTGTTATTCAGATCGCAGATGGTGCGCTGAGTGAAACGACCAGTATTTTACA GCGTATGAGAGAACTTTCCGTGCAGGCAGCGAGTGATGCAACAATGACACCGGCGGAT AAAGAAGCAATCCAGAAAGAAATCACTTCATTAAAAGATGAAGTTGACCGTATTTCTACA G ATAC AG AGTATAACAGCAAAACACTTTTAG ATG GTTCATTAGATACCAG G GTTTACAC C AAAAATG C AAC AAG AGTGG ACATTTCTGATC ATGTG AAAG CAG GACAGTATCAG CTTTC CATTGATACTGCAGCTACACAGGCCGGACCGGTAACAGCAAATCAGAATTATAATTCCA CAGCACCGGTCGGTGCGTCCGGAACAATGAGTATTAATGGTTCTAAAGTAGAGATAGAG GCAGCCGACACCTATGCGGAGGCTTTTGAGAAGATCAGAAATGCAGCAGAGACTGGTG AAACAACCGTTAAG ATTG AAAAG AATGG AG CACTTTC ATTTACC G C AG AAC AGTAC G G A ATGTCAAGCATCTTAGAGATCGCATTNNTGATGATAAGCAGCTTGCTAATGCACTTGGAT TTAC AG CAG ACG G AGG AAACAGTGTTGTAG AAG ATCCAG AG AATAAAGG CAG CTATGTA TACGG ACAG ATTCAG AATG G CAAAGTGATC GTACCTTCCG GTACAG ATG CCG AAGTAAC GCTCACAAAACCGAGTGATGGAACCGGATTTGGTGATACAGCTACGGTAAAAACAGATG G AAATAAG ATTAC G GTTACAG ACAG AG CCG GATTTG AG ATGTC ATTTCTTG CTG ATG CA GGTTATACGGGTAAGCTGGATTTTGATGTCACGGATATCGGAACGATGGCACTTCATAT TGGAGCAAATGAGGATCAGGAAACAAGAGTGCGTATTCCGGAGGTTTCCTGCAAGAGC CTTTACATTGATGATGCAGACGTGACGACTGTAAATGGAGCAGGCAGAGGTATCACACA GTTTGACGATGCCATTTCAAAGGTCAGTGAAGTGCGTTCAAGACTTGGTGCATACCAGA ATCGTCTTGAGAGTACGGTATCAAGCCTGGATACGTTTGAAGAAAATATGACAGGAGCC CAGTCACGACTGACAGATGCGGATATGGCATCGGAAATGACAGATTATACACATCAGAA TGTATTAAATCAGGCAGCAATCTCTGTTTTGACACAGGCAAACGATCTGCCACAGCAGG TATTGCAGATTCTGCAGTAA
An example of a polynucleotide sequence encoding Roseburia intestinalis Fla2 is shown as SEQ ID NO 7. SEQ ID No 7 has the following sequence:
ATGGTAGTTAATCATAATATGGCATTGATCTGTGAGAGTAGACAGTTACGATGTAATGTG AAG AACATG G AG AAGTCTTC AAAAAAG CTG GCAACAG GTTATAAATTG CTTGGAG CAAA TGATGATGCAGCAGGATTACAGATATCAGAAACCATGCGTCATCAGACCAGAGGTCTTA ACAAAG C ATCC AGAAATTCG CAAGATGG AATTAGTATG CTG CAG ACAG CAG ATG C AG CA TTACAGGAGACACAGGAAGTGTTGGATCGAATGACGGATCTGACAACACAGGCAGCTA ATGATATCAATACGGATGCGGATCGTCGTGCAATTCAGGATGAAATCGATCAGTTAAATC AG GAAGTG GATCGTATTGC ATATACG ACG AATTTTAATCAG CAGTATATATTAG C G GATG GAACTCCGCAGGCAAGACCAGGATACTATATGATACAGACAGGAAGTCTTGCGGGACA GGGAATAGAGATTAAGTTTGTTAATGCGAGCAAAGAGAGCTTGGGTGTGGACAAGGTTG ATGTATCATC G C ATG CAAAAG CG ACAGAATCTATAG C AGTGGTACAGAATGCAATTGAA AAG G CAG CTTCGTTTAG AG ATAC ATTTG GG GCAC AAC AG GAG C GGTTAG AACACG C ATT GCGTGGAACGGATAATACATCAGAAAGTACACAGAGGGCAGAATCAAGTAGACGCGAT ACCAACATGAATATGGAGATGGTACAATATTCTACAAACCGTATTTTAGTACAGGCATCT CAGAGTATTTTAGCACAGTACAATGATGATGCAAAATATGTGTTGGAAATGTTAAAATAG
An example of a polynucleotide sequence encoding Roseburia intestinalis Fla3 is shown as SEQ ID NO 9.
SEQ ID No 9 has the following sequence.
ATGGTAGTACAGCACAATATGACCGCAATGAATGCGAACAGAATGTTAGGCGTTACAAC AAGCGCACAGGCAAAATCTTCAGAGAAATTATCTTCTGGTTACAGAATCAACCGTGCAG GTG ATG ACG CTG CTGGTTTAAC AATTTCTG AG AAG ATG AG AAG C CAG ATC C GTGG ATTA AACAAAGCTTCTGACAACGCACAGGATGGTATTTCCTTAATCCAGGTTGCTGAGGGTGC ATTATCTGAGACACATTCTATCTTACAGCGTATGAATGAGTTAGCTACTCAGGCTGCTAA CGATACCAATACAACTGCTGATAGAGGAGCTATTCAGGATGAGATCAACCAGTTAACAT CTGAGATTAACAGAATCTCTTCTACAACTCAGTTCAATACTCAGAACCTCATCGATGGTA CATTCGCAAATAAAAACCTTCAGGTTGGTTCTATCTGTGGACAGAGAATTACTGTTTCTA TCGACAGTATGTCTGCTGGTAGCTTAAATGTATCTGCTAACTTAGTAAAGGTTAACACTT TC AGTG CAG C AGGTG AAGCAATGTCCAATATTCAGG GTG CTATTTCTG C AATTTCTAC AC AGCGTTCTTACTTAGGAGCTCTTCAGAATCGTCTGGAGCATACAATCTCCAACTTGGACA ACATTTCTGAGAATACTCAGTCTGCTGAATCTCGTATCCGTGATACAGATATGGCTGAAG AGATGGTTACTTACAGCAAGAACAATATTCTTGCTCAGGCAGGACAGTCTATGCTTGCTC AGGCTAACCAGTCTACTCAGGGTGTACTTTCTCTGTTACAGTAA
An example of a polynucleotide sequence encoding Roseburia intestinalis Fla4 is shown as SEQ ID O 1 1. SEQ ID No 1 has the following sequence:
ATGGCAATGGTAGTACAGCACAACATGTCCGCAATGAATGCGAACAGAAATTTAGGTGT TAC AACAG G AATG CAG GC AAAATCATC AG AG AAGTTATCTTC C GGTTACAAG ATCAACC GTG CAG CAG ATG ATG CAG CAG G ACTTTCTATTTCTG AG AAGATG AGAAG CC AG ATC C GC G GTTTAAATAAAG CATCTG ACAATG C AC AG G ATGGTATCTCTTTAATCC AG ACC G CTG AG GGAGCATTAAATGAGTCCCACTCTATTTTACAGAGAATGAGAGAGTTATCCGTACAGGC AGCCAACGGTACAGAGACAGATGACGACCGCGAGGCAGTACAGAACGAGGTTTCCCAG TTACAG G AAG AG CTG AC AAG AATTTCTG AG AC AACAG AGTTCAAC AC G ATGAAGCTG CT G G ATG GTTCTC AG AGTG G AAGTACATCTTC AAC C G GGTCAG GTCC GAAGTTTGGTGTTG TAGATGCAACATTAGACGGTGCACTTGTAACATCTAACGTGAAAGGTATTAAAGTAGCAA CAG CAG CTG CCACAAC AACAAAG G C AG GTCAGG AGACTG CTATCTG G G CTG CTG ATG G AAAGACATTAACTTTAAATCTTTCGAAAAATAAGGTATATACACAGGACGAAATTGATGAC TTGATCGCAAATGCAAAACAGGAAGACAGTTCTGCAACGGGTGCACCGGCTGAAGTGA AAGTATCTTTAAAGAATGGTATTTTTAATGCAGATGCAGACACAACTGCCGGAACTGTAA CAG CC G GTG GTGTG AAG G CAGTATCTG ATGAAG GAACAGTAACTGG ATTTGTTG GTGC AGATACAATTTCATTTACGGCAAATAAGTATGGAGCAGAGTTCAATGATACTGTATTTAAA TTCAAATTTGATAAGGCAGCAGGCAAAGAAGAAGTAGAGACAAATACAGCAATTGAAATT GATGGAGCAAATGCGGTAACAGCAGGTGAATATACAATTCATCTTGCAGCAGGCAAAGA ATATACGGCAGAAGATTTAGAAGATGTTCTTAAAACGGCAGGATTCGACTTTGATGTTAA ATTAAGTGGAAATACACCAGATGAGCCAAATACTTTATTTGCAACCAGTGGCGCATCAAC TGTG ACTG ATATTACAATG G GTG CTGG CACCG CCGG AG CTG GTCTTG G AAGTAC AG AT GCTATGTGGGGGCAAGCTGGTTATGACAGTTATCTTCTGGTGCTGGCATTACCTTGCAG ATTGGTGCAAATGAAGGTCAGACCATGAGTTTCTCTATCGATGACATGAGTGCAAGAGC ACTTGGCGTAGATGGCAACAAAGTTGATTTAAGCACACAGGCTGGCGCACAGAAAGCAA CTGATACCATTGATGCAGCAATCAAGAAAGTATCTGCACAGCGTGGTAGAATGGGTGCG ATCCAGAACCGTCTGGAGCACACCATCAGCAACCTTGATACAGCAGCAGAGAATACCCA GACTGCAGAGTCCCGTATCCGTGATACAGATATGGCAGAAGAGATGGTTGAGTACTCCA AGAACAACATTCTTGCACAGGCAGGTCAGTCTATGCTTGCACAGGCGAACCAGTCTACA CAGGGTGTACTCTCCTTATTACAGTAA In one aspect, the polynucleotide sequence encodes a Roseburia flagellin selected from the group consisting of Fla1 , Fla2, Fla3 and Fla4. In one embodiment, the polynucleotide sequence encodes a Roseburia flagellin selected from the group consisting of Fla2, Fla1 , Fla4 and combinations thereof. In a further embodiment, the polynucleotide sequence encodes the Roseburia flagellin Fla2.
In one aspect, the polynucleotide sequence encoding Roseburia flagellin is selected from the group consisting of a polynucleotide sequence encoding Roseburia hominis Fla1 , a polynucleotide sequence encoding Roseburia hominis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla1 , a polynucleotide sequence encoding Roseburia intestinalis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla3 and a polynucleotide sequence encoding Roseburia intestinalis Fla4. In one embodiment, the polynucleotide sequence encoding Roseburia flagellin is selected from the group consisting of a polynucleotide sequence encoding Roseburia hominis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla1 , a polynucleotide sequence encoding Roseburia intestinalis Fla4 and combinations thereof. In a further embodiment, the polynucleotide sequence encoding Roseburia flagellin is selected from the group consisting of a polynucleotide sequence encoding Roseburia hominis Fla2, a polynucleotide sequence encoding Roseburia intestinalis Fla2 and combinations thereof. In another embodiment, the polynucleotide sequence encoding Roseburia flagellin is a polynucleotide sequence encoding Roseburia intestinalis Fla2. The therapeutic effect of flagellins were evaluated by the inventors by functional assays.
In one embodiment, the Roseburia flagellin is a truncated Roseburia flagellin. For example, the truncated Roseburia flagellin comprises at least 20, 30, 40, 50, 75, 100, 125, 150, 175 or 200 amino acids of polypeptide shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
In one embodiment, the truncated Roseburia flagellin is a truncated Roseburia hominis flagellin or a truncated Roseburia intestinalis flagellin. In one embodiment, the polynucleotide sequence encoding the Roseburia flagellin encodes a truncated FlaA1 , Fla2, Fla3 or Fla4. For example, the polynucleotide sequence encodes a truncated Roseburia flagellin comprising at least 20, 30, 40, 50, 75, 100, 125, 150, 175 or 200 amino acids of polypeptide shown as SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12.
In one embodiment, the polynucleotide sequence encoding the Roseburia flagellin encodes a truncated FlaA1 or Fla3.
In one embodiment, the Roseburia flagellin is a fusion polypeptide. For example, the polypeptide is fused to glutathione S-transferase (GST).
Table A - summary of the Roseburia flagellin sequences described herein and the bacterial strain from which they may be derived.
Figure imgf000036_0001
Figure imgf000037_0001
TGCAACAATGACACCGGCGGATAAAGA DPENKGSYVYGQIQNGKVIVPS
AGCAATCCAGAAAGAAATCACTTCATTA GTDAEVTLTKPSDGTGFGDTAT
AAAGATGAAGTTGACCGTATTTCTACAG VKTDGNKITVTDRAGFEMSFLAD
ATACAGAGTATAACAGCAAAACACTTTT AGYTGKLDFDVTDIGTMALHIGA
AGATGGTTCATTAGATACCAGGGTTTAC NEDQETRVRIPEVSCKSLYIDDA
ACCAAAAATGCAACAAGAGTGGACATTT DVTTVNGAGRGITQFDDAISKVS
CTGATCATGTGAAAGCAGGACAGTATCA EVRSRLGAYQNRLESTVSSLDTF
GCTTTCCATTGATACTGCAGCTACACAG EENMTGAQSRLTDAD ASEMT
GCCGGACCGGTAACAGCAAATCAGAAT DYTHQNVLNQAAISVLTQANDLP
TATAATTCCACAGCACCGGTCGGTGCG Q
TCCGGAACAATGAGTATTAATGGTTCTA
AAGTAGAGATAGAGGCAGCCGACACCT
ATGCGGAGGCTTTTGAGAAGATCAGAA
ATGCAGCAGAGACTGGTGAAACAACCG
TTAAGATTGAAAAGAATGGAGCACTTTC
ATTTACCGCAGAACAGTACGGAATGTCA
AGCATCTTAGAGATCGCATTN NTGATGA
TAAGCAGCTTGCTAATGCACTTGGATTT
ACAGCAGACGGAGGAAACAGTGTTGTA
GAAGATCCAGAGAATAAAGGCAGCTAT
GTATACGGACAGATTCAGAATGGCAAA
GTGATCGTACCTTCCGGTACAGATGCC
GAAGTAACGCTCACAAAACCGAGTGAT
GGAACCGGATTTGGTGATACAGCTACG
GTAAAAACAGATGGAAATAAGATTACGG
TTACAGACAGAGCCGGATTTGAGATGTC
ATTTCTTGCTGATGCAGGTTATACGGGT
AAGCTGGATTTTGATGTCACGGATATCG
GAACGATGGCACTTCATATTGGAGCAAA
TGAGGATCAGGAAACAAGAGTGCGTAT
TCCGGAGGTTTCCTGCAAGAGCCTTTAC
ATTGATGATGCAGACGTGACGACTGTAA
ATG G AGC AGG C AG AG GTATCAC AC AGT
TTGACGATGCCATTTCAAAGGTCAGTGA
AGTGCGTTCAAGACTTGGTGCATACCA
GAATCGTCTTGAGAGTACGGTATCAAGC
CTGGATACGTTTGAAGAAAATATGACAG
GAGCCCAGTCACGACTGACAGATGCGG
ATATGGCATCGGAAATGACAGATTATAC
Figure imgf000039_0001
Figure imgf000040_0001
C AG AGTTC AAC AC G ATG AAG CTGCTG G AN AVTAGEYTI H LAAG KEYTAED
ATGGTTCTCAGAGTGGAAGTACATCTTC LEDVLKTAGFDFDVKLSGNTPDE
AACCGGGTCAGGTCCGAAGTTTGGTGT PNTLFATSGASTVTDITMGAGTA
TGTAGATGCAACATTAGACGGTGCACTT GAGLGSTDAMWGQAGYDSVSS
GTAACATCTAACGTGAAAGGTATTAAAG GAGITLQIGANEGQTMSFSIDD
TAGCAACAGCAGCTGCCACAACAACAA SARALGVDGNKVDLSTQAGAQK
AGGCAGGTCAGGAGACTGCTATCTGGG ATDTIDAAIKKVSAQRGRMGAIQ
CTGCTGATGGAAAGACATTAACTTTAAA NRLEHTISNLDTAAENTQTAESRI
TCTTTCGAAAAATAAGGTATATACACAG RDTDMAEEMVEYSKNNILAQAG
GACGAAATTGATGACTTGATCGCAAATG QSMLAQANQSTQGVLSLLQ
CAAAACAGGAAGACAGTTCTGCAACGG
GTGCACCGGCTGAAGTGAAAGTATCTTT
AA AG AATG GT ATTTTTAATG C AG ATG C A
GACACAACTGCCGGAACTGTAACAGCC
GGTGGTGTGAAGGCAGTATCTGATGAA
GGAACAGTAACTGGATTTGTTGGTGCA
GATACAATTTCATTTACGGCAAATAAGT
ATGGAGCAGAGTTCAATGATACTGTATT
TAAATTCAAATTTGATAAGGCAGCAGGC
AAAGAAGAAGTAGAGACAAATACAGCAA
TTGAAATTGATGGAGCAAATGCGGTAAC
AGCAGGTGAATATACAATTCATCTTGCA
G C AGG C AAAG AATATACGG C AG AAG AT
TTAGAAGATGTTCTTAAAACGGCAGGAT
TC G ACTTTG ATGTTAAATTAAGTG G AAA
TACACCAGATGAGCCAAATACTTTATTT
GCAACCAGTGGCGCATCAACTGTGACT
GATATTACAATGGGTGCTGGCACCGCC
GGAGCTGGTCTTGGAAGTACAGATGCT
ATGTGGGGGCAAGCTGGTTATGACAGT
TATCTTCTGGTGCTGGCATTACCTTGCA
G ATTGGTG C AAATG AAG GTCAGACC AT
GAGTTTCTCTATCGATGACATGAGTGCA
AGAGCACTTGGCGTAGATGGCAACAAA
GTTG ATTTAAG C AC AC AG GCTGG CG C A
CAGAAAGCAACTGATACCATTGATGCAG
CAATCAAGAAAGTATCTGCACAGCGTG
GTAG AATG G GTG C G ATCC AG A AC C GTC
TGGAGCACACCATCAGCAACCTTGATAC
Figure imgf000042_0001
Table B - summary of the accession numbers for Roseburia flagellins described herein.
Figure imgf000043_0001
Modulation/regulation
The terms "modulation" and "regulation" may be used interchangeably herein.
In one embodiment, the term "modulation" refers to an increase and/or induction and/or promotion and/or activation. In an alternative embodiment, the term "modulation" refers to a decrease and/or reduction and/or inhibition. In one embodiment, the term "regulation" refers to an upregulation. In an alternative embodiment, the term "regulation" refers to a downregulation.
In one embodiment, the Roseburia flagellin, and/or Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), reduces the inflammation of a tissue or an organ.
For example, inflammation of the alimentary canal or part thereof (such as the intestine) is reduced.
The term "inflammation" as used herein refers to one or more of the following: redness, swelling, pain, tenderness, heat, and disturbed function of a tissue or organ due to an inflammatory process triggered by over-reaction of the immune system.
A reduction in inflammation in a subject can be determined by determining the levels of proinflammatory cytokines and chemokines in tissue, serum and/or faecal samples in a subject before, and after, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the levels of one or more of the following can be monitored: IL-1 , IL-4, IL5, IL6, IL- 8, IL-12, IL-13, IL-17, IL-21 , IL-22, IL23, TNFcc, IFNy, CXCL1 , CXCL10, CCL2, CCL20 serum and faecal calprotectin, SA1009/SA1008 calcium binding proteins, and Type 1 interferons, CD markers such as CD163, CD14, inflammatory transcription factors such as NF-kB, STAT, and MAPkinases, c-reactive protein (CRP), erythrocyte sedimentation rate (ESR), complement proteins, serum albumin, histological evaluation of target tissues and organs, disease activity indices. Further, in human studies quality of life (QoL) questionnaires can be carried out before, and after, the Roseburia flagellin, and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one embodiment, the amount of a tissue or organ which is inflamed in a subject is at least 10%, 20%, 30%, 40% or 50% lower when compared to the amount of tissue or organ which is inflamed in a subject before the Roseburia flagellin, and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one embodiment, the Roseburia flagellin, and/or Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), reduces the inflammation by epithelial cells of the tissue or the organ.
For example, the epithelial cells are epithelial cells of the alimentary canal or part thereof (such as the intestine).
In one embodiment, the Roseburia flagellin, and/or Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), increases the production of T cells in a subject.
In one embodiment, the T cells are regulatory T cells (also referred to as Tregs) such as regulatory T cells capable of expressing TLR5 (Toll-like receptor 5).
Without wishing to be bound by theory, an increase in Treg numbers will combat the effects of other effector T cells (also referred to as Teffs), such as Th1 , Th17 and Th2 which drive inflammation, autoimmunity and allergic/atopic conditions. Hence this property of the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), can be exploited to address many diseases where Teff/Treg cell balance is lost, e.g. Crohn's and ulcerative colitis.
In one embodiment, the production of T cells in a subject is increased such that there are at least 10%, 20%, 30%, 40% or 50% more T cells, or greater than 100% more T cells, when compared to the number of T cells in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "immune system" as used herein may refer to the adaptive immune system and/or the innate immune system. In one aspect, the invention relates to the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the adaptive immune system of a subject. As used herein, the term "adaptive immune system", otherwise known as the "specific immune system" refers to highly specialized, systemic cells and processes that eliminate or prevent pathogenic growth. The adaptive immune response provides the vertebrate immune system with the ability to recognize and remember specific pathogens (to generate immunity), and to mount stronger attacks each time the pathogen is encountered.
As used herein, the term "regulating the adaptive immune system" means inducing the activity of the adaptive immune system, and/or promoting immune homeostatic mechanisms by increasing the level of activity relative to the baseline level of activity. Preferably, the adaptive immune system is modulated towards immune regulation (and not immune activation therefore reducing inflammation).
Defects and disorders associated with the adaptive immune system, particularly related to the function of T cells, are associated with many inflammatory and autoimmune diseases. T cell responses associated with Th1 , Th2 and Th17 are associated with atopic, inflammatory and autoimmune diseases. Therapies which improve or increase T regulatory (Tregs) cell populations are important in controlling diseases driven by excessive Th1 , Th2 and Th17 cell responses. Another aspect of the invention relates to the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in regulating the innate immune system of a subject.
As used herein, the term "innate immune system", also known as the non-specific immune system, comprises the cells and mechanisms that provide the host with immediate defence against infection by other organisms in a non-specific manner. This means that the cells of the innate system recognize and respond to pathogens in a generic way, but unlike the adaptive immune system, it does not confer long-lasting or protective immunity to the host.
As used herein, the term "regulating the innate immune system" means inducing the activity of the innate immune system, and/or increasing the level of activity relative to the baseline level of activity such that it promotes immune homeostasis. Loss or dysregulation of the innate immune function, either due to loss of epithelial barrier, innate immune peptides such as defensins, chemokines and cytokines or defective TLR signalling are associated with increased risk of inflammatory diseases, in several body organs including the gut. Such diseases include inflammatory bowel disease.
In one embodiment, the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), restores immunological tolerance.
As used herein, the term "immunological tolerance" refers to the process by which the immune system does not attack an antigen such as a self-antigen.
As used herein the term "restoring immunological tolerance" refers to a restoration in immunological tolerance to one or more antigens (such as a self-antigen) in a subject such that the level of immunological tolerance to the antigen is higher when compared to the levels in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one embodiment, the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), activates dendritic cells and/or epithelial cells.
As used herein the term "activates dendritic cells" refers to an up-regulation of one or more cells markers (such as l-A/l-E cell markers, CD80 and CD86 and CD40) and/or an increase in the production of one or more cytokines (such as IL-10 and TGFp) by cells (such as dendritic cells) in a subject when compared to the levels in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "l-A/l-E" as used herein refers to cell markers of MHC class II. CD40 has an essential role in immunity, and is one of the best characterized of the costimulatory molecules. This receptor, a member of the tumor necrosis factor receptor family, is expressed by professional antigen-presenting cells, such as dendritic cells. CD40 binds its ligand CD40L, which is transiently expressed on T cells and other non-immune cells under inflammatory conditions.
CD40L is an example of a T cell marker. CD3, CD4, CD25, FoxP3, CTLA-4, Ly6g and CD1 1 b are further examples of T cell markers.
CD80 and CD86 are expressed on antigen-presenting cells (such as dendritic cells) and are required for the development and costimulation of T cell responses. The CD28 and CTLA-4 molecules on T cells serve as receptors for the CD80 and CD86 costimulatory antigens.
CD3, CD4, CD25, FoxP3, CTLA-4, Ly6g and CD1 1 b are examples of markers of colonic T regulatory cells.
Without wishing to be bound by theory, the depletion of Ly6g (e.g. Ly6g6c and Iy6g6e) increases infection risk, both gut and respiratory tract and is associated with diseases such as neutropenia. Thus, in one embodiment, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is for use in treating neutropenia.
Another aspect of the invention relates to the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), for use in maintaining immune homeostasis in a subject. As used herein "maintaining immune homeostasis" refers to the self-regulation of the body's immune system to maintain oral tolerance or immune stability in response to changing conditions. Oral tolerance refers to the normal immune responses to food and commensal bacteria in a healthy gut. These are lost in coeliac disease and Inflammatory Bowel Diseases such as Crohn's disease and ulcerative colitis. Thus, in one aspect, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is for use in treating coeliac disease and Inflammatory Bowel Diseases such as Crohn's disease and ulcerative colitis.
In one embodiment, the numbers of a cell marker on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of the cell marker on the cell(s), or greater than 100% more of the cell marker on the cell(s), when compared to the number of the cell marker on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have the cell marker are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have the cell marker, or greater than 00% more cells which have the cell marker, when compared to the number of cell with the cell marker in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FIaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In one aspect, the cells are T cells.
In another aspect, the cells are cells of the alimentary canal (such as cells of the intestine).
In a further aspect, the cells are colonic and/or small intestinal T regulatory cells and may be either CD4 or CD8 positive.
In one aspect, the cell marker is a T cell marker. In another aspect, the cells marker is a colonic T cell marker.
Markers which are type l-A/l-E are examples of a cell marker. CD40 is another example of a cell marker both found on dendritic cells. In one embodiment, the level of a cytokine in a subject is increased such that the cytokine level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the cytokine level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. Examples of dendritic cells include bone marrow dendritic cells and gut mucosal dendritic cells.
As used herein the term "activates epithelial cells" refers to an increase in the expression of one or more pro-inflammatory genes by epithelial cells in a subject when compared to the expression levels in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. The term "pro-inflammatory gene" as used herein refers to a gene which, when expressed, promotes inflammation. Examples of pro-inflammatory genes include genes encoding but not limited to ΙΙ_1-β, IL4, IL5, IL6, IL8, IL12, IL13, IL17, IL21 , IL22, IL23, IL27, IFNy, CCL2, CCL3, CCL5, CCL20, CXCL5, CXCL10, CXCL12, CXCL13, and TNF-a.
In one embodiment, the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), upregulates the production of a cytokine.
The term "upregulates the production of a cytokine" as used herein refers to an increase in the level of a cytokine in a subject compared to the level of the cytokine in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), is administered to the subject.
In one embodiment, the level of the cytokine is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), is administered to the subject.
In another embodiment, the Roseburia flagellin, and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), upregulates the production of IL-10 and/or TGFp.
The term "upregulates the production of IL-10" as used herein refers to an increase in the level of IL-10 in a subject compared to the level of IL-10 in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one embodiment, the level of IL-10 is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In some aspects, IL-10 is produced by dendritic cells such as bone marrow derived dendritic cells and gut mucosal dendritic cells in particular CD103+ subsets.
In one embodiment, the Roseburia flagellin, and/or the Fla polypeptide, and/or the polynucleotide sequence encoding the Roseburia flagellin and/or the Fla (such as FlaA1 or FlaA2) polypeptide, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), upregulates the production cell surface markers involved in immune responses and antigen recognition in a cell or cells of a subject.
Examples of cell surface markers involved in immune responses and antigen recognition include CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent.
Cell surface markers (e.g. CD317/BST-2) may be referred by different names in different species or the cell surface marker may not yet have been identified on the cells of a particular species. The term "species equivalent" as used herein encompasses these cell surface markers.
The term "upregulates the production CD40" as used herein refers to an increase in the level of CD40 in a subject compared to the level of CD40 in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing the cell marker CD40 is increased and/or the number of CD40 markers on a cell is increased. In one embodiment, the numbers of the CD40 cell marker on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of the cell marker on the cell(s), or greater than 100% more of the cell marker on the cell(s), when compared to the number of the cell marker on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have the cell marker CD40 are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have the cell marker, or greater than 100% more cells which have the cell marker, when compared to the number of cell with the cell marker in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. The term "upregulates the production l-A/l-E" as used herein refers to an increase in the level of l-A/l-E in a subject compared to the level of l-A/l-E in a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing one or more l-A/l-E cell markers is increased and/or the number of l-A l-E cell markers on a cell is increased.
In one embodiment, the numbers of the l-A l-E cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of l-A l-E cell markers on the cell(s), or greater than 100% more of l-A l-E cell markers on the cell(s), when compared to the number of l-A/l-E cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have l-A/l-E cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have l-A/l-E cell markers, or greater than 100% more cells which have l-A/l-E cell markers, when compared to the number of cell with l-A l-E cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. The term "upregulates the production of CD317/BST-2" as used herein refers to an increase in the level of CD3 7/BST-2 in a subject compared to the level of CD317/BST-2 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing one or more CD317/BST-2 cell markers is increased and/or the number of CD317/BST-2 cell markers on a cell is increased.
In one embodiment, the numbers of the CD317/BST-2 cell markers on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD317/BST-2 cell markers on the cell(s), or greater than 100% more of CD317/BST-2 cell markers on the cell(s), when compared to the number of CD317/BST-2 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have CD317/BST-2 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD317/BST-2 cell markers, or greater than 100% more cells which have CD317/BST-2 cell markers, when compared to the number of cell with CD317/BST-2 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. The term "upregulates the production of CD103" as used herein refers to an increase in the level of CD103 in a subject compared to the level of CD103 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing one or more CD103 cell markers is increased and/or the number of CD103 cell markers on a cell is increased. In one embodiment, the numbers of the CD103 cell markers on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD103 cell markers on the cell(s), or greater than 100% more of CD103 cell markers on the cell(s), when compared to the number of CD 103 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have CD103 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD103 cell markers, or greater than 100% more cells which have CD103 cell markers, when compared to the number of cell with CD103 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "upregulates the production of CD80" as used herein refers to an increase in the level of CD80 in a subject compared to the level of CD80 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing one or more CD80 cell markers is increased and/or the number of CD80 cell markers on a cell is increased.
In one embodiment, the numbers of the CD80 cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD80 cell markers on the cell(s), or greater than 100% more of CD80 cell markers on the cell(s), when compared to the number of CD80 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have CD80 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD80 cell markers, or greater than 100% more cells which have CD80 cell markers, when compared to the number of cell with CD80 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "upregulates the production of CD86" as used herein refers to an increase in the level of CD86 in a subject compared to the level of CD86 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing one or more CD86 cell markers is increased and/or the number of CD86 cell markers on a cell is increased.
In one embodiment, the numbers of the CD86 cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD86 cell markers on the cell(s), or greater than 100% more of CD86 cell markers on the cell(s), when compared to the number of CD86 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have CD86 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD86 cell markers, or greater than 100% more cells which have CD86 cell markers, when compared to the number of cell with CD86 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "upregulates the production of CD83" as used herein refers to an increase in the level of CD83 in a subject compared to the level of CD83 in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing one or more CD83 cell markers is increased and/or the number of CD83 cell markers on a cell is increased.
In one embodiment, the numbers of the CD83 cell markers on the cell(s) of a subject are up- regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of CD83 cell markers on the cell(s), or greater than 100% more of CD83 cell markers on the cell(s), when compared to the number of CD83 cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have CD83 cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have CD83 cell markers, or greater than 100% more cells which have CD83 cell markers, when compared to the number of cell with CD83 cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "upregulates the production of Siglec-H" as used herein refers to an increase in the level of Siglec-H in a subject compared to the level of Siglec-H in a subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. For example, the number of cells bearing one or more Siglec-H cell markers is increased and/or the number of Siglec-H cell markers on a cell is increased.
In one embodiment, the numbers of the Siglec-H cell markers on the cell(s) of a subject are up-regulated such that there are at least 10%, 20%, 30%, 40% or 50% more of Siglec-H cell markers on the cell(s), or greater than 100% more of Siglec-H cell markers on the cell(s), when compared to the number of Siglec-H cell markers on the cell(s) of the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition or alternatively, the number of cells in a subject which have Siglec- H cell markers are increased such that there are at least 10%, 20%, 30%, 40% or 50% more cells which have Siglec-H cell markers, or greater than 100% more cells which have Siglec-H cell markers, when compared to the number of cell with Siglec-H cell markers in the subject before the Roseburia flagellin, and/or the polypeptide Fla, and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said Fla, and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In some aspects, the production of CD40 l-A/l-E, CD317/BST-2, CD80, CD86, CD83 and/or Siglec-H is by dendritic cells (such as tolerogenic CD103+ dendritic cells expanded by FLT3L).
In one embodiment, the expression of one or more Type I IFN genes in a cell or cells of a subject is downregulated.
In one embodiment, the expression level of one or more Type I IFN genes is decreased such that the level is at least 10%, 20%, 30%, 40% or 50% lower when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
Examples of Type I IFN genes include but not limited to IFN-βΙ , IFN-p3, Ifi202b, ΙΠ203, IFI44, IFTI, MXI, OASI, OAS2, OAS3, OASL, lr†3 and Irf4.
In one embodiment, the expression of one or more pro-inflammatory genes in a cell or cells of a subject is downregulated.
In one embodiment, the expression level of one or more pro-inflammatory genes is decreased such that the level is at least 10%, 20%, 30%, 40% or 50% lower when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "intestinal microbiota" as used herein refers to microorganisms that live in the digestive tract of the host animals. These microorganisms perform a wide variety of metabolic, structural, protective and other beneficiary functions.
As used herein, the term "improving intestinal microbiota" refers to increasing the number and/or type of microorganisms present in the intestine of a subject (e.g. the host), and/or increasing the activity of said microorganisms in terms of their metabolic, structural, protective and other beneficiary functions. For example, the numbers (i.e. levels) of Clostridium cluster XlVa bacteria are increased and the numbers of E. coli are reduced; such an improvement in intestinal microbiota may occur in subjects with inflammatory bowel disease (IBD) once the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAI or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAI or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), has been administered to the subject.
In one embodiment, the number of microorganisms present in the intestine of a subject (e.g. the host), is increased such that the number of microorganisms is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition, or alternatively, the types of microorganisms present in the intestine of a subject (e.g. the host), are increased such that there are at least 5%, 10%, or 15% more types of microorganisms when compared to the types in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
As used herein, the term "regulating appetite" refers to the ability to modulate (i.e. increase or decrease) the desire for a subject to eat food. In one embodiment, the appetite in the subject is stimulated (i.e. increased).
Without wishing to be bound by theory, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), exerts a stimulatory effect on the appetite of a subject by downregulating the expression of genes associated with the suppression of appetite (such as genes encoding satiety hormones). Agt, Cartpt, Cck, Cxcl12 and Gcg are examples of genes associated with regulating appetite and the downregulation of one or more of these genes is associated with the suppression of appetite. Cck and Gcg are examples of satiety hormones.
In one aspect, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), stimulates the appetite in the subject such that the subject consumes at least 5%, 10%, or 15% more food when compared to the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In addition, or alternatively, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), stimulates the appetite in the subject such that after 1 month from administration the weight of the subject is at least 2%, 5%, or 10% higher when compared to the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one embodiment, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), reduces the level of cholecystokinin (Cck) and/or glucagon (Gcg) in the blood of a subject.
In one aspect, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), reduces the level of cholecystokinin (Cck) and/or glucagon (Gcg) in the blood of a subject by at least 5%, 10%, 15% or 20% when compared to the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), is administered to the subject.
In one embodiment, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), downregulates the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
In one aspect, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinaiis), decreases the expression of the gene encoding cholecystokinin (Cck) such that the expression level is at least 5%, 10%, 15% or 20% lower when compared to the expression level in the subject before the Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2) and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2) and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one aspect, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), decreases the expression of the gene encoding glucagon (Gcg) such that the expression level is at least 5%, 10%, 15% or 20% lower when compared to the expression level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
The term "improving alimentary canal health" as used herein refers to reducing the level of inflammation in the alimentary canal or part thereof and/or improving intestinal microbiota.
In one embodiment, the level of inflammation in the alimentary canal is at least 10%, 20%, 30%, 40% or 50% lower when compared to the level of inflammation in the alimentary canal of a subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In one embodiment, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), regulates the expression of at least one gene selected from Tlr5, Tir1, Vnn1, Defb37, Pla2g, Muc16, Itln, Sprrla, Cldn4, Pmp22, Crb3, Magi3, Man/eld3, Mpp7, Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a. Many of these genes are gut barrier genes and antimicrobials and hence work to reduce invasiveness of gut pathogens and also reduce the numbers of viable pathogens.
In one embodiment, the expression of one or more genes selected from the group consisting of TLR-related genes (e.g. Tlr5, Tlr1, and Vnn1), genes encoding anti-microbial peptides (e.g. Defb37, Pla2g, Muc16, and Itln), gut barrier function genes (e.g. Sprrla, Cldn4, Pmp22, Crb3, and Mag/3), innate immune genes (e.g. Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a) in a cell or cells of a subject is upregulated. In one embodiment, the expression of one or more genes selected from the group consisting of TLR-related genes (e.g. Tlr5, Tlr1, and Vnn1), genes encoding anti-microbial peptides (e.g. Defb37, Pla2g, Mud 6, and Itln), gut barrier function genes (e.g. Sprrla, Cldn4, Pmp22, Crb3, and Magi3), innate immune genes (e.g. Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a) is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one embodiment, the expression of one or more genes selected from the group consisting of Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, Itln, Sprrla, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a in a cell or cells of a subject is upregulated.
In one embodiment, the expression level of one or more genes selected from the group consisting of Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, Itln, Sprrla, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a is increased such that the level is at least 10%, 20%, 30%, 40% or 50% higher, or greater than 100% higher, when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject.
In one embodiment, the expression of one or more genes selected from the group consisting of genes encoding acetyl-CoA acetyltransferase, 3-hydroxyacyl-CoA dehydrogenase, butyryl- CoA dehydrogenase and phosphoenolpyruvate carboxykinase [ATP] in a cell or cells of a subject is modulated.
In one embodiment, the expression level of one or more genes selected from the group consisting of genes encoding acetyl-CoA acetyltransferase, 3-hydroxyacyl-CoA dehydrogenase, butyryl-CoA dehydrogenase and phosphoenolpyruvate carboxykinase [ATP] is modulated such that the level is at least 10%, 20%, 30%, 40% or 50% higher or lower when compared to the level in the subject before the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is administered to the subject. In a further aspect, the present invention relates to a transformed microorganism (such as a Firmicutes e.g. a Roseburia spp such as R. hominis or R. intestinalis) in which the expression of a flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2 is enhanced compared to the equivalent microorganism prior to transformation, and uses thereof for various therapeutic and nutritional uses as described herein. For example, the transformed microorganism may have been transformed with a nucleotide sequence (such as a promoter) such that the microorganism is capable of upregulating the expression of the gene encoding a flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2. In another example, the transformed microorganism may have be transformed with an expression vector comprising a nucleotide sequence encoding a flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2 operably linked to a regulatory sequence (such as a promoter) such that the microorganism is capable of overexpressing the gene encoding the flagellin (e.g. Roseburia flagellin) such as FlaA1 or FlaA2.
As used herein, the term "expression vector" refers to a DNA construct containing a DNA coding sequence (e.g., gene sequence) that is operably linked to one or more suitable control sequence(s) capable of affecting expression of the coding sequence in a host. Such control sequences include a promoter to effect transcription, an optional operator sequence to control such transcription, a sequence encoding suitable mRNA ribosome binding sites, and sequences which control termination of transcription and translation. The vector may be a plasmid, a phage particle, or simply a potential genomic insert. Once transformed into a suitable host, the vector may replicate and function independently of the host genome, or may, in some instances, integrate into the genome itself. The plasmid is the most commonly used form of expression vector. However, the description is intended to include such other forms of expression vectors that serve equivalent functions and which are, or become, known in the art. The term "operably linked" refers to juxtaposition wherein the elements are in an arrangement allowing them to be functionally related. For example, a promoter is operably linked to a coding sequence if it controls the transcription of the coding sequence.
Tissues
In one embodiment, the tissue or organ is the alimentary canal or a section thereof (e.g. the oesophagus, the stomach or the intestine such as the small intestine or the large intestine and colon) or another mucosal sites (such as the nasal passages and the lungs). In one embodiment, the tissue or organ is the alimentary canal or part thereof.
Examples of parts of the alimentary canal include the oesophagus, the stomach and the intestine (such as the small intestine (e.g. the duodenum, the jejunum and the ileum) and/or the large intestine (e.g. the caecum, ascending colon, transverse colon, descending colon, and sigmoid colon)).
Subject
In one embodiment, the subject is a monogastric animal.
Examples of monogastric animals include poultry, humans, rats, pigs, dogs, cats, horses and rabbits.
In another embodiment, the subject is a mammal such as a monogastric mammal.
Examples of monogastric mammals include omnivores (such as humans, rats, and pigs), carnivores (such as dogs and cats), and herbivores (such as horses and rabbits). In one embodiment, the subject is a human.
Typically, TLR5 is capable of being expressed in the cells of said subject. Disorders
Roseburia flagellin, and/or polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), may be used in treating a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
In one embodiment, the inflammatory disorder and/or an autoimmune disorder affects the alimentary canal, or a section thereof, of said subject.
In one embodiment, the inflammatory disorder and/or an autoimmune disorder affects a mucosal site of a subject. Examples of mucosal sites include the alimentary canal or a section thereof (e.g. the oesophagus, the stomach or the intestine such as the small intestine or the large intestine and colon), the nasal passages and the lungs.
In one embodiment, the inflammatory disorder and/or an autoimmune disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes, coeliac disease, atopic dermatitis, rhinitis, irritable bowel syndrome (IBS), colitis, inflammatory bowel disorder (IBD), ulcerative colitis, pouchitis, Crohn's disease, functional dyspepsia, atopic diseases, necrotising enterocolitis, and combinations thereof. In one aspect, the inflammatory disorder is colitis. In a further aspect, the inflammatory disease is Crohn's disease, ulcerative colitis or pouchitis.
In one aspect, the inflammatory disorder and/or an autoimmune disorder affects the intestine. In one aspect, the intestinal disorder is IBS. The precise pathophysiology of IBS remains to be elucidated. Recent studies have described mucosal inflammation and alterations in intestinal microbiota in IBS patients and a disease correlation with intestinal infections. In a further aspect, the intestinal disorder is Crohn's disease. In one aspect, the disorder is an autoimmune disorder.
In one aspect, the autoimmune disorder is selected from the group consisting of ulcerative colitis, pouchitis, rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes, allergies (including coeliac disease), atopic dermatitis and rhinitis. In particular due to its function in restoring immune tolerance, the autoimmune diseases, rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes are of particular relevance.
As used herein, the term "medicament" encompasses medicaments for both human and animal usage in human and veterinary medicine. In addition, the term "medicament" as used herein means any substance, which provides a therapeutic and/or beneficial effect. The term "medicament" as used herein is not necessarily limited to substances, which need Marketing Approval, but may include substances which, can be used in cosmetics, nutraceuticals, food (including feeds and beverages for example), probiotic cultures, nutritional supplements and natural remedies. In addition, the term "medicament" as used herein encompasses a product designed for incorporation in animal feed, for example livestock feed and/or pet food.
Prophylactic applications
The Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), according to the invention may also be used in prophylactic applications. In prophylactic applications, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), according to the invention are administered to a patient susceptible to, or otherwise at risk of, a particular disease in an amount that is sufficient to at least partially reduce the risk of developing a disease. Such an amount is defined to be "a prophylactic effective dose". The precise amounts depend on a number of specific factors such as the subject's state of health and weight. Encapsulation
In one embodiment, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin of the polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated.
In a further embodiment, the pharmaceutical composition comprising the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated.
In another embodiment, the nutritional supplement comprising the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or the polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), is encapsulated. In a further embodiment, the feedstuff, food product, dietary supplement, or food additive is encapsulated.
The term "encapsulated" as used here refers to a means for protecting the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), from an incompatible environment by physical separation so that it can be delivered to the target site (e.g. the intestine) without degradation or significant degradation in order that the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell, and/or the Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), can have an effect on the target site. An example is an enteric coated capsule.
Even when the objective of the encapsulation is the isolation of the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell, and/or the Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), from its surroundings, the protective coating or shell must be ruptured at the time of desired action. The rupturing of the protective coating or shell is typically brought about through the application of chemical and physical stimuli such as pressure, enzyme attack, chemical reaction and physical disintegration.
For example, the encapsulation ensures that the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell, and/or the Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), can be ingested so that the polypeptide, and/or polynucleotide sequence, and/or the vector, and/or the host cell and/or the Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), can be delivered to the intestine (i.e. the target site) in an amount which is effective to produce an effect in the intestine.
Pharmaceutical composition
The pharmaceutical composition may be any pharmaceutical composition. In one aspect, the pharmaceutical composition is to be administered orally, enterally or rectally. For example, the composition may be an edible composition. "Edible" means a material that is approved for human or animal consumption.
The pharmaceutical compositions may be for human or animal usage in human and veterinary medicine.
Examples of such suitable excipients for the various different forms of pharmaceutical compositions described herein may be found in the "Handbook of Pharmaceutical Excipients, 2nd Edition, (1994), Edited by A Wade and PJ Weller.
Acceptable carriers or diluents for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington's Pharmaceutical Sciences, Mack Publishing Co. (A. R. Gennaro edit. 1985).
Examples of suitable carriers include lactose, starch, glucose, methyl cellulose, magnesium stearate, mannitol, sorbitol and the like. Examples of suitable diluents include ethanol, glycerol and water.
The choice of pharmaceutical carrier, excipient or diluent can be selected with regard to the intended route of administration and standard pharmaceutical practice. The pharmaceutical compositions may comprise as, or in addition to, the carrier, excipient or diluent any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), solubilising agent(s).
Examples of suitable binders include starch, gelatin, natural sugars such as glucose, anhydrous lactose, free-flow lactose, beta-lactose, corn sweeteners, natural and synthetic gums, such as acacia, tragacanth or sodium alginate, carboxymethyl cellulose and polyethylene glycol.
Examples of suitable lubricants include sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and the like. Preservatives, stabilizers, dyes and even flavouring agents may be provided in the pharmaceutical composition. Examples of preservatives include sodium benzoate, sorbic acid and esters of p-hydroxybenzoic acid. Antioxidants and suspending agents may be also used. Nutritional supplements
Nutritionally acceptable carriers, diluents and excipients include those suitable for human or animal consumption and that are used as standard in the food industry. Typical nutritionally acceptable carriers, diluents and excipients will be familiar to the skilled person in the art.
Feedstuff/products
A further aspect of the invention relates to feedstuffs, food products, dietary supplements and food additives containing Roseburia flagellin, and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis),.
The terms "feedstuff', "food product" "food additive" and "dietary supplement" as used herein are intended to cover all consumable products that can be solid, jellied or liquid.
Suitable food products may include, for example, functional food products, food compositions, pet food, livestock feed, health foods, feedstuffs and the like. In one aspect, the food product is a health food.
As used herein, the term "functional food product" means food that is capable of providing not only a nutritional effect, but is also capable of delivering a further beneficial effect to the consumer. Accordingly, functional foods are ordinary foods that have components or ingredients (such as those described herein) incorporated into them that impart to the food a specific functional - e.g. medical or physiological benefit - other than a purely nutritional effect.
Examples of specific food products that are applicable to the present invention include milk- based products, ready to eat desserts, powders for re-constitution with, e.g., milk or water, chocolate milk drinks, malt drinks, ready-to-eat dishes, instant dishes or drinks for humans or food compositions representing a complete or a partial diet intended for pets or livestock.
In one aspect, the feedstuff, food product, dietary supplement or food additive according to the present invention are intended for humans, pets or livestock such as monogastric animals. The feedstuff, food product, dietary supplement or food additive may be intended for animals selected from the group consisting of dogs, cats, pigs, horses, or poultry. In a further embodiment, the food product, dietary supplement or food additive is intended for adult species, in particular human adults. The term "milk-based product" as used herein means any liquid or semi-solid milk or whey based product having a varying fat content. The milk-based product can be, e.g., cow's milk, goat's milk, sheep's milk, skimmed milk, whole milk, milk recombined from powdered milk and whey without any processing, or a processed product, such as yoghurt, curdled milk, curd, sour milk, sour whole milk, butter milk and other sour milk products. Another important group includes milk beverages, such as whey beverages, fermented milks, condensed milks, infant or baby milks; flavoured milks, ice cream; milk-containing food such as sweets. The feedstuffs, food products, dietary supplements or food additives of the present invention may be - or may be added to - food supplements, also referred to herein as dietary or nutritional supplements or food additives. The feedstuffs, food products, dietary supplements or food additives according to the invention may also be used in animal nutrition (e.g. in pig nutrition), particularly in the early- weaned period and growing fattening period. The feedstuffs, food products, dietary supplements or food additives are expected to enhance immune function reduce and prevent infectious diseases, beneficially alter the microbiota composition, and improve growth and performance of animals, for example, through increased feed conversion efficiency.
Probiotics or live biotherapeutic product
The Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), may be used in a probiotic or live biotherapeutic product.
Another aspect of the invention relates to a probiotic composition comprising the Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or said polypeptide Fla (such as FlaA1 or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis). As used herein, the term "probiotic" means microbial cell preparations or components of microbial cells with a beneficial effect on the health or well-being of the host. (Salminen S, Ouwehand A. Benno Y. et al "Probiotics: how should they be defined" Trends Food Sci. Technol. 1999: 10 107-10). In one aspect, the probiotic composition is an orally administrable composition of metabolically active, i.e., live and/or or lyophilized, or non-viable heat-killed, irradiated or lysed probiotic bacteria. The probiotic composition may contain other ingredients. The probiotic composition can be administered orally, i.e., in the form of a tablet, capsule or powder. The probiotic composition may comprise the bacterial species R. hominis or R. intestinalis. Encapsulated products are favoured for R. hominis and R. intestinalis as they are anaerobes. Other ingredients (such as vitamin C, for example), may be included as oxygen scavengers and prebiotic substrates (such as these improve the colonisation and survival in vivo). Alternatively, the probiotic composition of the invention may be administered orally as a food or nutritional product, such as milk or whey based fermented dairy product, or as a pharmaceutical product. A suitable daily dose of the probiotic bacteria is from about 1 x 103 to about 1 x 1011 colony forming units (CFU); for example, from about 1 x 107 to about 1 x 1010 CFU; in another example from about 1 x 106 to about 1 x 10 0 CFU.
In one aspect, the probiotic composition contains the bacterial species and/or cellular components thereof, as active ingredients, in an amount of from about 1 x 106 to about 1 x 1011 CFU/g, respect to the weight of the composition; for example, from about 1 x 108 to about 1 x 1010 CFU/g. The dose may be of 1 g, 3g, 5g, and 10g.
Typically, a probiotic is optionally combined with at least one suitable prebiotic compound. A prebiotic is usually a non-digestible carbohydrate such as an oligo- or polysaccharide, or a sugar alcohol, which is not degraded or absorbed in the upper digestive tract. Known prebiotics include commercial products such as inulin and transgalacto-oligosaccharides.
In one aspect, the probiotic composition of the present invention includes a prebiotic in an amount of from about 1 to about 30% by weight, respect to the total weight composition, (e.g. from 5 to 20% by weight). Carbohydrates may be selected from the group consisting of: fructo- oligosaccharides (or FOS), short-chain fructo-oligosaccharides, inulin, isomalt- oligosaccharides, pectins, xylo-oligosaccharides (or XOS), chitosan-oligosaccharides (or COS), beta-glucans, arable gum modified and resistant starches, polydextrose, D-tagatose, acacia fibers, carob, oats, and citrus fibers. In one aspect, the prebiotics are the short-chain fructo-oligosaccharides (for simplicity shown herein below as FOSs-c.c); said FOSs-c.c. are not digestible carbohydrates, generally obtained by the conversion of the beet sugar and including a saccharose molecule to which three glucose molecules are bonded. Administration
The pharmaceutical compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives of the present invention may be adapted for oral, rectal, vaginal, parenteral, intramuscular, intraperitoneal, intraarterial, intrathecal, intrabronchial, subcutaneous, intradermal, intravenous, nasal, buccal or sublingual routes of administration.
In one aspect, the pharmaceutical compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives of the present invention are adapted for oral, rectal, vaginal, parenteral, nasal, buccal or sublingual routes of administration. In a further aspect, the pharmaceutical compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives of the present invention are adapted for oral administration.
For oral administration, particular use is made of compressed tablets, pills, tablets, gellules, drops, and capsules.
Other forms of administration comprise solutions or emulsions which may be injected intravenously, intraarterially, intrathecal^, subcutaneously, intradermally, intraperitoneally or intramuscularly, and which are prepared from sterile or sterilisable solutions. The pharmaceutical compositions of the present invention may also be in form of suppositories, pessaries, suspensions, emulsions, lotions, ointments, creams, gels, sprays, solutions or dusting powders.
An alternative means of transdermal administration is by use of a skin patch. For example, the active ingredient can be incorporated into a cream consisting of an aqueous emulsion of polyethylene glycols or liquid paraffin. In another example, the active ingredient can also be incorporated into an ointment consisting of a white wax or white soft paraffin base together with such stabilisers and preservatives as may be required. Pharmaceutical compositions, the nutritional supplements, feedstuffs, food products, dietary supplements or food additives may be formulated in unit dosage form, i.e., in the form of discrete portions containing a unit dose, or a multiple or sub-unit of a unit dose.
Dosage
A person of ordinary skill in the art can easily determine an appropriate dose of the
Roseburia flagellin, and/or the polypeptide Fla (such as FlaA1 or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), to administer to a subject without undue experimentation. Typically, a physician will determine the actual dosage which will be most suitable for an individual patient and it will depend on a variety of factors including the activity of the specific bacterial strain employed, the metabolic stability and length of action of that strain, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the individual undergoing therapy. The dosages disclosed herein are exemplary of the average case. There can of course be individual instances where higher or lower dosage ranges are merited, and such are within the scope of this invention. Combinations
In one aspect, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), are administered in combination with at least one or two, or three or four or five other active agents. In such cases, the Roseburia flagellin, and/or the polypeptide Fla (such as FlaAl or FlaA2), and/or a polynucleotide sequence encoding said Roseburia flagellin and/or polypeptide Fla (such as FlaAl or FlaA2), and/or the vector comprising said polynucleotide sequence, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, and/or Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), may be administered consecutively, simultaneously or sequentially with the one or more other active agents.
The at least one or two, or three or four or five other active agents may be selected from the group consisting of: Roseburia flagellins, the polypeptide Fla (such as FlaAl or FlaA2), polynucleotide sequence(s) encoding said Roseburia flagellin, polynucleotide sequence(s) encoding said polypeptide Fla (such as FlaAl or FlaA2), vector(s) comprising said polynucleotide sequence(s), host cell(s) comprising said vector(s), host cell(s) comprising said polynucleotide sequence(s), and microorganisms (e.g. Roseburia such as R. hominis and/or R. intestinalis).
The at least one or two, or three or four or five other active agents may be a microorganism (e.g. a Roseburia such as R. hominis and/or R. intestinalis). Examples of suitable microorganisms include: Roseburia hominis A2-183 and Roseburia intestinalis L1 -82.
Sequence Identity or Sequence Homology
The terms "polypeptide", "polypeptide sequence", "protein" and "amino acid sequence" are used interchangeably herein.
The terms "polynucleotide sequence" and "nucleotide sequence" are used interchangeably herein. The present invention also encompasses the use of sequences having a degree of sequence identity or sequence homology with amino acid sequence(s) of a polypeptide described herein (e.g. variants, homologues and derivatives) or of any nucleotide sequence encoding such a polypeptide (hereinafter referred to as a "homologous sequence(s)"). Here, the term "homologue" means an entity having a certain homology with the subject amino acid sequences and the subject nucleotide sequences. Here, the term "homology" can be equated with "identity".
In the present context, a homologous sequence is taken to include an amino acid or a nucleotide sequence which may be at least 50, 60, 70, 75, 80, 85 or 90% identical, in some embodiments at least 95, 96, 97, 98 or 99% identical to the subject sequence. Although homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity. In some embodiments, a homologous sequence is taken to include an amino acid sequence or nucleotide sequence which has one or several additions, deletions and/or substitutions compared with the subject sequence.
In some embodiments, the present invention relates to the use of a protein whose amino acid sequence is represented herein or a protein derived from this (parent) protein by substitution, deletion or addition of one or several amino acids, such as 2, 3, 4, 5, 6, 7, 8, 9 amino acids, or more amino acids, such as 10 or more than 10 amino acids in the amino acid sequence of the parent protein and having the activity of the parent protein.
In some embodiments, the present invention relates to the use of a nucleic acid sequence (or gene) encoding a protein whose amino acid sequence is represented herein or encoding a protein derived from this (parent) protein by substitution, deletion or addition of one or several amino acids, such as 2, 3, 4, 5, 6, 7, 8, 9 amino acids, or more amino acids, such as 10 or more than 10 amino acids in the amino acid sequence of the parent protein and having the activity of the parent protein.
In the present context, a homologous sequence is taken to include a nucleotide sequence which may be at least 50, 60, 70, 75, 85 or 90% identical, in some embodiments at least 95, 96, 97, 98 or 99% identical to a nucleotide sequence encoding a polypeptide described herein (the subject sequence). Typically, the homologues will comprise the same or equivalent sequences that code for the domain(s) etc. as the subject sequence. Although homology can also be considered in terms of similarity (i.e. amino acid residues having similar chemical properties/functions), in the context of the present invention it is preferred to express homology in terms of sequence identity. The homologous amino acid sequence and/or nucleotide sequence may provide and/or encode a polypeptide which retains the functional activity and/or enhances the activity of the polypeptide.
In some aspects, an amino acid sequence as described herein has at least 50, 60, 70, 75, 80, 85 or 90% identity, in some embodiments at least 95, 96, 97, 98 or 99% identity to the subject sequence.
In some aspects, a nucleotide sequence as described herein has at least 50, 60, 70, 75, 80, 85 or 90% identity, in some embodiments at least 95, 96, 97, 98 or 99% identity to the subject sequence.
Homology comparisons can be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs can calculate % homology between two or more sequences.
% homology may be calculated over contiguous sequences, i.e. one sequence is aligned with the other sequence and each amino acid in one sequence is directly compared with the corresponding amino acid in the other sequence, one residue at a time. This is called an "ungapped" alignment. Typically, such ungapped alignments are performed only over a relatively short number of residues. Although this is a very simple and consistent method, it fails to take into consideration that, for example, in an otherwise identical pair of sequences, one insertion or deletion will cause the following amino acid residues to be put out of alignment, thus potentially resulting in a large reduction in % homology when a global alignment is performed. Consequently, most sequence comparison methods are designed to produce optimal alignments that take into consideration possible insertions and deletions without penalizing unduly the overall homology score. This is achieved by inserting "gaps" in the sequence alignment to try to maximize local homology.
However, these more complex methods assign "gap penalties" to each gap that occurs in the alignment so that, for the same number of identical amino acids, a sequence alignment with as few gaps as possible - reflecting higher relatedness between the two compared sequences - will achieve a higher score than one with many gaps. "Affine gap costs" are typically used that charge a relatively high cost for the existence of a gap and a smaller penalty for each subsequent residue in the gap. This is the most commonly used gap scoring system. High gap penalties will of course produce optimized alignments with fewer gaps. Most alignment programs allow the gap penalties to be modified. Typically the default values are used when using such software for sequence comparisons.
Calculation of maximum % homology therefore firstly requires the production of an optimal alignment, taking into consideration gap penalties. A suitable computer program for carrying out such an alignment is the Vector NTI (Invitrogen Corp.). Examples of software that can perform sequence comparisons include, but are not limited to, the BLAST package (see Ausubel et al 1999 Short Protocols in Molecular Biology, 4th Ed - Chapter 18), BLAST 2 (see FEMS Microbiol Lett 1999 174(2): 247-50; FEMS Microbiol Lett 1999 177(1): 187-8 and tatiana@ncbi.nlm. nih.gov), FASTA (Altschul er al 1990 J. Mol. Biol. 403-410) and AlignX for example. At least BLAST, BLAST 2 and FASTA are available for offline and online searching (see Ausubel et al 1999, pages 7-58 to 7-60).
Although the final % homology can be measured in terms of identity, the alignment process itself is typically not based on an all-or-nothing pair comparison. Instead, a scaled similarity score matrix is generally used that assigns scores to each pairwise comparison based on chemical similarity or evolutionary distance. An example of such a matrix commonly used is the BLOSUM62 matrix - the default matrix for the BLAST suite of programs. Vector NTI programs generally use either the public default values or a custom symbol comparison table if supplied (see user manual for further details). For some applications, it is preferred to use the default values for the Vector NTI package.
Alternatively, percentage homologies may be calculated using the multiple alignment feature in Vector NTI (Invitrogen Corp.), based on an algorithm, analogous to CLUSTAL (Higgins DG & Sharp PM (1988), Gene 73(1), 237-244). Once the software has produced an optimal alignment, it is possible to calculate % homology, for example % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.
Should Gap Penalties be used when determining sequence identity, then the following parameters can be used for pairwise alignment for example:
Figure imgf000082_0001
Figure imgf000082_0002
In one embodiment, CLUSTAL may be used with the gap penalty and gap extension set as defined above.
In one embodiment, the degree of identity with regard to a nucleotide sequence is determined over at least 20 contiguous nucleotides, for example over at least 30 contiguous nucleotides, for example over at least 40 contiguous nucleotides, for example over at least 50 contiguous nucleotides, for example over at least 60 contiguous nucleotides, for example over at least 100 contiguous nucleotides, for example over at least 200 contiguous nucleotides, for example over at least 300 contiguous nucleotides.
In one embodiment, the degree of identity with regard to a nucleotide sequence may be determined over the whole sequence. Recombinant
In one aspect the Roseburia flagellin polypeptide and/or polynucleotide sequence for use in the present invention is a recombinant sequence - i.e. a sequence that has been prepared using recombinant DNA techniques.
These recombinant DNA techniques are within the capabilities of a person of ordinary skill in the art. Such techniques are explained in the literature, for example, J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Books 1-3, Cold Spring Harbor Laboratory Press.
Synthetic
In one aspect the Roseburia flagellin polynucleotide sequence for use in the present invention is a synthetic sequence - i.e. a sequence that has been prepared by in vitro chemical or enzymatic synthesis. It includes, but is not limited to, sequences made with optimal codon usage for host organisms - such as the methylotrophic yeasts Pichia and Hansenula. Expression of enzymes
The nucleotide sequence for use in the present invention may be incorporated into a recombinant replicable vector. The vector may be used to replicate and express the nucleotide sequence, in protein form, in and/or from a compatible host cell.
Expression may be controlled using control sequences e.g. regulatory sequences.
The protein produced by a host recombinant cell by expression of the nucleotide sequence may be secreted or may be contained intracellular^ depending on the sequence and/or the vector used. The coding sequences may be designed with signal sequences which direct secretion of the substance coding sequences through a particular prokaryotic or eukaryotic cell membrane.
Expression vector
In one aspect, the present invention relates to a vector (such as an expression vector) comprising at least one polynucleotide sequence encoding at least one Roseburia flagellin. The term "expression vector" means a construct capable of in vivo or in vitro expression.
In one embodiment, the expression vector is incorporated into the genome of a suitable host organism. The term "incorporated" in one aspect covers stable incorporation into the genome.
The nucleotide sequence of the present description may be present in a vector in which the nucleotide sequence is operably linked to regulatory sequences capable of providing for the expression of the nucleotide sequence by a suitable host cell or host organism.
The vectors for use in the present invention may be transformed into a suitable host cell or host organism as described herein to provide for expression of a polypeptide of the present description. The choice of vector e.g. a plasmid, cosmid, or phage vector will often depend on the host cell into which it is to be introduced.
The vectors for use in the present invention may contain one or more selectable marker genes- such as a gene, which confers antibiotic resistance e.g. ampicillin, kanamycin, chloramphenicol or tetracyclin resistance. Alternatively, the selection may be accomplished by co-transformation (as described in W091/17243).
Vectors may be used in vitro, for example for the production of RNA or used to transfect, transform, transduce or infect a host cell.
Thus, in a further embodiment, the description provides a method of making nucleotide sequences of the present description by introducing a nucleotide sequence of the present description into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector.
The vector may further comprise a nucleotide sequence enabling the vector to replicate in the host cell in question. Examples of such sequences are the origins of replication of plasmids pUC19, pACYC177: pUB1 10, pE194, pAMB1 and plJ702. An expression vector may comprise at least two, three, four or five polynucleotide sequences encoding Roseburia flagellins. Examples of expression vectors include pGEX-6P-1 , pCR-Blunt ll-TOPO and T7-MAT- Tag-FLAG-.
The expression vector pGEX-6P-1 may be used for cloning recombinant flagellins. The expression vector pGEX-6P-1 comprises a tac promoter for chemically inducible, high- level expression of GST-tagged recombinant proteins, an internal laclq gene for use in any E. coli host, an AmpR gene for ampicillin selection and a PreScission Protease site for cleaving, if desired, the protein from the fusion product . The cloning vector pCR-Blunt ll-TOPO may be used for cloning recombinant flagellins, in particular those which are insoluble after cell lysis. Typically this vector allows high-efficiency DNA cloning of blunt-end PCR products. The vector comprises Kanamycin and Zeocin resistance genes for selection in E. coli, and the insert is flanked by multiples restriction sites for excision.
Expression vector T7-MAT-Tag-FI_AG- may be used for cloning recombinant flagellins, in particular those which insoluble after cell lysis. The multi cloning site (MCS) is flanked by MAT (Metal Affinity Tag) sequence and FLAG peptide (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys) sequence, which results in the production of double-tagged flagellin, which can be further purified by affinity columns. This expression vector also comprises a pT7/lac (phage T7 lac operon) promoter for IPTG inducible, high-level expression of MAT-ORF-FLAG recombinant flagellins, an internal lacl gene that represses transcription at basal state in any E. coli host, and an AmpR gene for ampicillin selection. Reg ulato ry sequences
In some applications, the nucleotide sequence for use in the present invention is operably linked to a regulatory sequence which is capable of providing for the expression of the nucleotide sequence, such as by the chosen host cell. By way of example, the present invention covers a vector comprising the nucleotide sequence of the present invention operably linked to such a regulatory sequence, i.e. the vector is an expression vector.
The term "operably linked" refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. A regulatory sequence "operably linked" to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under condition compatible with the control sequences. The term "regulatory sequences" includes promoters and enhancers and other expression regulation signals.
The term "promoter" is used in the normal sense of the art, e.g. an RNA polymerase binding site.
Enhanced expression of the nucleotide sequence encoding a flagellin of the present description may also be achieved by the selection of heterologous regulatory regions, e.g. promoter, secretion leader and terminator regions.
In one embodiment, the nucleotide sequence according to the present description is operably linked to at least a promoter.
Other promoters may even be used to direct expression of the polypeptide of the present description.
Examples of suitable promoters for directing the transcription of the nucleotide sequence in a bacterial, fungal or yeast host are well known in the art. The promoter can additionally include features to ensure or to increase expression in a suitable host. For example, the features can be conserved regions such as a Pribnow Box or a TATA box.
Constructs
The term "construct" - which is synonymous with terms such as "conjugate", "cassette" and "hybrid" - includes a nucleotide sequence for use according to the present invention directly or indirectly attached to a promoter. An example of an indirect attachment is the provision of a suitable spacer group such as an intron sequence, such as the Sh1-intron or the ADH intron, intermediate the promoter and the nucleotide sequence of the present description. The same is true for the term "fused" in relation to the present description which includes direct or indirect attachment. In some cases, the terms do not cover the natural combination of the nucleotide sequence coding for the protein ordinarily associated with the wild type gene promoter and when they are both in their natural environment. The construct may even contain or express a marker, which allows for the selection of the genetic construct.
For some applications, the construct of the present description comprises at least the nucleotide sequence of the present description operably linked to a promoter.
Host cells
The term "host cell" - in relation to the present description includes any cell that comprises the nucleotide sequence and/or an expression vector as described herein. Typically the host cell is capable of the recombinant production of a protein having the specific properties as defined herein.
Examples of host cells include bacteria such as Roseburia spp. and competent cells. Examples of Roseburia spp are Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, and Roseburia inulinivorans. Examples of competent cells include competent E. coli cells (such as E. coli BL21 (DE3) pLysS and/or E. coli B21 Rosetta).
Thus, a further embodiment of the present description provides host cells transformed or transfected with a nucleotide sequence of the present description. In addition, or alternatively, a further embodiment of the present description provides host cells transformed or transfected with a nucleotide sequence (e.g. a promoter such as a heterologous promoter or an exogenous) that is capable of upregulating (overexpressing) the expression of a nucleotide sequence (e.g. gene - such as a homologous gene or an endogenous gene) encoding a flagellin of the present description when compared to the equivalent microorganism prior to transformation. The cells will be chosen to be compatible with the said vector and may for example be bacterial (e.g. prokaryotic), fungal, or yeast cells.
The nucleotide sequence encoding the flagellin of the present description may be
heterologous or homologous to the host cell. Typically when the nucleotide sequence encoding the flagellin is homologous to the host cell the host cell comprises multiple copies of the nucleotide sequence. In addition or alternatively, the nucleotide sequence encoding the flagellin is operably linked to a heterologous promoter; typically said promoter is capable of upregulating (overexpressing) the homologous nucleotide sequence encoding the flagellin.
In one example, the host cell comprises the nucleotide sequence coding for the flagellin polypeptide of the present description (such as a homologous or endogenous nucleotide sequence) under the control of a heterologous or exogenous promoter.
In one embodiment, the host cell is transformed or transfected with one or more nucleotide sequences that encodes at least one flagellin (e.g. Roseburia flagellin) selected from the group consisting of Fla1 , Fla2, Fla3 and Fla4. In another embodiment, the host cell is transformed or transfected with one or more nucleotide sequences that encode at least one flagellin (e.g. Roseburia flagellin) selected from the group consisting of Fla2, Fla1 and Fla4. In a further embodiment, the host cell is transformed or transfected with a nucleotide sequences that encodes the flagellin (e.g. Roseburia flagellin) Fla2.
The host cell may comprise multiple copies of polynucleotide sequences encoding Roseburia flagellins.
A host cell may comprise at least 1 , 2, 3, 4 or 5 polynucleotide sequences encoding at least 1 , 2, 3, 4 or 5 Roseburia flagellins.
In one embodiment, the host cell comprises a polynucleotide sequence encoding at least one Roseburia flagellin derived or derivable from one Roseburia species and at least one further polynucleotide sequence encoding at least one Roseburia flagellin derived or derivable from a different Roseburia species. For example, the host cell comprises at least one polynucleotide sequence encoding an R. hominis flagellin (e.g. Fla1 or Fla2) and at least one polynucleotide sequence encoding a R. intestinalis flagellin (e.g. Fla1 or Fla 2).
A host cell may comprise at least 1 , 2, 3, 4 or 5 expression vectors comprising at least 1 , 2, 3, 4 or 5 polynucleotide sequences encoding Roseburia flagellin.
In one embodiment, the host cell comprises an expression vector comprising a polynucleotide sequence encoding Roseburia flagellins derived or derivable from one Roseburia species and at least one further expression vector comprising a polynucleotide sequence encoding Roseburia flagellins derived or derivable from a different Roseburia species. For example, the host cell comprises at least one expression vector comprising a polynucleotide sequence encoding an R. hominis flagellin (e.g. Fla1 or Fla2) and at least one expression vector comprising a polynucleotide sequence encoding a R. intestinalis flagellin (e.g. Fla1 or Fla 2).
The nucleotide sequence encoding the flagellin may be endogenous or exogenous to the host cell. Typically when the nucleotide sequence encoding the flagellin is endogenous to the host cell the host cell comprises multiple copies of the nucleotide sequence. In addition or alternatively, the nucleotide sequence encoding the flagellin is operably linked to an exogenous promoter; typically said promoter is capable of upregulating (overexpressing) the endogenous nucleotide sequence encoding the flagellin.
Examples of suitable bacterial host organisms are gram positive or gram negative bacterial species.
In one embodiment, the host cell is a microorganism.
In one embodiment, the host cell is a lactic acid bacterium species, Lactococcus species, a Bifidobacterium species, a Lactobacillus species or a Propionibacterium species.
Examples of lactic acid bacteria include, but are not limited to, Lactobacillus spp., Leuconostoc spp., Pediococcus spp. , Lactococcus spp., Streptococcus spp., Aerococcus spp., Carnobacterium spp., Enterococcus spp., Oenococcus spp., Sporolactobacillus spp., Tetragenococcus spp., Vagococcus spp. , and Weisella spp.
Examples of Lactobacillus spp include Lactobacillus paracasei, L. acidophilus, L. fermentum, L brevis, L. gasseri, L plantarum, L. bulgaricus, L. helveticus, L. reuteri, L. casei, L. jensenii,
L. rhamnosus, L. crispatus, L. johnsonii, L. salivarius, L. acetotolerans, L. acidifarinae, L acidipiscis, L. agilis, L. algidus, L. alimentarius, L. amylolyticus, L amylophilus, L.
amylotrophicus, L. amylovorus, L. animalis, L. antri, L. apodemi, L aviarius, L. bifermentans,
L buchneri, L camelliae, L. catenaformis, L. ceti, L. coleohominis, L. collinoides, L. composti, L. concavus, L. coryniformis, L. crustorum, L. curvatus, L. delbrueckii subsp. deibrueckii, L. delbrueckii subsp. bulgaricus, L. delbrueckii subsp. lactis, L. dextrinicus, L. diolivorans, L. equi, L. equigenerosi, L. farraginis, L. farciminis, L. fornicalis, L. fructivorans, L. frumenti, L. fuchuensis, L. galUnarum, L. gastricus, L. ghanensis, L. graminis, L. hammesii, L. hamsteri,
L. harbinensis, L. hayakitensis, L. hilgardii, L. homohiochii, L. iners, L. ingluviei, L. intestinalis, L kalixensis, L. kefiranofaciens, L. kefiri, L. kimchii, L. kitasatonis, L. kunkeei, L. leichmannii,
L. lindneri, L. malefermentans, L. mail, L. manihotivorans, L. mindensis, L. mucosae, L.
murinus, L. nagelii, L namurensis, L. nantensis, L. oligofermentans, L. oris, L. panis, L.
pantheris, L. parabrevis, L. parabuchneri, L. paracollinoides, L. parafarraginis, L. parakefiri, L. paralimentarius, L paraplantarum, L. pentosus, L. perolens, L. pontis, L. psittaci, L. rennini, L. rimae, L. rogosae, L. rossiae, L. ruminis, L. saerimneri, L. sakei, L. sanfranciscensis, L. satsumensis, L. secaliphilus, L. sharpeae, L. siliginis, L. spicheri, L. suebicus, L.
thailandensis, L. ultunensis, L. vaccinostercus, L. vaginalis, L. versmoldensis, L. vini, L. vitulinus, L. zeae, and L zymae.
Examples of Propionibacterium include, but are not limited to Propionibacterium
freudenrechli subsp. shermanii (PAB), Propionibacterium acidifaciens, Propionibacterium acidipropionici, Propionibacterium acnes, Propionibacterium austraiiense, Propionibacterium avidum, Propionibacterium cyclohexanicum, Propionibacterium freudenrelchli subsp.
freudenrelchli, Propionibacterium granulosum, Propionibacterium jensenii, Propionibacterium microaerophilum, Propionibacterium propionicum, and Propionibacterium thoenii. In one embodiment, the Propionibacterium is Propionibacterium freudenrechli subsp.
shermanii (PAB).
Examples of Bifidobacterium include, but are not limited to, Bifidobacterium adoiescentis, B. breve, B. longum, B. animalis, B. infantis, B. thermophilum, B. bifidum, Bifidobacterium catenulatum, Bifidobacterium pseudocatenulatum, Bifidobacterium angulatum and B. lactis.
In another embodiment, the host cell is a Firmicute - for example a Roseburia species such as Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, or Roseburia inulinivorans). In one embodiment, the host cell comprises at least one heterologous polynucleotide sequence encoding a Roseburia flagellin. In addition or alternatively, the host cell comprises at least two copies of a homologous polynucleotide sequence encoding a Roseburia flagellin; for instance, the host cell comprises at least 3, 4 or 5 homologous copies of a polynucleotide sequence encoding a Roseburia flagellin. Depending on the nature of the nucleotide sequence encoding the polypeptide of the present description, and/or the desirability for further processing of the expressed protein, eukaryotic hosts such as yeasts or other fungi may be used. In general, yeast cells are used over fungal cells because they are easier to manipulate. However, some proteins are either poorly secreted from the yeast cell, or in some cases are not processed properly (e.g. hyperglycosylation in yeast). In these instances, a different fungal host organism should be selected.
The use of suitable host cells - such as yeast, fungal and plant host cells - may provide for post-translational modifications (e.g. myristoylation, glycosylation, truncation, lipidation and tyrosine, serine or threonine phosphorylation) as may be needed to confer optimal biological activity on recombinant expression products of the present description. The host cell may be a protease deficient or protease minus strain. This may for example be the protease deficient strain Aspergillus oryzae JaL 125 having the alkaline protease gene named "alp" deleted. This strain is described in W097/35956. The term "host cell" does not cover native nucleotide coding sequences in their natural environment when they are under the control of their native promoter which is also in its natural environment.
Organism
The term "organism" in relation to the present description includes any organism that could comprise the nucleotide sequence coding for the polypeptide according to the present description and/or products obtained therefrom, and/or wherein a promoter can allow expression of the nucleotide sequence according to the present description when present in the organism.
Suitable organisms may include a bacterium (such as a prokaryote), a fungus, a yeast or a plant. The term "transgenic organism" in relation to the present description includes any organism that comprises the nucleotide sequence coding for the polypeptide according to the present description and/or the products obtained therefrom, and/or wherein a promoter can allow expression of the nucleotide sequence according to the present description within the organism. In one embodiment the nucleotide sequence is incorporated in the genome of the organism.
The term "transgenic organism" does not cover native nucleotide coding sequences in their natural environment when they are under the control of their native promoter which is also in its natural environment.
Therefore, the transgenic organism of the present description includes an organism comprising any one of, or combinations of, the nucleotide sequence coding for the polypeptide according to the present description, constructs according to the present description, vectors according to the present description, plasmids according to the present description, cells according to the present description, or the products thereof.
For example the transgenic organism may comprise the nucleotide sequence coding for the polypeptide of the present description (such as a homologous nucleotide sequence) under the control of a heterologous promoter.
Transformation of host cells/organism
As indicated earlier, the host organism can be a prokaryotic or a eukaryotic organism. Examples of suitable prokaryotic hosts include Roseburia hominis, Roseburia cecicola, Roseburia faecis, Roseburia intestinalis, Roseburia inulinivorans, E. coli and Bacillus subtilis. Teachings on the transformation of prokaryotic hosts is well documented in the art, for example see Sambrook et al (Molecular Cloning: A Laboratory Manual, 2nd edition, 1989, Cold Spring Harbor Laboratory Press). If a prokaryotic host is used then the nucleotide sequence may need to be suitably modified before transformation - such as by removal of introns.
Filamentous fungi cells may be transformed using various methods known in the art - such as a process involving protoplast formation and transformation of the protoplasts followed by regeneration of the cell wall in a manner known. The use of Aspergillus as a host microorganism is described in EP 0 238 023.
Another host organism can be a plant. A review of the general techniques used for transforming plants may be found in articles by Potrykus (Annu Rev Plant Physiol Plant Mol Biol [1991] 42:205-225) and Christou (Agro-Food-Industry Hi-Tech March/April 1994 17-27). Further teachings on plant transformation may be found in EP-A-0449375.
General teachings on the transformation of fungi, yeasts and plants are presented in following sections.
Transformed fungus
A host organism may be a fungus - such as a mould. Examples of suitable such hosts include any member belonging to the genera Thermomyces, Acremonium, Aspergillus, Penicillium, Mucor, Neurospora, Trichoderma and the like. In one embodiment, the host organism may be a filamentous fungus.
Transforming filamentous fungi is discussed in US-A-5741665 which states that standard techniques for transformation of filamentous fungi and culturing the fungi are well known in the art. An extensive review of techniques as applied to N. crassa is found, for example in Davis and de Serres, Methods Enzymol (1971) 17A: 79-143. Further teachings which may also be utilised in transforming filamentous fungi are reviewed in US-A-5674707.
In addition, gene expression in filamentous fungi is taught in in Punt et al. (2002) Trends Biotechnol 2002 May;20(5):200-6, Archer & Peberdy Crit Rev Biotechnol (1997) 17(4):273- 306.
The present description encompasses the production of transgenic filamentous fungi according to the present description prepared by use of these standard techniques. In one aspect, the host organism can be of the genus Aspergillus, such as Aspergillus niger.
A transgenic Aspergillus according to the present description can also be prepared by following, for example, the teachings of Turner G. 1994 (Vectors for genetic manipulation. In: Martinelli S.D., Kinghorn J.R.( Editors) Aspergillus: 50 years on. Progress in industrial microbiology vol 29. Elsevier Amsterdam 1994. pp. 641-666).
Transformed yeast
In another embodiment, the transgenic organism can be a yeast.
A review of the principles of heterologous gene expression in yeast are provided in, for example, Methods Mol Biol (1995), 49:341-54, and Curr Opin Biotechnol (1997) Oct;8(5):554- 60 In this regard, yeast - such as the species Saccharomyces cerevisi or Pichia pastoris (see FEMS Microbiol Rev (2000 24(1 ):45-66), may be used as a vehicle for heterologous gene expression.
A review of the principles of heterologous gene expression in Saccharomyces cerevisiae and secretion of gene products is given by E Hinchcliffe E Kenny (1993, "Yeast as a vehicle for the expression of heterologous genes", Yeasts, Vol 5, Anthony H Rose and J Stuart Harrison, eds, 2nd edition, Academic Press Ltd.). For the transformation of yeast, several transformation protocols have been developed. For example, a transgenic Saccharomyces according to the present description can be prepared by following the teachings of Hinnen et al., (1978, Proceedings of the National Academy of Sciences of the USA 75, 1929); Beggs, J D (1978, Nature, London, 275, 104); and Ito, H et al (1983, J Bacteriology 153, 163-168).
The transformed yeast cells may be selected using various selective markers - such as auxotrophic markers dominant antibiotic resistance markers.
Transformed plants/plant cells
A host organism suitable for the present description may be a plant. In this respect, the basic principle in the construction of genetically modified plants is to insert genetic information in the plant genome so as to obtain a stable maintenance of the inserted genetic material. A review of the general techniques may be found in articles by Potrykus (Annu Rev Plant Physiol Plant Mol Biol [1991] 42:205-225) and Christou (Agro-Food-Industry Hi-Tech March/April 1994 17-27).
Direct infection of plant tissues by Agrobacterium is a simple technique which has been widely employed and which is described in Butcher D.N. et al., (1980), Tissue Culture Methods for Plant Pathologists, eds.: D.S. Ingrams and J. P. Helgeson, 203-208.
Other techniques for transforming plants include ballistic transformation, the silicon whisker carbide technique (see Frame BR, Drayton PR, Bagnaall SV, Lewnau CJ, Bullock WP, Wilson HM, Dunwell JM, Thompson JA & Wang K (1994) Production of fertile transgenic maize plants by silicon carbide whisker-mediated transformation, The Plant Journal 6: 941-948) and viral transformation techniques (e.g. see Meyer P, Heidmann I & Niedenhof I (1992) The use of cassava mosaic virus as a vector system for plants, Gene 110: 213-217). Further teachings on plant transformation may be found in EP-A-0449375.
Plant cells may be grown and maintained in accordance with well-known tissue culturing methods such as by culturing the cells in a suitable culture medium supplied with the necessary growth factors such as amino acids, plant hormones, vitamins, etc.
In a further aspect, the present description relates to a vector system which carries a nucleotide sequence or construct according to the present description and which is capable of introducing the nucleotide sequence or construct into the genome of an organism, such as a plant. The vector system may comprise one vector, but it may comprise two vectors. In the case of two vectors, the vector system is normally referred to as a binary vector system. Binary vector systems are described in further detail in Gynheung An et al., (1980), Binary Vectors, Plant Molecular Biology Manual A3, 1-19.
One extensively employed system for transformation of plant cells uses the Ti plasmid from Agrobacterium tumefaciens or a Ri plasmid from Agrobacterium rhizogenes An ef al., (1986), Plant Physiol. 81 , 301-305 and Butcher D.N. et al., (1980), Tissue Culture Methods for Plant Pathologists, eds.: D.S. Ingrams and J. P. Helgeson, 203-208. After each introduction method of the desired promoter or construct or nucleotide sequence according to the present description in the plants, the presence and/or insertion of further DNA sequences may be necessary. If, for example, for the transformation the Ti- or Ri-plasmid of the plant cells is used, at least the right boundary and often however the right and the left boundary of the Ti- and Ri-plasmid T-DNA, as flanking areas of the introduced genes, can be connected. The use of T-DNA for the transformation of plant cells has been intensively studied and is described in EP-A-120516; Hoekema, in: The Binary Plant Vector System Offset-drukkerij Kanters B.B., Alblasserdam, 1985, Chapter V; Fraley, et al., Crit. Rev. Plant Sci., 4:1-46; and An ef al., EMBO J. (1985) 4:277-284.
Culturing and production
Host cells transformed with the nucleotide sequence of the present description and/or an expression vector of the present description may be cultured under conditions conducive to the production of the encoded polypeptide and which facilitate recovery of the polypeptide from the cells and/or culture medium.
The medium used to cultivate the cells may be any conventional medium suitable for growing the host cell in questions and obtaining expression of the polypeptide.
The protein produced by a recombinant cell may be displayed on the surface of the cell.
The protein may be secreted from the host cells and may conveniently be recovered from the culture medium using well-known procedures. Secretion
In some embodiments, the protein is secreted from the expression host into the culture medium from where the protein may be recovered. According to the present description, the secretion leader sequence may be selected on the basis of the desired expression host. Hybrid signal sequences may also be used with the context of the present description.
Typical examples of heterologous secretion leader sequences are those originating from the fungal amyloglucosidase (AG) gene (g/aA - both 18 and 24 amino acid versions e.g. from Aspergillus), the a-factor gene (yeasts e.g. Saccharomyces, Kluyveromyces and Hansenula) or the a-amylase gene (Bacillus).
By way of example, the secretion of heterologous proteins in E. coli is reviewed in Methods Enzymol (1990) 182:132-43.
Detection
A variety of protocols for detecting and measuring the expression of the amino acid sequence are known in the art. Examples include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA) and fluorescent activated cell sorting (FACS).
A wide variety of labels and conjugation techniques are known by those skilled in the art and can be used in various nucleic and amino acid assays. A number of companies such as Pharmacia Biotech (Piscataway, NJ), Promega (Madison, Wl), and US Biochemical Corp (Cleveland, OH) supply commercial kits and protocols for these procedures.
Suitable reporter molecules or labels include those radionuclides, enzymes, fluorescent, chemiluminescent, or chromogenic agents as well as substrates, cofactors, inhibitors, magnetic particles and the like. Patents teaching the use of such labels include US-A- 3,817,837; US-A-3,850,752; US-A-3,939,350; US-A-3,996,345; US-A-4,277,437; US-A- 4,275, 149 and US-A-4,366,241. Also, recombinant immunoglobulins may be produced as shown in US-A-4, 816,567. Fusion proteins
The amino acid sequence for use according to the present description may be produced as a fusion protein, for example to aid in extraction and purification. Examples of fusion protein partners include glutathione-S-transferase (GST), 6xHis, GAL4 (DNA binding and/or transcriptional activation domains) and (β-galactosidase). It may also be convenient to include a proteolytic cleavage site between the fusion protein partner and the protein sequence of interest to allow removal of fusion protein sequences.
Typically, the fusion protein will not hinder the activity of the protein sequence.
Gene fusion expression systems in E. coli have been reviewed in Curr Opin Biotechnol (1995) 6(5):501-6.
In another embodiment, the amino acid sequence may be ligated to a heterologous sequence to encode a fusion protein. For example, for screening of peptide libraries for agents capable of affecting the substance activity, it may be useful to encode a chimeric substance expressing a heterologous epitope that is recognised by a commercially available antibody.
The present invention is further described by way of the following non-limiting examples. EXAMPLES
The practice of the present invention will employ, unless otherwise indicated, conventional techniques of chemistry, molecular biology, microbiology, recombinant DNA and immunology, which are within the capabilities of a person of ordinary skill in the art. Such techniques are explained in the literature. See, for example, J. Sambrook, E. F. Fritsch, and T. Maniatis, 1989, Molecular Cloning: A Laboratory Manual, Second Edition, Books 1-3, Col d Spring Harbor Laboratory Press; Ausubel, F. M. et al. (1995 and periodic supplements; Current Protocols in Molecular Biology, ch. 9, 13, and 16, John Wiley & Sons, New York, N.Y.); B. Roe, J. Crabtree, and A. Kahn, 1996, DNA Isolation and Sequencing: Essential Techniques, John Wiley & Sons; J. M. Polak and James O'D. cGee, 1990, In Situ Hybridization: Principles and Practice; Oxford University Press; M. J. Gait (Editor), 1984, Oligonucleotide Synthesis: A Practical Approach, Irl Press; D. M. J. Lilley and J. E. Dahlberg, 1992, Methods of Enzymology: DNA Structure Part A: Synthesis and Physical Analysis of DNA Methods in Enzymology, Academic Press; and E. M. Shevach and W. Strober, 1992 and periodic supplements, Current Protocols in Immunology, John Wiley & Sons, New York, NY. Each of these general texts is herein incorporated by reference. Material and Methods
ROSEBURIA GENUS FLAGELLINS Flaqellin diversity
Flagellins from Roseburia genus bacteria, in particular, Roseburia hominis and
Roseburia intestinalis were cloned, expressed, purified and analysed.
Figure B1A and B1 B show an SDS-Analysis of recombinant flagellins. Flagellin protein nomenclature:
Roseburia Genus
Roseburia Species
Roseburia hominis
Roseburia hominis FlaA1 (This is also referred herein as RhFlaAI or Rh1 )
Roseburia hominis FlaA2 (This is also referred herein as RhFlaA2 or Rh2)
Roseburia intestinalis
Roseburia intestinalis FlaA1 (This is also referred herein as RiFlaAI or RM or RM)
Roseburia intestinalis FlaA2 (This is also referred herein as RiFlaA2 or Ri2 or RI2)
Roseburia intestinalis FlaA3 (This is also referred herein as RiFlaA3 or Ri3 or RI3)
Roseburia intestinalis FlaA4 (This is also referred herein as RiFlaAI or
Ri4 or RI4)
See:
ELY, B., ELY, T.W., CRYMES, W.B..JR and MINNICH, S.A., 2000. A family of six flagellin genes contributes to the Caulobacter crescentus flagellar filament. Journal of Bacteriology, 182(17), pp. 5001 -5004.
IBRAHIM, G.F., FLEET, G.H., LYONS, M.J. and WALKER, R.A., 1985. Method for the isolation of highly purified Salmonella flagellins. Journal of clinical microbiology, 22(6), pp. 1040-1044.
NEVILLE, B.A., FORDE, B.M., CLAESSON, M.J., DARBY, T., COGHLAN, A., NALLY, K., ROSS, R.P. and OTOOLE, P.W., 2012. Characterization of pro-inflammatory flagellin proteins produced by Lactobacillus ruminis and related motile Lactobacilli. PloS one, 7(7), pp. e40592.
NG, S.Y., CHABAN, B. and JARRELL, K.F., 2006. Archaeal flagella, bacterial flagella and type IV pili: a comparison of genes and posttranslational modifications. Journal of Molecular Microbiology and Biotechnology, 11 (3-5), pp. 167-191.
WATSON, R.O. and GALAN, J.E., 2005. Signal transduction in Campylobacter jejuni-induced cytokine production. Cellular microbiology, 7(5), pp. 655-665.
Bacterial growth conditions
R. hominis A2-183T (=DSM 16839T=NCIMB 14029T) was grown anaerobically at 37"C in YCFA media. The culture was spun down and the pellet was resuspended in one mL of YCFA media, supplemented with 2% cysteine (w/v, Sigma-Aldrich) and 3% ascorbic acid (w/v, Sigma-Aldrich).
R. intestinalis L1-82T (=DSM 14610T=NCIMB 13810T) was grown anaerobically at 37"C in YCFA media. The culture was spun down and the pellet was resuspended in one mL of YCFA media, supplemented with 2% cysteine (w/v, Sigma-Aldrich) and 3% ascorbic acid (w/v, Sigma-Aldrich).
Mice
C3H/HeN and C57BI/6 were purchased from Harlan Laboratories. GF C3H/HeN were provided and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France). GF TLR5KO and wild type C57BI/6 were provided by Andrew Gewirtz (Center for Inflammation, Immunity, and Infection and Department of Biology, Georgia State University, Atlanta, GA 30303, USA) and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas. Conventional TLR5KO and wild type BOY/J were provided by Adam Cunningham (MRC Centre for Immune Regulation, Institute of Microbiology and Infection, Division of Immunity and Infection University of Birmingham UK) The management and experimental procedures were approved by the respective Local Ethical Review Committees. Animal experiments
Germfree animal experiments were performed in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France). GF C3H/HeN male mice were allocated into control (W=8) and treatment (Λ =10) groups and caged individually in plastic isolators. At day 0, 1 and 2, animals in the treatment group were given 100 μΙ_ of R. hominis culture by gavage, while control animals were given 100 μΙ_ YCFA media. Ileum, ascending colon and caecum samples were collected at 14d and 28d. Six GF C3H/HeN male mice were treated with E. coli MG1655 (K12) as described above, and three animals were sacrificed at 10d and 22d to give N=3. Three GF TLR5KO mice and three C57BI/6 WT mice were inoculated with R. hominis culture as described above to evaluate the functional importance of R. hominis flagellins. After 28d these animals were sacrificed together with their GF counterparts. Twenty-two female C57BL/6 mice were dosed daily with 50 μΙ_ of 109 CFU R. hominis for 14 days. Control animals were dosed with culture medium alone. From day 8, mice were given DSS (MW 50kDa, 30g/l) in their drinking water for 6 days. The animals were euthanized on day 14 and tissue sampling was performed as described above. Tissue culture experiments
Caco-2 (Homo sapiens epithelial colorectal adenocarcinoma cells) and HT29 {Homo sapiens colorectal adenocarcinoma) cells were grown in transwell plates within an anaerobic workstation. R. hominis A2-183 culture or R. intestinalis L1-82T was harvested at exponential phase, and 100 μ!_ of bacterial suspension (108 CFU/mL) was added to experimental wells. Bacterial (non-adherent and adherent) and eukaryotic cells (Caco-2 and HT-29) were harvested after 2h and 4h incubation and stored in RNAIater. For tissue culture experiments with recombinant flagellins, 5x104 Caco-2 cells were grown in 24-well plates at 37°C in a 75% humidified atmosphere of 5% C02. The cells reached confluence on day 5-6 and were used three days post-confluence. The cells were incubated with recombinant flagellins at a final concentration of 100 ng/μΙ for 2hr at 37°C in a 75% humidified atmosphere of 5% C02.
FISH analysis
FISH analysis was performed on neutral buffered formalin-fixed gut tissue sections using a general bacterial probe Eub338 and a newly designed R. hominis A2-183-specific probe and a R. intestinalis L1-82T specific probe.
R. hominis library construction
R. hominis chromosomal DNA for small-size library construction and pyrosequencing was isolated using an UltraClean™ Microbial DNA Isolation Kit (Mo Bio Laboratories Inc) and high-molecular-weight DNA for fosmid libraries was isolated using a Wizard Genomic DNA Purification kit (Promega). Microarray analyses
Bacterial microarray
Bacterial RNA was isolated from mouse caecum contents and further processed using commercial kits following the manufacturer's recommendations. PCR products amplified from 6000 clones in the E. coli plasmid library of R. hominis were arrayed in duplicate on aminosilane-coated microscope slides (Corning) using a MicroGrid II TAS (BioRobotics).
Mouse microarray analysis
Total RNA was extracted from ileum and ascending colon tissue, processed into biotin- labelled cRNA/aRNA (depending on Affymetrix kit used), and hybridized to the GeneChip NuGO Mouse Array and GeneChip Mouse Genome Array (Affymetrix) using standard techniques. Data analysis was performed with the software packages R (http://www.r- project.org) and Bioconductor (http://www.bioconductor.org). RT-PCR analysis
The R. ?om/n/s-specific primers 5'-CCCACTGACAGAGTATGTAATGTAC-3' and 5'- GCACCACCTGTCACCAC-3' were used for PCR analysis of faecal samples to validate gut colonization levels. Real-time PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the Power SYBR Green PCR Master Mix (Applied Biosystems). All samples were run in triplicate. GyrA was used as a reference gene for normalization. For host gene expression, total eukaryotic RNA isolated from the ileum and ascending colon was reverse-transcribed into cDNA using the High Capacity cDNA Reverse Transcription Kit (Applied Biosystems). Real-time PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the QuantiFast SYBR Green PCR Kit (Qiagen) and QuantiTect Primer Assays (Qiagen). All samples were run in triplicate. Hprt was selected as a reference gene for normalization. All RT-PCR data were analyzed on a logarithmic scale with base 2 by one-way ANOVA with a significance cut-off of P<0.05. Differences were back-transformed to calculate fold changes. Western blot
Immuno-purified rabbit polyclonal antibodies against Roseburia hominis FlaA1 and FlaA2 was produced as described in Duck et al. (Duck ef al. 2007). For the western blot, R. hominis was grown in the presence of varying amounts (0.01g to 1g diet/10 mL of culture) of UV irradiated standard mouse chow for 3hrs, filtered to remove dietary components and diluted in laemmli buffer containing 8M urea. Samples were loaded on a NuPAGE® Novex® 4-12% Bis-Tris gel (Invitrogen) and electrophoresed, followed by further processing using the WesternBreeze Chromogenic Immunodetection System (Invitrogen). FlaA1 and FlaA2 antibodies were used at 1 :1000 and loading control anti-DNA gyrase A (Abeam) at 1 :300, followed by alkaline phosphatase conjugated anti-rabbit. Detection was by substrate colour development relative to loading control colour development. Immunofluorescence
Immuno-localization of R. hominis flagellin was examined in colon contents of mice using specific antisera raised against defined peptide sequences from both FlaA1 and FlaA2 flagellin proteins. Gut content smears were fixed in pre-cooled methanol, incubated with anti- FlaA1 or anti-FlaA2 rabbit antisera (CovaLabs) at 4°C overnight and visualized using Alexa donkey anti rabbit 488 (Molecular Probes).
T cell markers were examined on sequential 8 μιη cryosection. Fixed tissue sections were incubated with Ly6G-FITC, CD3-FITC, CD1 1 b-FITC (BD Biosciences), double-labelled with FoxP3 (Abeam) and CD3-FITC (BD Biosciences) primary antibody or isospecific IgG. Sections were counterstained with DAPI and mounted with Vectashield (Vector Laboratories). For quantification of positive cells, a minimum of five fields of view from each mouse section was examined.
Cloning and purification of recombinant flagellins
Flagellin genes were isolated from liquid bacterial cultures of R. hominis, R. intestinalis, S. typhimurium, S. enteritidis, Eubacterium rectale 33656 and E. coli K12 by PCR amplification and purification. Caco-2 cells were incubated with recombinant flagellins at a final concentration of 100 ng/μί. for 2h at 37°C in a 75% humidified atmosphere of 5% C02. Isolation of intestinal and MLN cells
Cells were isolated from the small intestine and mesenteric lymph node as previously described with minor modifications (Monteleone et al. 2008). Briefly, cellular suspensions were incubated with 100U/mL collagenase VIII (Sigma-Aldrich) in RPMI supplemented with 20% FBS at 37°C for 20 min (mesenteric lymph nodes) or 1 hour (intestinal pieces). Single cell suspensions were then analyzed by flow cytometry (as described).
Generation of bone marrow-derived dendritic cells and cultures
Bone marrow was harvested from femur and tibia of C3H/HeN and C57BI6 mice. For GMCSF-derived dendritic cells, bone marrow cells were resuspended at 1x106/mL in RPMI supplemented with 10% FCS and 20ng/mL rmGM-CSF and seeded at 10ml_/plate in 100mm2 tissue culture plates. After three days culture, loosely adherent cells were collected and replated with GM-CSF supplemented media at 1x106/mL in 12 well tissue culture plates. At day 5, cells were stimulated with 100ng/mL flagellins before being harvested on day 6. For Flt3L-derived dendritic cells, bone marrow cells were resuspended at 2x106/ml_ in RPMI supplemented with 10% FCS and 200ng/mL rmFlt3 and seeded at 2mL/well in 12-well tissue culture plates. Cells were cultured for 10 days with Flt3 supplemented media added to each well on day 4. At day 9, cells were stimulated with 100ng/ml_ flagellins before being harvested on day 10 and analyzed by flow cytometry.
Flow Cytometry
Single cell suspensions of lamina propria cells and dendritic cells were incubated in blocking buffer (containing serum and CD16/CD32 antibody) at 4°C for 15 min prior to staining with specific fluorochrome conjugated antibodies. Lamina propria cells were labelling with antibodies to mouse CD4-FITC and CD25-APC (eBioscience), CD8-APC-Cy7 and CD3- PerCP (Biolegend), and B220-BV570 (BD Biosciences). Intracellular FoxP3 labelling was performed after extracellular staining and cell fixation/permeabilisation according to the manufacturer's instructions (eBioscience). GMCSF-derived dendritic cells were labelled with antibodies CD11c-PE-Cy7, CD1 1-PerCP Cy5, l-A l-E -APC-Cy7, CD80-PE, CD86-APC, CD8-FITC, B220-BV570. Flt3 derived dendritic cells were labelled with CD11 c-PE-Cy7-, CD1 1 b- or Siglec-H-PerCP Cy5-, l-A/l-E -APC-Cy7, CD317 -PE, CD40-APC, CD103-FITC, B220-BV570 Cells were analyzed using a FACSArria (BD Biosciences) and FlowJo software version 7.2.5.
Cytometric Bead Array (CBA)
Bone marrow cells were isolated from femur and tibia with RPMI media of C3H/HeN and C57BI/6 mice and Flt3L-expanded as described previously. Cells were stimulated with 100 ng/mL flagellin (e.g. Roseburia flagellin) after 9 days of culture, and supernatant was collected on day 10. The experiment was performed on three separate occasions to create N=3.
CBA analysis was performed on cell supernatants using the Cytometric Bead Array Mouse Enhanced Sensitivity Master Buffer Kit (BD Biosciences). Standards and samples were loaded onto a 96-well plate for measurement in a FACSArray (BD Biosciences). Results were analyzed using BD FCAP software (BD Biosciences).
Histology
Ascending colon tissue samples were fixed in neutral buffered formalin (Sigma), embedded in cold-curing resin, and 4 m tissue sections were stained using standard haemotoxylin/eosin methods. A complete transverse cross sectional area of colon from each animal was imaged at x200 magnification on a Zeiss Axioskop microscope using a Qlmaging camera controlled by Image Pro Plus software. Each field of view was then scored from 0-4 according to a method based on Berg et al. (Berg et al. 1996). The mean percentage of fields of view at a given grade was calculated and treatment groups were compared using student t-test analysis.
Further detailed protocols are described in the supplementary Materials and Methods. Supplementary Information (SI) Materials and Methods
Bacterial growth conditions
R. hominis A2-183T (=DSM 16839T=NCIMB 14029T) was grown anaerobically on synthetic YCFA or complex M2GSC media. Culture was inoculated from frozen stock into Hungate tubes and incubated overnight at 37°C. Bacteria were then grown on M2GSC agar plates for 48h in a MACS-MG-1000 anaerobic workstation (Don Whitley Scientific) under 80% N2, 10% C02, and 0% H2 at 37°C. The effect of mucin was investigated by adding 0.5% (w/v) mucin from porcine stomach type III (Sigma-Aldrich) to the YCFA medium.
For colonization of germfree (GF) mice, R. hominis was grown in YCFA media overnight at 37"C. The culture was spun down and the pellet was resuspended in one mL of YCFA media, supplemented with 2% cysteine (w/v, Sigma-Aldrich) and 3% ascorbic acid (w/v, Sigma-Aldrich).
Mice
C3H/HeN and C57BI/6 were purchased from Harlan Laboratories. Mice were housed within HEPA-filtered flexi-film isolators (Bell Isolation Systems) at the University of Aberdeen. GF C3H/HeN were provided and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas (ANAXEM plateform, Institut Micalis, INRA, Jouy-en-Josas, France). Germfree TLR5KO and wild type C57BI/6 were provided by Andrew Gewirtz (Center for Inflammation, Immunity, and Infection and Department of Biology, Georgia State University, Atlanta, GA 30303, USA) and maintained in the INRA gnotobiotic rodent breeding facility at Jouy-en-Josas. The management and experimental procedures were approved by the respective Local Ethical Review Committees. Mouse experiments
Eighteen GF C3H/HeN male mice were allocated into control (N-8) and treatment (Λ =10) groups and caged individually in plastic isolators. The mice were fed ad libitum on a sterilized commercial diet (R03-40; UAR). At day 0, 1 and 2, animals in the treatment group were given 100 μΙ_ of R. hominis culture by gavage, while control animals were given 100 μΙ_ YCFA media. At 14d and 28d, four control animals and five R. hominis-treated animals were sacrificed. The ileum and ascending colon were divided into four equal parts and transferred to RNAIater (Ambion), neutral buffered formalin (NBF; Sigma-Aldrich) or liquid nitrogen. The whole caecum was transferred to RNAIater.
To demonstrate the specificity of the response to R. hominis, six GF C3H/HeN male mice were treated with E. coli MG1655 (K12), and three animals were sacrificed at 10d and 22d as described above to give N=3.
Three GF TLR5KO mice and three C57BI/6 WT mice were inoculated with R. hominis culture as described above to evaluate the functional importance of R. hominis flagellins. After 28d these animals were sacrificed together with their GF counterparts.
Twenty-two female C57BL/6 mice (6 weeks old) were used to evaluate the therapeutic effect of R. hominis during DSS-induced colitis. After an acclimatization period of 7- 0 days, the mice were dosed daily with 50 μΐ_ of 109 CFU R. hominis for 14 days. Control animals were dosed with culture medium alone. From day 8, mice were given DSS (MW 50kDa, 30g/l) in their drinking water for 6 days. The animals were euthanized on day 14 and tissue sampling was performed as described above.
Tissue culture experiments
All ceil culture reagents, unless specified otherwise, were supplied by Sigma-Aldrich. For tissue culture experiments in anaerobic conditions, 2x105 Caco-2 or HT29 cells in 1.5 ml_ DME (high glucose, HEPES) medium supplemented with heat-inactivated fetal bovine serum (Gibco), penicillin, streptomycin, amphotericin B and L-glutamine were seeded into the upper compartments of a six-well transwell plate (Corning). The lower compartments contained 3.0 mL of the same medium. Cells were incubated at 37°C in a 5% C02 atmosphere until three days post-confluence, washed with Hanks' solution to remove antibiotics and FCS and stepped down in DMEM supplemented with L-glutamine, sodium selenite and transferrin for 24h without antibiotics. Transwell inserts were then transferred to an anaerobic culture box within the anaerobic workstation at 37°C. The upper compartment of each insert was filled with anaerobic DMEM cell medium, while the lower compartment was filled with oxygenated DMEM.
R. hominis A2-183 culture was harvested at exponential phase by centrifugation at 3,500xg for 5 min. The pellet was washed and resuspended in 0.8 ml_ anaerobic DMEM. One hundred microliters of bacterial suspension (108 CFU/mL) was added to experimental wells. The control wells received the same amount of medium without bacterial cells. Additional controls included bacterial cells incubated without Caco-2 or HT29 cells. Bacterial and eukaryotic cells were harvested after 2h and 4h incubation. Both non-adherent and adherent bacteria were aspirated and stored in RNAIater (Ambion). The viability of R. hominis cells was tested by plating onto YCFA plates. Caco-2 cells or HT-29 cells were harvested from the wells and also stored in RNAIater. R. intestinalis L1-82T (=DSM 146 0T=NCIMB 13810T) culture was harvested at exponential phase by centrifugation at 3,500 g for 5 min. The pellet was washed and resuspended in 0.8 mL anaerobic DMEM. One hundred microliters of bacterial suspension (108 CFU/mL) was added to experimental wells. The control wells received the same amount of medium without bacterial cells. Additional controls included bacterial cells incubated without Caco-2 or HT29 cells. Bacterial and eukaryotic cells were harvested after 2h and 4h incubation. Both nonadherent and adherent bacteria were aspirated and stored in RNAIater (Ambion). The viability of R. intestinalis cells was tested by plating onto YCFA plates. Caco-2 cells or HT-29 cells were harvested from the wells and also stored in RNAIater. For tissue culture experiments with recombinant flagellins, 5x104 Caco-2 cells were seeded in 24-well plates in DMEM (high glucose, HEPES) medium supplemented with heat- inactivated fetal bovine serum (Gibco), penicillin, streptomycin, amphotericin B and L- glutamine at 37°C in a 75% humidified atmosphere of 5% C02. The cells reached confluence on day 5-6 and were used 3 days post-confluency. Prior any treatment, cells were washed twice with Hanks' Balanced Salt Solution and kept in DMEM supplemented with L- Glutamine, selenium and transferrin for 24 hours.
R. hominis library construction
R. hominis chromosomal DNA for small-size library construction and pyrosequencing was isolated using an UltraClean™ Microbial DNA Isolation Kit (Mo Bio Laboratories Inc) and high-molecular-weight DNA for fosmid libraries was isolated using a Wizard Genomic DNA Purification Kit (Promega). DNA integrity was checked by gel electrophoresis.
DNA was mechanically sheared using a Nebulizer Kit (Invitrogen) and fractionated by gel electrophoresis, DNA fragments of desired size were excised from the gel and purified using a Wizard® SV Gel and PCR Clean-Up System (Promega). End-repair was done with a DNA Terminator End Repair Kit (Lucigen). 1.5-3.5 kb fragments were cloned using the CloneSmart® LCAmp Kit (Lucigen) and a 4-8 kb library was constructed using the pJAZZ®- OC Vector (Lucigen). Fosmid libraries were constructed using the CopyControl™ Fosmid Library Production Kit (Epicentre Biotechnologies). Colonies were picked using an automated colony picker (BioRobotics BioPick, Genomic Solutions) and archived into 384-well microtitre plates containing 70 2xLB medium supplemented with 10% glycerol and corresponding antibiotic. Cells were grown overnight at 37 °C with shaking and stored at -80 °C.
Sequencing, assembly, and annotation
Templates for sequencing of small-size libraries were generated by PCR using one μί of clone biomass and primers SL1 and SR2 surrounding the cloning site of pSMART-LCAmp. PCR products were purified using Multiscreen PCR Clean-up filter plates (Millipore).
Recombinant DNA from the pJAZZ®-OC clones was isolated using the Wizard® SV 96 Plasmid DNA Purification System (Promega). Fosmid DNA was isolated using the
FosmidMAX™ DNA Purification Kit (Epicentre). End-reads of DNA fragments from R.
hominis \NGS libraries with different insert sizes were obtained using CEQ8000 (Beckman Coulter) and ABI 3770 (Applied Biosystems) DNA sequencers. Genomic DNA from R.
hominis was also sequenced using 454 GS20 (454 Life Sciences) and 454 FLX sequencers (Roche). The Sanger and 454 data were assembled with MIRA version 3
(http://chevreux.org/projects_mira.html; (1 ). The RAST annotation pipeline
(http://rast.nmpdr.org; (2)) was used for automatic and manual annotation of the genome and for comparative genomic analyses. The annotated genomic sequence of R. hominis A2-183 was submitted to GenBank under the accession number CP003040.
Microarray analyses
Bacterial microarray
Bacterial RNA was isolated from mouse caecum contents using the RNeasy Mini Kit (Qiagen), and further processed with the MICROBEw/cft™ Kit (Ambion), the MICROBExpress™ Bacterial mRNA Enrichment Kit (Ambion), and the MessageAmp™ II- Bacteria RNA Amplification Kit (Applied Biosystems). RNA was labelled with either dCTP- Cy3 or dCTP-Cy5 during cDNA synthesis (CyScribe First Strand cDNA Labelling Kit; Amersham). Labeled products were purified using the CyScribe GFX Purification Kit (Amersham). PCR products amplified from 6000 clones in the E. coli plasmid RA8 library of R. hominis were arrayed in duplicate on aminosilane-coated microscope slides (Corning) using a MicroGrid II TAS (BioRobotics). Amplified fragments of the housekeeping genes rpoD and gyrA were randomly distributed on the array as controls. Microarray hybridization was performed in the GeneTAC hybridization station (Genomic Solutions). Dye labelling was swapped for a second hybridization, and a separate RNA purification was also labelled and hybridized twice, to ensure reproducibility and to obtain statistically significant results. In total, four slides were hybridized for each comparison, for a total of 12 hybridizing spots per amplified clone. Fluorescence was measured in two channels using a GeneTAC LS IV (Genomic Solutions) with GeneTac Integrator version 3.0.1 software. Spot intensities were log-transformed and Loess normalization was applied to remove differences in probe labelling and hybridization efficiencies. The one-sample t-test was used on the log-ratio values to test for differential expression. Data was considered significant when fold change>2 and P<0.05. Mo use microarray analysis
Ileum and ascending colon tissue was removed from RNAIater and lyzed in Trizol (Invitrogen). RNA was isolated using standard chloroform/isopropanol steps. Total RNA was further purified with the RNeasy Kit (Qiagen), including an RNase-free DNase I (Qiagen) digestion step. RNA integrity was determined using the Agilent 2100 Bioanalyzer (Agilent Technologies). Total RNA was processed into biotin-labelled cRNA using the One-Cycle Target Labeling Kit (Affymetrix) or biotin-labelled aRNA using the 3' IVT Express Kit (Affymetrix). Hybridization to the GeneChip NuGO Mouse Array and GeneChip Mouse Genome Array (Affymetrix) on a GeneChip Fluidics Station 450 (Affymetrix) was performed at the Institute of Medical Sciences Microarray Core Facility (University of Aberdeen, UK). Chips were scanned with an Affymetrix GeneChip Scanner 3000 (Affymetrix). Image quality analysis was performed using Gene Chip Operating Software (GCOS) (Affymetrix). Further data analysis was performed with the freely available software packages R (http://www.r- project.org) and Bioconductor (http://www.bioconductor.org). The moderated F-test provided by the Bioconductor package limma was used to test for differential expression. Data was considered significant when P<0.05 using the Benjamini and Hochberg false discovery method: Statistical analysis was performed separately for each of the two time-points. All differentially expressed genes (P<0.05) were imported into MetaCore analytical software (GeneGo, St Joseph, Ml) to generate pathway maps. Integrated pathway enrichment analysis was performed using the knowledge-based canonical pathways and endogenous metabolic pathways. Ranking of relevant integrated pathways was based on P-values calculated using hypergeometric distribution. P-values represented the probability of a given number of genes from the input list to match a certain number of genes in the map by chance, considering the numbers of genes in the experiment versus the number of genes in the map within the full set of all genes on maps.
Gene Ontology (GO) based functional interpretation of the data was performed using DAVID (http://david.abcc.ncifcrf.gov), an expanded version of the original web-accessible program (3). Significantly different transcripts (P<0.05) were allocated into the GO category 'Biological Process' to unearth patterns of gene expression significantly enriched for specific GO terms.
Microarray data were submitted to the National Center for Biotechnology Information (NCBI) Gene Expression Omnibus (accession number GSE25544;http://www.ncbi. nlm.nih.gov/geo).
RT-PCR analysis
The R. hominis-specif\c primers 5'-CCCACTGACAGAGTATGTAATGTAC-3' and 5'- GCACCACCTGTCACCAC-3' were used for semi-quantitative and Real-time PCR analysis of faecal samples to validate gut colonization levels. Further bacterial PCR primers were designed using the on-line tool Primer3Plus (4) and purchased from Sigma-Aldrich. Realtime PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the Power SYBR Green PCR Master Mix (Applied Biosystems). PCR was performed as follows: one cycle at 95°C for 10 min, followed by 40 cycles at 95°C for 15 sec and 60°C for 1 min, ending with a dissociation step. All samples were run in triplicate. GyrA was used as a reference gene for normalization due to its low variation between samples.
For host gene expression, 2 g of total eukaryotic RNA isolated from the ileum and ascending colon was reverse-transcribed into cDNA using the High Capacity cDNA Reverse Transcription Kit (Applied Biosystems) with random primers. Real-time PCR analysis was performed using a 7500 Fast Real-Time PCR System (Applied Biosystems) with the QuantiFast SYBR Green PCR Kit (Qiagen) and QuantiTect Primer Assays (Qiagen). PCR cycling conditions were as follows: one cycle at 95°C for 5 min, followed by 40 cycles at 95°C for 10 seconds and at 60°C for 30 seconds, ending with a dissociation step. All samples were run in triplicate. Hprt was selected as a reference gene for normalization because of its low variation between samples.
All RT-PCR data were analyzed on a logarithmic scale with base 2 by one-way ANOVA with a significance cut-off of P<0.05. Differences were back-transformed to calculate fold changes.
Western blot
Immuno-purified rabbit polyclonal antibodies against Roseburia hominis Fla1 and Fla2 was produced as described in Duck ei al. (5). In brief, New Zealand white female rabbits were immunized with synthetic peptide in complete Freund's adjuvant and boosted several times. For R. hominis Fla1 , peptide NH2-CRSQVRGLNKASDNA-CONH2 and peptide NH2- IDGNFTSKKLQVGSLC-COOH were used, while for R. hominis Fla2, peptide C- AQYNDDAKSVLEILK-COOH and peptide C-GLNKASRNSQDGIS-CONH2 were used. Following immunization the antibodies were purified on an immunoaffinity column prepared by coupling the peptides to 1 ml_ of activated sepharose beads. For the western blot, R. hominis was grown in the presence of varying amounts (0.01 g to 1g diet/10 mL of culture) of UV irradiated standard mouse chow for 3hrs, filtered to remove dietary components and diluted in laemmli buffer containing 8M urea. Thirty μί of each sample was loaded into wells of a NuPAGE® Novex® 4-12% Bis-Tris gel (Invitrogen) and electrophoresed, followed by further processing using the WesternBreeze Chromogenic Immunodetection System (Invitrogen). Fla1 and Fla2 antibodies were diluted 1 :1000 and loading control anti-DNA gyrase A (Abeam) diluted 1 :300 in antibody diluent and incubated overnight at 4°C, followed by 1h at room temperature with alkaline phosphatase conjugated anti-rabbit. Detection was by substrate colour development relative to loading control colour development.
FISH analysis
Tissues fixed in neutral buffered formalin were embedded in Technovit 8100 (Heraeus Kulzer). Two-micron sections were cut using a rotary microtome (Leica/Reichert Autocut). Three sections were taken per slide at 100 μίτι, 200 μπι and 300 μΐτι into the tissue, resulting in nine sections per animal.
Slides were dehydrated by consecutive incubations in 50% (v/v), 80% and 96% ethanol and dried at room temperature (RT). The 16S rRNA FISH probes used were a general bacterial probe Eub338 (GCTGCCTCCCGTAGGAGT; Cy3) and a newly designed R. hominis A2-183- specific probe (GTACATTACATACTCTGTCAGTG; FITC), which was extensively tested for specificity against a panel of intestinal bacterial isolates. Ten microliter probe (30 ng/μΐ.) in 100 μί. hybridization buffer was applied to the dehydrated sample and incubated at probe- specific temperature. The slides were washed in washing buffer at 50° C for 30 min, dipped in ice-cold water to remove residual washing buffer and dried under compressed air flow. Counterstaining was performed with 4',6-diamidino-2-phenylindole (DAPI; Vector Laboratories Inc) and slides were mounted with Vectashield Mounting Medium for fluorescence (Vector Laboratories Inc) to prevent fading. Bacteria were visualized using a Leica DM RBE fluorescence microscope (Leitz GMBH) and photographed with a Penguin 600CL camera (Pixera) and Viewfinder 3.0 software (Studio Lite). High-magnification images (x630) were retrieved using the Apochromatics system (Leica).
Immunofluorescence Immuno-localization of R. hominis flagellin was examined in colon contents of mice colonized with R. hominis using specific antisera raised against defined peptide sequences from both Fla1 and Fla2 flagellin proteins. Gut contents were diluted in PBS, smeared on glass slides and air dried. Smears were fixed in pre-cooled methanol for 5 min at -20 °C , incubated with anti-Fla or anti-Fla2 rabbit antisera (1 : 125, CovaLabs) overnight at 4 °C and visualized using Alexa donkey anti rabbit 488 (1 :1000, Molecular Probes).
Sections were fixed in pre-cooled methanol for 30 min at -20 °C. Immuno-localization of T cell markers was examined on sequential cryosections (8μιη). Sections were fixed either in pre-cooled methanol for 30 min at -20 °C (Ly6G FITC, CD3 FITC, CD1 1 b FITC, all at 1 :50 (BD Biosciences)), or, for the double-labelled FoxP3 (1 :500, Abeam) with CD3 FITC (1 :100, BD Biosciences) fixed in 1% paraformaldehyde (PFA) for 2 min at RT followed by 3 min in 0.01% Triton X in PBS. All sections were blocked with 10% BSA (Sigma) containing 10% relevant pre-immune sera in PBS (pH 7.4). Methanol-fixed tissues were incubated with primary antibodies for 1 h at RT. PFA-fixed sections were incubated with antibodies overnight at 4 °C. FoxP3 was visualized using Alexa goat anti rabbit 594 (1 :1000, Molecular Probes). Sections were counter labelled with DAPI and mounted with Vectashield (Vector Laboratories). For quantification of positive cells, a minimum of five fields of view from each mouse section was examined, using imaging software and microscope settings described above.
Histology
Ascending colon tissue samples were fixed for three hours in neutral buffered formalin (Sigma) at room temperature with constant agitation. The samples rinsed in PBS and then transferred to 70% ethanol and stored at room temperature until orientated for transverse sectioning and embedded in cold-curing resin using Technovit 8100 (Heraeus Kulzer) according to the manufacturer's instructions. The embedded tissue was mounted onto Histoblocs using Technovit 3040 (Heraeus Kulzer). Four micron sections were cut using a rotary microtome (Leica Autocut) fitted with a glass knife (TAAB Laboratories Equipment Ltd.). Tissue sections were stained using standard haemotoxylin/eosin methods. A complete transverse cross sectional area of an ascending colon from each animal was imaged at x200 magnification on a Zeiss Axioskop microscope using a Qlmaging camera controlled by Image Pro Plus software. Each field of view was then scored from 0-4 according to a method based on Berg et ai. (6). Histopathology scores were 0 = Shallow crypts, no or few infiltrating inflammatory cells, intact epithelium, goblet cells appear full of mucin (no pathology); 1 = Crypts may exhibit slight epithelial cell hyperplasia, some diffuse infiltrating inflammatory cells may be seen between crypts, luminal epithelium appears intact, goblet cells may appear slightly depleted of mucin; 2 = Crypts appear deeper with distinct evidence of epithelial hyperplasia, depletion of mucin from goblet cells, infiltrating inflammatory cells evident and may be multifocal in nature, although infiltrates are not seen in the submucosa; 3 = Lesions involve a larger area of the mucosa and /or are more frequent than seen in grade 2. Lesions do not involve the submucosa. Luminal epithelial cells exhibit small erosions. The lesions are not transmural; 4 = Crypt epithelium appears eroded. Abscesses may be present. Luminal epithelial cells appear irregular, sometimes with complete loss. Transmural infiltrate is observed - often associated with complete loss of epithelial cells into the lumen. The mean percentage of fields of view at a given grade was calculated and treatment groups were compared using student t-test analysis.
Cloning and purification of recombinant flagellins
Flagellin genes were isolated from liquid bacterial cultures of R. hominis, R. intestinalis, S. typhimurium, S. enteritidis, Eubacterium rectale 33656 and E. coli K 2 by PCR amplification and purification. The purified flagellin fragment from R. hominis was inserted into expression vector pT7-MAT-Tag-FLAG (Sigma) and flagellin fragments from S. enteritidis and £ coli K12 were inserted into expression vector pGEX-6P-1 (GE Healthcare). Recombinant flagellin was expressed by transformation of plasmid DNA into E. coli BL21 Rosetta and £ coli BL21 (DE3) cells, respectively and induction with 1 mM IPTG (isopropyl b-D-galactosidase). Flagellins were recovered from cell lysates with FLAG beads (Sigma) and Ni-NTA (nickel- nitriloacetic) beads (Clontech, Takara) as per the manufacturer's instructions. The purity of the preparation was assessed by SDS-PAGE stained with coomassie blue solution. Activity of the flagellins fragments was determined by Luciferase Assay (Promega) according to the manufacturer's instructions using the NF- Β transformed Caco-2 cell line.
Caco-2 cells were incubated with recombinant flagellins at a final concentration of 100 ng/pL for 2h at 37°C in a 75% humidified atmosphere of 5% C02. After the treatment the cells were washed with PBS solution twice and harvested for total RNA isolation.
Isolation of intestinal and MLN cells
Cells were isolated from the small intestine and mesenteric lymph node as previously described with minor modifications (7). Briefly, cellular suspensions were incubated with 100U/ml collagenase VIII (Sigma-Aldrich) in RPMI supplemented with 20% FBS at 37°C for 20min (mesenteric lymph nodes) or 1 hour (intestinal pieces). Single cell suspensions were then analyzed by flow cytometry. Generation of bone marrow-derived dendritic cells and cultures
Bone marrow was harvested from femur and tibia of C3H/HeN and C57BI6 mice as previously described (8-1 1 ). For GMCSF-derived dendritic cells, bone marrow cells were resuspended at 1x106/mL in RPMI supplemented with 10% FCS and 20ng/mL rmGM-CSF and seeded at 10mL/plate in 100mm2 tissue culture plates. After three days culture, loosely adherent cells were collected and replated with GM-CSF supplemented media at 1x106/mL in 12 well tissue culture plates. At day 5, cells were stimulated with 100ng/mL flagellins before being harvested on day 6. For Flt3L-derived dendritic cells, bone marrow cells were resuspended at 2x 06/mL in RPMI supplemented with 10% FCS and 200ng/mL rmFlt3 and seeded at 2mL/well in 12-well tissue culture plates. Cells were cultured for 10 days with an additional 2ml_ of Flt3 supplemented media added to each well on day 4. At day 9, cells were stimulated with 100ng/mL flagellins before being harvested on day 10. Cells were harvested from plates by gentle pipetting and analyzed by flow cytometry. Flow Cytometry
Single cell suspensions of lamina propria cells, mesenteric lymph node cells and dendritic cells were incubated in blocking buffer (containing serum and CD16/CD32 antibody) at 4°C for 15 min prior to staining with specific fluorochrome conjugated antibodies. Lamina propria cells were labelled with antibodies to mouse CD4-FITC and CD25-APC (eBioscience), CD8- APC-Cy7, CD3-PerCP Cy5.5 and B220-BV570 (Biolegend). Intracellular FoxP3-PE (eBioscience) labelling was performed after extracellular staining and cell fixation/permeabilisation according to the manufacturer's instructions (eBioscience). GM-CSF derived dendritic cells were labelled with antibodies CD1 1 b-PerCP Cy5.5 (BD Biosciences), CD1 1 c-PE-Cy7, l-A/l-E -APC-Cy7, CD80-PE, CD86-APC, CD8-FITC, B220-BV570 (Biolegend). Flt3L derived dendritic cells were labelled with CD1 1 c-PE-Cy7-, CD11 b- or Siglec-H-PerCP Cy5.5 (Bioegend), l-A/l-E -APC-Cy7, CD317-PE, CD40-Alexa Fluor 647, CD103-FITC, B220-BV570. Cells were analyzed using a FACSAriall (BD Biosciences) and FlowJo software version 7.2.5. Cytometric Bead Array (CBA)
Bone marrow cells were isolated from femur and tibia with RPMI media of C3H/HeN and C57BI/6 mice and Flt3L-expanded as described previously. Cells were stimulated with 100 ng/mL flagellin (e.g. Roseburia flagellin) after 9 days of culture, and supernatant was collected on day 10. The experiment was performed on three separate occasions to create N=3.
CBA analysis was performed on cell supernatants using the Cytometric Bead Array Mouse Enhanced Sensitivity Master Buffer Kit (BD Biosciences) according to the manufacturer's instructions. Standards and samples were loaded onto a 96-well plate for measurement in a FACSArray (BD Biosciences). Results were analyzed using BD FCAP software (BD Biosciences).
Dry body weight and lipid carcass analysis
Eviscerated mouse carcass was weighed, lyophilized to constant weight and then milled for analysis. Lipid content was determined by extraction (1 :100 w/v) with chloroform/methanol (2:1 v/v) as described previously (12).
Cloning of Roseburia flagellins.
Amplification by PCR of the flagellin gene from liquid bacteria culture.
Roseburia hominis A2-183 flagellin sequences were retrieved from the National Center for biotechnology Information (NCBI) website (http://www.ncbi.nlm.nih.gov/).
Roseburia intestinalis L1-82T (NCIMB = 13810; DSM = 14610 T) flagellin sequences were retrieved from the National Center for biotechnology Information (NCBI) website (http://www.ncbi.nlm.nih.gov/). Accession numbers for the flagellin genes and proteins are provided in Table B (Table B - summary of the accession numbers for Roseburia flagellins described herein) ***
Total RNA isolation from bacteria
Total RNA was isolated from 1 mL of log phase bacteria liquid culture using the RNAeasy minkit (Qiagen, Sussex, UK), coupled to RNase-free DNase I (Qiagen) digestion and based on manufacturer's protocol. In brief, one milliliter of liquid culture was place in a 1.5 mL tube, centrifuged at 5.000 x g for 5 min at 4°C and the supernatant was discarded. The bacterial pellet was resuspended in 100 pL of lysozyme-containing TE buffer (10 mM Tris-HCI, 1 mM EDTA, pH 8.0) and incubated at RT (room temperature). Gram-positive bacteria RH (Roseburia hominis) was incubated for 10 min with a lysozyme concentration of 3 mg/mL. Three hundred and fifty microliters of lysis buffer containing 1 % β-mercapto-ethanol were then added to the tube to disrupt the cells by vortexing and 250 pL of 100 % ethanol (Molecular grade, Merck) were added. Seven hundreds microliters of the resulting suspension was applied to the RNeasy mini column fitted with a catching tube, centrifuged for 15 seconds at 8.000 x g and the catch emptied. Again, 350 pL of wash buffer was applied to the column, which was centrifuged for 15 s at 8.000 x g and the flow-through discarded. DNA digestion was carried out by adding to each column, 30 units of DNase I mixed with 70 pL of RDD buffer, and incubating at RT for 15 min. The column was washed again as previously described with 350 μΙ_ of wash buffer, then twice with 500 pL of RPE buffer. After air-drying the column by centrifugation of the empty column for 1 min at 8.000 x g, 40 μ[_ of RNase-free water were added directly onto the column and incubated 1 min at RT to be centrifuged for 1 min at 8.000 x g. The eluate containing the total RNA was measured spectrophotometrically using Nanodrop technique to determine the concentration. RNA integrity was checked by the RINH genomic department (University of Aberdeen, UK) with an Agilent 2100 Bioanalyzer (Agilent Technologies). RNA with integrity number (RIN) was between 9.5 and 10 was considered excellent quality. Total RNA was stored at -80°C until later use.
Reverse transcription
Total RNA was reverse transcribed using the Quantitect reverse Transcription kit (Qiagen), according to the manufacturer's instructions. Briefly, one microgram of total RNA in a total volume of 12 pL was incubated for 2 min at 42°C with 1 X gDNA wipeout buffer and further mixed with 1X Quantiscript RT buffer (3 μΙ_), RT primer mix (2 μΙ_) and Quantiscript reverse transcriptase (1 μΙ_) in a final volume of 20 μ[_. The reverse transcription program was 15 min at 42°C followed by 3 min at 95°C to inactivate the enzyme. The resulting complementary DNA (cDNA) concentration was 50 ng/ L and the cDNA was stored at -20°C until later use. PCR amplification of flagellin genes
To amplify the flagellin from genomic DNA, forward and reverse primers were manually designed and purchased to Sigma- Aldrich (Poole, UK). The amplification by PCR of flagellin fragments was performed with forward primer inserting a Bglll restriction site at 5' end, and reverse primer inserting a Xhol restriction at the 3' end.
Roseburia hominis (f la 1 )
Forward primer (5'-3'): CTCGAGATATGGTAGTACAGCACAA
Reverse primer (5'-3'): CTTAGATCTCTGTAATAAG G ATAATA
Roseburia hominis (fla2)
Forward primer (5'-3'): CTCGAGATATGGTGGTTAATCATAA
Reverse primer (5'-3'): CTTAGATCTTTTC AAAATCTCAAG CAC
Roseburia intestinalis (Fla1 )
Forward primer (5'-3'): GCAGGATCCATGCGTGGCGGAGACAAT
Reverse primer (5'-3'): AATGTGGTG GTGGTGGTG GTG CTG CAG AATCTG CAA Roseburia intestinalis (Fla2)
Forward primer (5'-3'): CTCGAGATATGGTAGTTAATCATAA
Reverse primer (5'-3'): CTTAGATCTTTTTAACATTTCCAACAC Roseburia intestinalis (Fla3)
Forward primer (5'-3'): CTCGAGATATGGTAGTACAGCACAA
Reverse primer (5'-3') CTTAGATCTCTGTAACAGAGAAAGTA
Roseburia intestinalis (Fla4)
Forward primer (5'-3') CCGGGATCCATGGTAGTACAGCACAAT
Reverse primer (5'-3') TTAGTG GTG GTG ATGATG ATG CTGTAAC AG AGAAAG
Using 1 μΙ_ of bacterial culture as a template, the flagellin genes were amplified by PCR. The thermal program for amplification was adapted from Fermentas (Fermentas GMBH, Germany) for optimum KOD polymerase (Novagen, Madison, Wl) functions and was 95°C for 2 min for polymerase activation followed by 34 cycles of amplification, 95°C for 20 s, annealing temperature for 10s and 70°C for 20 s ending with 2 min at 70°C using KOD polymerase. The details of the PCR mix are given in Table 1. The PCR products were run on a 1 % agarose gel for 30 min at 120 V and the bands of interest were excised and purified. The insert was first cloned into the cloning vector pCR™-Blunt ll-TOPO using Zero Blunt TOPO PCR cloning kit (Invitrogen) according to the manufacturer's instructions and by mixing as described in Figure 1A and Table 1.
Table 1 Composition of the mix for the insertion of PCR product into pCR-Blunt ll-TOPO cloning vector. Salt solution and vector-enzyme mix were ready-to-use solutions.
Components Volume (pL)
PCR product 2
Salt solution 1
H20 2
Vector-enzyme mix 1
Total 6
Electrophoretic separation and purification of PCR products.
In order to view the isolated flagellin product amplified by PCR, the PCR reaction was mixed with 1 X Blue-orange loading dye (Promega) and loaded onto a 1% agarose gel (made of agarose 1% diluted in TAE buffer (40 mM Tris base, 0.1 % (v/v) acetic acid, 1 mM EDTA) boiled and poured in a gel tray) containing 0.5 pg/mL of Ethidium bromide to stain nucleic acids. Samples migrated for 30 min under 120 V using TAE as running buffer. When migration was finished, the gel was visualized under ultra-violet (UV) and the product was identified using a reference standard and excised with a clean scalpel. The gel slice was then transferred into a pre-weighed eppendorf tube and its weight recorded by subtraction from the empty tube weight. The PCR product was purified. Membrane binding solution was added to the gel slice in a ratio of 10 pL of solution per 10 mg of agarose gel slice. The mixture was then incubated at 65°C for 10 min with frequent vortexing until the gel slice was completely dissolved. The tube was centrifuged briefly at RT to ensure all contents were at the bottom of the tube before progressing to DNA purification. From this point onward the purification PCR involved using Wizard® SV Gel and PCR Clean-up system (Promega, Southampton, UK) according to the manufacturer's instructions. One SV minicolumn per PCR product was placed into a collection tube. The PCR product were added to the SV minicolumn assembly and incubated for 1 min at room temperature (RT). The column was centrifuged at 16.000 x g for 1 min, and the flow-through discarded. The column was then washed by adding 700 μΙ_ of membrane wash solution and centrifuged for 5 min at RT. The flow-through was discarded and the assembly spun again for 1 min and dried at RT for 2 min to evaporate any residual ethanol. The column was then transferred into a fresh 1.5 mL nuclease-free tube. To recover the PCR product, 25 μΙ_ of nuclease-free water was applied to the centre of the column and DNA was eluted by 1 min incubation at RT and 1 min spin at 16.000 x g. The concentration of the eluate was measured spectrophotometrically using Nanodrop (Thermo Fisher Scientific) and stored at -20°C.
Digestion of the flagellin and expression vector.
Two hundred microliters of freshly thawed DH5a competent cells were kept on ice and 4 μΐ_ of the PCR product mix, and left on ice for 5 min. Heat shock was performed for 1 min at 42°C and the ceils returned on ice or 5 min, before addition of 400 μΙ_ of SOC medium. SOC Medium (Sigma) is a rich media used primarily in the recovery step of Escherichia coli competent cell transformations. Use of SOC maximizes the transformation efficiency of competent cells. The cells grew at 37°C for 1 hour, and 200 μΙ_ of the mix was plated on LB agar plate supplemented with Kanamycin 50 pg/mL The positive clones were prepared as minipreps, nanodropped and digested with BamH1 and Xho1 for 2 hours to excise the flagellin. The expression vector pT7-MAT-Tag-FLAG-2 (Sigma), depicted in Figure 2A, was also digested with BamH1 and Xho1. After separation of the product on a 1 % agarose gel and purification of the digested vector and fragment i.e. the vector and the insert were ligated at 4°C overnight and transformed into E.coli DH5a. Ligation products were plated on LB agar supplemented with ampicillin 100 pg/mL. Positives clones were prepared as minipreps and transformed into E.coli BL21 (DE3) competent cells. The positives colonies were sequenced with appropriate primers to check the presence of the insert. Glycerol aliquots were made out the positive clones. The expression vectors encoding Roseburia flagellins were further prepared as minipreps and transformed into E.coli competent cells to improve the yield of the purification; for Rh1 , Rh2 and Ri2 the E. coli competent cells were E.coli BL21 Rosetta and for RI3, Ri1 Ri4, Se, St, K12, and Er the £ coli competent cells were E.coli BL21 (DE3).
Expression and purification of Roseburia flagellins
The transformed E.coli (e.g. BL21 Rosetta) encoding the flagellin gene (RH1 or FLaA1) were grown in 1 liter LB medium with ampicillin (100 g mL), and supplemented with chloramphenicol (50 g/YnL) for Rosetta cells, at 37°C under shaking 180 rpm until log phase. The culture was induced for 3 hours with 1 mM IPTG under the same conditions, to allow the specific expression of flagellin protein. Bacteria were pelleted by centrifugation 4.000 x g, 4°C, for 10 min and resuspended in 60 mL of buffer 1 (50 mM Tris (pH 7.4), 150 mM NaCI) and sonicated with a Soniprep 150 (Sanyo, Japan), for 1 min when using BL21 (DE3), or 3 min when using Rosetta with 1 min rest after each minute. Cell lysate was centrifuged at 9.000 x g for 10 min at 4°C and the supernatant discarded. The pellet, which contains insoluble proteins was resuspended in 60 mL of buffer 2 (50 mM Tris (pH 8.0), 100 mM NaCI, 5 mM EDTA, 0.5% Triton-X100, 1 mM DTT) sonicated again until complete resuspension, and centrifuged at 5.000 x g for 15 min at 4°C. The insoluble fraction was washed a second and a third time with buffer 2. A last wash was carried out using buffer 2 without Tx-100 and DTT, as described above. To solubilise the proteins, the insoluble fraction was resuspended using sonication in 4 mL of urea buffer (2 M urea, 50 mM Tris (pH 7.4), 150 mM NaCI) and centrifuged at 5.000 x g, 5 min at RT. The supernatant was discarded by decanting and the pellet was resuspended in 2 mL of 4 M urea, 50 mM Tris (pH7.4), 150 mM NaCI by sonication and centrifuged at 5.000 x g, 5 min at RT. The supernatant was collected by decanting and the pellet was resuspended in 2 mL of 8 M urea, 50 mM Tris (pH7.4), 150 mM NaCI solution by sonication and centrifuged at 5.000 x g, 5 min at RT. The supernatant was collected by decanting and mixed to the 4M urea fraction, to make a 6M urea solution containing solubilized flagellins. One milliliter of Talon resin (Clontech, Takara, UK) was washed twice with 2 mL of buffer 1 (50 mM Tris (pH7.4), 150 mM NaCI) and centrifugated at 1.000 x g, 2 min at RT. The supernatant was discarded and the 6 M urea fraction containing flagellin was added, and left for rotation at 4°C for 1 hour. After centrifugation at 1.000 x g for 2 min at RT, the resin was washed twice with buffer containing 2 M urea, 50 mM Tris (pH 7.4), 150 mM NaCI, 15 mM immidazole. After centrifugation, the resin was incubated for 10 min with 300 L of elution buffer (360 mM Tris- HCI, 680 mM imidazole, 360 mM NaCI, 0,35 N HCI, 1.43 M urea), gently mixed, and the eluate was collected after centrifugation at 2.000 x g for 2 min at RT. The elution was repeated once and the two eluates mixed. A second purification step using anti-FLAG M2 magnetic beads (Sigma) was performed to improve the purity of the protein preparation. Four hundred microliters of ultra pure water were slowly added to the eluate of the Talon resin, to obtain a final concentration of 0.9 M urea, suitable for FLAG beads. Two hundred fifty microliters of FLAG magnetic beads were washed twice with 750 pL of buffer 1 , by mixing and leaving on a magnetic stand (Ambion) to remove the supernatant. The Talon-eluate was added to the beads and rotated for 30 min at 4°C. The beads were washed five times with 1 mL of 0.9 urea, 50 mM Tris (pH7.4), 150 mM NaCI. The elution consisted in adding to the beads 250 pL of 200 pg/mL FLAG peptide solution containing 0.9 M urea, 50 m Tris (pH7.4), 150 mM NaCI, mixing well and incubating 30 min at RT. The tubes were placed on the magnetic stand and the final product was collected. This elution step was repeated once and 500 pL final products were further dialyzed in PBS with 0.9 M urea for 1 hour at 4°C, prepared as aliquots and stored at -80°C. The purity of the preparations was assessed by SDS-PAGE stained with coomassie blue solution (Figure 3A). Just before use, the protein aliquot was dialyzed 1 hour against PBS, changing the buffer twice, in slide-a-lyser of 20 kDa molecular weight cut off (Pierce, UK) and the protein concentration was measured using Bradford's method. Endotoxin measurement confirmed values were <0.25 EU/mL.
The nucleotide sequence encoding Fla1 is shown in SEQ ID NO 1 and the amino acid sequence of Fla1 is shown in SEQ ID NO 2.
ATG GTAGTAC AG CAC AATCTTACAG CAATG AAC GCTAACAG AC AGTTAGGTATC ACAAC AGG CG CAC AG GCTAAGTCTTCTGAG AAGTTATCTTCTG GTTACAAG ATCAACCG CG C AG CAGATGACGCAGCAGGTCTTACGATTTCCGAGAAGATGAGAAGCCAGGTTAGAGGCTT AAATAAAGCTTCTGACAACGCACAGGATGGTGTATCCCTTATTCAGGTAGCTGAGGGTG CATTAAGTGAGACACACTCCATCTTACAGCGTATGAATGAGTTAGCAACTCAGGCAGCA AACGATACCAATACAACCTCAGACAGAACTGCAGTTCAGCAGGAGATCAACCAGTTAGC ATCTGAGATCACCAGAATCGCTTCTACAACTCAGTTCAACACAATGAACCTGATCGATGG TAACTTCACAAGTAAGAAGCTTCAGGTAGGTTCCCTTTGCGGACAGGCTATCACAATCG ATATCTCTGATATGTCTGCTACAGGTCTTGGCGTTAGCGGATTAGTAGTATCTTCCTTCT CTGCAGCTGGTAAGGCAATGTCTGCAGCTCAGGATGCTATCAGCTACGTATCTTCTATG CGTTCTAAGCTGGGTGCATTACAGAACAGACTTGAGCACACAATCTCCCACCTGGACAA CATTTCTGAGCACACATCTTCTGCAGAGTCTCGTATCCGTGATACAGATATGGCTGAAG AGATGGTTGAGTACAGCAAGAACAACATCCTTGCTCAGGCAGGACAGTCTATGCTTGCT CAG G CTAACCAGTCTACTCAGG GTGTATTATCCTTATTAC AGTAA (SEQ ID NO 1).
MWQHNLTAMNANRQLGITTGAQAKSSEKLSSGYKINRAADDAAGLTISEKMRSQVRGLNK ASDNAQDGVSLIQVAEGALSETHSILQRMNELATQAANDTNTTSDRTAVQQEINQLASEITRI ASTTQFNTMNLIDGNFTSKKLQVGSLCGQAITIDISDMSATGLGVSGLWSSFSAAGKAMSA AQDAISYVSSMRSKLGALQNRLEHTISHLDNISEHTSSAESRIRDTDMAEEMVEYSKNNILAQ AGQSMLAQANQSTQGVLSLLQ (SEQ ID NO 2).
The flagellin structure consists of four domain DO, D1 , D2 and D3. See Figure 4A.
DO: N-terminal a-helix starts from Gin 2 and extends up to Ser 32 (NDO). C-terminal a-helix starts from Ala 459 and extends down to Ser 491 (CDO).
The spoke region, which connects DO and D1 domains, consists of two chains (Ns and Cs), one from Ser 32 to Ala 44 and the other from Glu 454 to Ala 459.
D1 : N-terminal segment extends from Ala 44 to Gin 176 and the C-terminal segment from Asn 406 to Glu 454. N-terminal segment is made of an a-helix (from Ala 44 to Ala 99) (ND1a), followed up by a loop connecting to the second, shorter a-helix (ND1 b) which goes down and the chain continues to two β-turns, a β-hairpin pointing down and an extended chain going up, and the rest of the chain finally goes into domain D2. The C-terminal a-helix in domain 1 (CD1) starts from Asn 406 and extends to Glu 454.
Domain DO and D1 are packed into the protofilament structure so that N-DO is oriented to the outside and C-DO exposed to the central channel.
D2 domain comprises two segments: N-terminal segment from Lys 177 to Gly 189 and C- terminal segment from Ala 284 to Glu 405. It is made mostly of β strands excepting two helix 285-289 and 288-298.
D3 domain comprises a central segment from Tyr 90 to Val 283. Mostly made of β strands with one short stretch of helical fold (199-209).
Without wishing to be bound by theory, two essential regions of flagellin protein involved in the recognition and activation of TLR5 are thought to be amino acids at positions 79-117 of SEQ ID NO 2 (N-D1 domain) and amino acids at positions 408-439 of SEQ ID NO 2 (C- D1 domain), as well as the amino acid alanine (A) at position 41 1 of SEQ ID NO 2, the amino acid glutamine (Q) at position 412 of SEQ ID NO 2 and the amino acid serine (S) at position 420 of SEQ ID NO 2.
EXAMPLES
R. hominis referentially colonizes the colon
C3H/HeN germfree (GF) mice were inoculated with three gavages of R. hominis on consecutive days. The inventors report the first successful mono-colonization of germfree mice with a single bacterial species from the Firmicutes phylum. Successful colonization was achieved using an inoculation medium containing 3% ascorbic acid and 2% cysteine to protect this oxygen sensitive bacterium. Analysis of gut tissue by fluorescent in situ hybridization (FISH) revealed that R. hominis colonized both the ileum and colon, but was found in much higher numbers in the colon. Bacteria were also found closely associated with the colonic mucosa (Fig. S1A). Colonization was further validated and quantified by PCR using R. hominis-specif c primers with numbers approximating 1x1010 bacteria/g faeces (Fig. S1 B-C). Faeces of GF animals tested negative for the presence of any bacteria.
The R. hominis genome reveals unique genes promoting host interactions
The complete genome sequence of R. hominis A2-183 was generated and is represented by a single 3,592, 125-bp chromosome (Fig. 1A). Automated and manual annotation of the genome using the RAST platform revealed the presence of four ribosomal operons, 66 RNAs and 3,273 predicted proteins. The largest group of genes belonged to the Subsystem Category Carbohydrates (271 genes), encoding proteins involved in carbohydrate metabolism, followed by Protein Metabolism (197) and Amino acids and Derivatives (175) (Fig. 1 B). Other important functional categories included Motility and Chemotaxis (49) and Dormancy and Sporulation (12). Comparative genomic analysis established that the closest relative in terms of genomic structure and function among the complete bacterial genomes is Eubacterium rectale (Mahowald et a!. 2009), which is not surprising given the close taxonomical relatedness of these organisms (Duncan et al. 2006, Aminov ef al. 2006). Comparative reconstruction of the two genomes with 1 ,095 genes revealed that they differed by approximately 25% of the genes. In particular, these differences encompassed genes encoding important functions for interaction with the host. For example, the Motility and Chemotaxis genes encoding type IV fimbrial assembly proteins PilB and PilC were present in E. rectale but absent in R. hominis whereas flagellar basal-body rod protein FIgC, flagellar hook-basal body complex protein FliE, flagellin protein FlaB and flagellar motor switch protein FliG were unique to R. hominis (Table S1). The two bacterial genomes also differed by 42 carbohydrate genes, reflecting their divergent nutritional requirements. Interestingly, R. hominis is unique in that it expresses two flagellin genes that are both FLA type as opposed to flagellins homologous to FliC expressed by Salmonella and E. coli bacterial species.
Table S1. Comparative analysis of the R. hominis and E. rectale genomes.
Comparative genomic analysis showed that Eubacterium rectale is the closest known relative of R. hominis in terms of genomic structure and function, and the two genomes differed by approximately 25% of the genes. (A) Genes present in R. hominis but absent in E. rectale and (B) genes present in E. rectale but absent in R. hominis. Table S1A. Genes present in R. hominis but absent in E. rectale.
Figure imgf000122_0001
Figure imgf000123_0001
Figure imgf000124_0001
Figure imgf000125_0001
Figure imgf000126_0001
Figure imgf000127_0001
Table S1 B. Genes present in E. rectale but absent in R. hominis.
Figure imgf000128_0001
Figure imgf000129_0001
Figure imgf000130_0001
R. hominis responds to the gut environment by up-regulating motility, mobilization and chemotaxis genes
To determine the genes differentially expressed by R. hominis in response to association with the host and diet, a microarray was constructed using 6,000 PCR fragments from the small-insert-size sequencing library. Subsequent Real-time PCR validation was performed on 42 differentially expressed genes (Tables S2 and S3), which cluster at specific regions of the R. hominis genome as illustrated in Fig. 2A. To distinguish between the effects of gut environment and dietary components, bacterial RNA was isolated from four different experimental conditions: (i) in vivo, from the caecum of mono-associated mice; (ii) in vitro, from bacteria grown in culture media; (iii) in vitro, from bacteria grown in the presence of dietary components; and (iv) from bacteria incubated on the surface of confluent Caco-2 and HT-29 cells. Table S2. Real-time PCR analysis on bacterial RNA using R. hominis specific primers.
Bacterial PCR primers were designed for differentially expressed genes using Primer3Plus. All samples were run in triplicate. GyrA was used as a reference gene for normalization.
Figure imgf000132_0001
Figure imgf000133_0001
Table S3. Index of R. hominis PGR experiments plotted on circular genome map. List of hominis PCR experiments as shown on the circular genome map.
Figure imgf000134_0001
Fifty differentially expressed genes were identified (in vivo vs. in vitro). The most surprising discovery was the high up-regulation in vivo of genes involved in conjugation/mobilization transfer, the mobA- and mobL-Wke genes (Fig. 2A). The presence of such genes in the transcriptional studies was surprising as no identifiable genes were assigned to Phages, Prophages, Transposable Elements and Plasmids in the Subsystem Category feature. This difference in gene detection and allocation is likely due to the recognized limitations of the Subsystem Category annotation. The stimulatory effect of dietary compounds was much less pronounced, suggesting that the gut environment per se is a major inducer of genes involved in horizontal gene transfer.
Other gut environment-induced subsystems included Membrane Transport, in particular magnesium transport, and Motility and Chemotaxis including multiple methyl-accepting chemotaxis proteins and genes of the flagellar operon (Fig. 2B). R. hominis possesses multiple flagellin genes flaA 1, flaA2, flaA3, and flaB. In the mouse gut environment, flagellin expression was verified by Western-blot and immunocytochemistry using bacteria isolated from both in vivo colonized mice and from in vitro cultures grown in the presence of diet, with specific antibodies raised against recombinant flagellin proteins FlaA1 and FlaA2 (RH1 and RH2) (Fig. 2C). This positive validation of flagellin expression in vivo is consistent with previous reports indicating that only certain subsets of Firmicutes produce flagella in vivo (Turnbaugh et al. 2008) unlike other bacterial species that actively down-regulate expression of the bacterial protein. The expression of catabolic metabolism genes in R. hominis in the gut environment was also affected by the gut environment (Fig. 2D). The genes involved included acetyl-CoA acetyltransferase, 3-hydroxyacyl-CoA dehydrogenase, butyryl-CoA dehydrogenase and phosphoenolpyruvate carboxykinase [ATP].
To further investigate the effects of host-adaptation on the R. hominis transcriptome, in vitro stimulation of human intestinal epithelial cells (Caco-2 and HT-29) was performed. This showed that the conjugation/mobilization transfer gene mobA/mobL proteinl, which was induced by adaptation to the mouse gut, was also increased in both cell lines (Fig. 2E). Consistent with the in vivo data, the flagellin gene MotA was up-regulated in Caco-2 cells. Genes involved in butyrate metabolism showed differences between the two cell lines, with down-regulation seen in Caco-2 cells and up-regulation in HT-29 cells.
R. hominis influences host innate signalling pathways mostly in the colon
Colonization of GF mice with R. hominis correlated with increased host gene expression, which was highest in the colon (Fig. 3A and Table S4). Differential expression was most profound at 28d after colonization, with 159 genes up-regulated and 143 genes down- regulated. The number of differentially expressed genes in the ileum at 14d was similar to the ascending colon, with 79 genes up-regulated and 119 genes down-regulated. Differential expression in the ileum was very low at 28d, consistent with reduced colonization levels. The transcriptomic response differed at the two time-points, as shown by the clear separation of significant transcripts by heatmap analysis (Fig. 3B). Positive Real-time PCR validation of Affymetrix data is shown in Fig. 3C.
Table S4. Affymetrix data between R. hominis inoculated animals and GF animals. Affymetrix microarray analysis was performed on RNA isolated from ascending colon and ileum tissue. Data was considered significant when P<0.05 using the Benjamini and Hochberg false discovery method. (A) Transcripts differentially expressed in the ascending colon at 14d. (B) Transcripts differentially expressed in the ascending colon at 28d. (C) Transcripts differentially expressed in the ileum at 14d. (D) Transcripts differentially expressed in the ileum at 28d.
Table S4A. Transcripts differentially expressed in the ascending colon at 14d between R. hominis inoculated animals and germfree animals.
Figure imgf000137_0001
Figure imgf000138_0001
Figure imgf000139_0001
Figure imgf000140_0001
Figure imgf000141_0001
Table S4B. Transcripts differentially expressed in the ascending colon at 28d between R. hominis inoculated animals and germfree animals.
Figure imgf000141_0002
Figure imgf000142_0001
Figure imgf000143_0001
Figure imgf000144_0001
Figure imgf000145_0001
Figure imgf000146_0001
Figure imgf000147_0001
Figure imgf000148_0001
Figure imgf000149_0001
Figure imgf000150_0001
Table S4C. Transcripts differentially expressed in the ileum at 14d between R. hominis inoculated animals and germfree animals.
Figure imgf000151_0001
Figure imgf000152_0001
Figure imgf000153_0001
Figure imgf000154_0001
Figure imgf000155_0001
Figure imgf000156_0001
Figure imgf000157_0001
Table S4D. Transcripts differentially expressed in the ileum at 28d between R. hominis inoculated animals and germfree animals.
Figure imgf000158_0001
Genes involved in innate immunity and gut barrier function were significantly induced by the presence of R. hominis in the ascending colon. The GO-process 'innate immune response' (GO:0045087) was up-regulated and included the important TLR-related genes Tlr5, 77/ and Vnn1. The up-regulation of Tlr5 was of particular interest, given the corresponding induction of flagellar genes and flagellin protein in R. hominis during gut colonization, and may infer a role for this innate signalling pathway in mediating innate and adaptive immune responses. Other innate immune genes affected in the colon by R. hominis included the antimicrobial peptides Defb37, Pla2g3, Mud 6 and Itln and the gut barrier function genes Sprrla, Cldn4, Pmp22, Crb3 and Magi3. Innate immune genes showing up-regulation in the ileum in response to R. hominis included Defcr20, Pcgf2, Ltbp4, Igsf8 and Tcfe2a. Interestingly, herein it is shown negative regulation of the NF- Β pathway (GO:0043124) (Fig, S2) by R. hominis, which, like B. thetaiotaomicron (Kelly et al. 2004), may contribute to immune homeostasis by down-regulating this inflammatory cascade.
To demonstrate that these responses are specific to R. hominis, the response of germfree animals to another commensal bacterium was investigated. The gene expression responses to colonization with E. coli MG1655 (K12) were compared to R. hominis after 10-14d and 22- 28d post-colonization. Over this time interval, large differences in gene expression were observed in response to R. hominis but not to E. coli, indicating that R. hominis is biologically very active in the gut, in contrast to the minimal impact of £. coli (Fig. S3). The response to E. coli deduced from the gene expression data in the ascending colon seemed to be mainly a B-cell mediated antibody response.
R. hominis affects T cell pathways mostly in the colon The majority of pathways affected at 14d grouped into the categories cell differentiation, cell cycle regulation and tissue remodelling. Importantly, immune response was a major pathway induced at 28d in the ascending colon. The significantly affected pathways in this category were mostly involved in T cell function, including IL-10 signalling and regulation of T cell function by CTLA-4 (Table S5). The genes involved in these pathways showed both up- regulation and down-regulation, so while these pathways were significantly affected by the presence of R. hominis, the precise net functional effects on T cell differentiation required further investigation. To clarify the role of R. hominis in relation to T cell differentiation, conventional mice with R. hominis were treated for 14 days and determined the impact on T cell subsets both in the lamina propria and mesenteric lymph nodes (MLN). Treatment with R. hominis increased the population of CD3*CD4+CD25+FoxP3+ T cells in both locations (Fig. 4). An assessment was made of the numbers of double-positive CD3+FoxP3+ cells in the lamina propria of ascending and descending colon of mono-associated C3H/HeN and C57BI6 animals and confirmed a significant increase in regulatory T cells in R. hominis- treated mice (Fig. 5A). The GO-process for 'actin polymerization' (GO:0030041 ) (Arpc3, Capg, Cdc42ep5 and Rhoc) was up-regulated at 28d in the colon in R. hominis colonized mice (Fig. S2). Actin polymerization at the immune synapse is required for T cell activation and effector function. Overall, this data indicates that R. hominis actively effects the adaptive immune response in the colon by positively influencing T cell regulation. Table S5. Immune system response pathway analysis of transcripts differentially expressed in the ascending colon between R. hominis treated mice and germfree mice at 28d. Differentially expressed genes (P<0.05) were imported into GeneGo MetaCore analytical software to determine significantly enriched canonical pathways in each group. * The number of genes on each map that are differentially expressed in the specific treatment comparison. ** The total number of genes on each map.
Regulatory processes/Immune system response pathway
P-value Significant* Total**
Immune responseJL-10 signaling pathway 0.00125 10 26
Immune response IL-9 signaling pathway 0.00592 1 1 36
Immune response HMGB1/RAGE signaling pathway 0.00832 14 53
Immune response_BCR pathway 0.00992 14 54
Development_GM-CSF signaling 0.01258 13 50
Development_PEDF signaling 0.02618 12 49
Immune response IL-5 signalling 0.02840 1 1 44
Immune response TC and CD28 co-stimulation in activation of NF-kB 0.03611 10 40
Immune response Regulation of T cell function by CTLA-4 0.04598 9 36
Immune response CD40 signaling 0.04796 14 65
Signal transduction_JNK pathway 0.04921 10 42
Related to these results was the induction of the Ly6 gene family in the ascending colon. In particular, the GPI-anchored gene product of Ly6g6c was up-regulated 25-fold, and the related gene Ly6g6e was up-regulated two-fold at 28d. Most haematopoietic cells, including neutrophils and plasmacytoid dendritic cells, express one or more members of the Ly6 family. Furthermore, a possible role of Ly6 in T eel! activation, differentiation and maturation has been proposed (Mallya, Campbell & Aguado 2006). Immunocytochemistry confirmed increased presence of Ly6G+, CD1 1 b+ and CD3+ FoxP3+ cells in R. ?om/n s-colonized mice (Fig. 5B).
R. hominis flagellins modulate T cell differentiation
The influence of bacteria on the differentiation of T cells may reflect the array of TLR ligands displayed. For example, the coupling between TLR5 signalling and CD4+ T cell responses has recently been demonstrated for flagellate pathogens (Letran ef ai. 2011). Interestingly, depending upon the experimental setting, flagellin can prime a range of T cell responses including Th1 , Th2, Th17 and Treg responses (Wilson ef al. 2012). The functionality of bacterial flagellins FlaAI (RH1) and FlaA2 (RH2) was investigated using novel soluble recombinant flagellin proteins, generated against the unique R. hominis flagellin sequences. The ability of RH1 and RH2 were compared and contrasted with various commensal and pathogenic flagellins, generated using identical protocols, to activate signalling responses in intestinal epithelial cell lines and bone marrow derived dendritic cells expanded with either FLT3L or GM-CSF.
Epithelial cells treated with identical concentrations of different bacterial flagellins revealed distinct patterns of gene expression (Fig. 6A). Importantly, no endotoxin contamination was detected in the recombinant protein preparations. Salmonella enteritidis (SE) was more potent than E. coli K12 (EC) or RH1 flagellin. RH 1 flagellin also showed a strong response but clustered in a distinct clad along with commensal EC. The responses were shown to be TLR5-dependent using epithelial cells expressing dominant-negative TLR5. In contrast, RH2 was shown to be minimally active; it was generally not pro-inflammatory nor did it activate the conserved gene signature (IL-8, CXCL-1 , CXCL-2 and CXCL-10) induced by other recombinant bacterial flagellins. RH1 flagellin protein is more biologically active than RH2 in vitro; although both recombinant proteins were expressed in vivo, RH1 was also significantly up-regulated at the gene expression level in vivo. It was demonstrated that the RH1 flagellin from R. hominis induced different responses in Flt3L and GM-CSF derived dendritic cells relative to commensal E. coli and pathogenic Salmonella enteritidis (Fig. 6B-C). In particular, RH1 was unique in its ability to activate Flt3L-expanded DCs, with up-regulation of l-A/l-E and CD40 and the production of IL-10 by bone marrow derived DCs from both C3H/HeN and C57BI/6 mice. The IL-10/IL-12 ratio was particularly elevated in C57BI/6 DCs (Fig. 6D), which were found to be CD103+ Siglec-H+. Consistent with the observations herein, a number of recent reports have also shown that flagellin can activate CD103+DC populations (Flores- Langarica et al. 2012, Kinnebrew et al. 2012).
To evaluate the functional importance of R. hominis and its flagellins, germ-free TLR5KO and WT mice were mono-colonized. The heatmap showing differentially expressed genes for both TLR5KO and wild-type colonized with R. hominis revealed a very strong effect of TLR5 (Fig S4). Although T cell pathways were still influenced by R. hominis colonization in TLR5KO mice, the responses were more related to IL4, IL5, IL-6, IL-9 pathways and not IL- 10 and CTLA-4 (Table S6). Furthermore, the numbers of double-positive CD3+FoxP3+ cells in the lamina propria of TLR5KO mice were not increased by R. hominis treatment (Fig. 6E), in contrast to mono-associated C3H/HeN and C57BI6 animals (Fig. 5A).
Table S6. Immune system response pathway analysis of transcripts differentially expressed in the ascending colon between TLR5 KO mice and WT mice, mono- colonized with R. hominis. Differentially expressed genes (P<0.05) were imported into GeneGo MetaCore analytical software to determine significantly enriched canonical pathways in each group. * The number of genes on each map that are differentially expressed in the specific treatment comparison. ** The total number of genes on each map. # Maps pValue Ral tio
1 Immune response_IL-9 signaling pathway 0.00001 7 36
2 Immune response Histamine signaling in dendritic ceils 0.00008 7 50
3 Immune response_HMGB1/RAGE signaling pathway 0.00012 7 53
4 Immune response IL-6 signaling pathway 0.00046 5 31
5 Immune response_Histamine H1 receptor signaling in immune 0.00052 6 48 response
6 Immune response_Oncostatin M signaling via MAPK in mouse 0.00082 5 35 cells
7 Immune response_Oncostatin signaling via MAPK in human 0.00107 5 37 cells
8 Signal transduction_JNK pathway 0.00191 5 42
9 Immune response_IL-7 signaling in B lymphocytes 0.00213 5 43
10 Immune response_Signaling pathway mediated by IL-6 and IL-1 0.00362 4 30
1 1 Development GM-CSF signaling 0.00415 5 50
12 Immune response_T cell receptor signaling pathway 0.00492 5 52
13 Chemotaxis Leukocyte chemotaxis 0.00528 6 75
14 Immune response_CCL2 signaling 0.00579 5 54
15 Immune response_CD28 signaling 0.00579 5 54
16 Immune response Role of DAP12 receptors in NK cells 0.00579 5 54
17 Immune response_Fc epsilon Rl pathway 0.00626 5 55
18 Immune response_Role of PKR in stress-induced antiviral cell 0.00728 5 57 response
19 Immune response_HMGB1 release from the cell 0.01 114 4 41
20 Immune response_IL-15 signaling 0.01 176 5 64
21 Immune response_HTR2A-induced activation of cPLA2 0.01313 4 43
22 Immune response_IL-4 signaling pathway 0.01421 4 44
23 Immune response_IL-5 signalling 0.01421 4 44
24 Immune response_Fc gamma R-mediated phagocytosis in 0.01653 4 46 macrophages
25 Immune response_NF-AT signaling and leukocyte interactions 0.01653 4 46
26 Development_PEDF signaling 0.02043 4 49
27 Immune response_IL-2 activation and signaling pathway 0.02043 4 49
28 Immune response_NFAT in immune response 0.02332 4 51
29 Immune response_IL-3 activation and signaling pathway 0.02803 3 31
30 Immune response_BCR pathway 0.02809 4 54
31 Immune response_TLR signaling pathways 0,02809 4 54
32 Immune responsejmmunological synapse formation 0.03727 4 59
33 Immune response_Th17 cell differentiation 0.03836 3 35
34 Immune response_Human NKG2D signaling 0.04722 3 38
The observation herein that R. hominis influences Tregs in conventional and germ-free mice and not in TLR5KO is consistent with reports of flagellin-TLR5 interactions promoting CD4+CD25+Foxp3+ regulatory T cells (Crellin ef al. 2005, Hossain ef al. 2011). Similarly, the ability of a flagellin-ovalbumin fusion protein to suppress IL-4 production by OVA-T-cell receptor CD4(+) T cells via an IL-10 dependent mechanism has recently been described (Schuike ef al. 2011 ) indicating that flagellin can influence the directional differentiation of T cell subsets. In addition, the impact of the TLR5KO on T cells responses driven by R. hominis infers that RH1 (the signalling flagellin) was crucial in mediating the Treg responses and not RH2 (the non-signaling flagellin). Finally, an additional observation was the enhancement of Type I IFN genes in TLR5KO mice (including lfi202b, Ifi203 and lr†4), which suggests that TLR5 signalling may dampen Type I interferon responses.
R. hominis modulates innate immune response genes in both the ileum and colon and attenuates colitis in DSS-treated mice
The DSS mouse model was used to test the therapeutic efficacy of R. hominis, due to the control of inflammatory pathways as well as the positive effects on Treg induction in mono- associated mice. Mice were dosed (~50 μΙ_, 109CFU) daily for a period of 14 days, and given DSS (MW 50kDa, 30g/l) in their drinking water from day 8 onwards. Gene expression of a panel of pro-inflammatory biomarkers showed that untreated DSS mice had strong elevation of all investigated genes compared to wild-type mice, with gene induction ranging from 4- to 49-fold (Fig. 7A). Pro-inflammatory gene induction was significantly lower in R. hominis- treated compared to untreated mice, indicating strong therapeutic benefits of oral administration of R. hominis. Histological analysis showed the presence of severe inflammation in the ascending colon of untreated DSS, while the colonic mucosa of R. hominis-treated animals was normal, with low-level inflammation, consistent with the reduced inflammatory gene expression (Fig 7B and C). R. hominis colonization influences body composition and expression of satiety genes Significant metabolic actions of R. hominis in mono-associated mice were also evident. The GO-processes 'negative regulation of response to food' (GO:0032096), 'negative regulation of appetite' (GO:0032099), and 'regulation of catecholamine secretion' (GO:0050433) were all down-regulated in the ascending colon after colonization with R. hominis (Fig. S5). This data infers that R. hominis exerts a stimulatory effect on host appetite. The genes involved in these processes were Agt, Cartpt, Cc c and Cxcl12, with fold-changes ranging from 2- to 12- fold. Cck, in particular, plays a major role in digestion and satiety as a hunger suppressant. Gcg also showed down-regulation at this gut site. To establish whether these gene changes had physiological relevance in relation to food intake and body composition, dry carcass weight and composition analyses were performed. The dry carcass weights of R. /?om/n/s-associated mice were significantly heavier compared to GF animals, and the differences were most discernible at 14d (Fig. S6A). Further carcass lipid analysis showed that total adiposity was also significantly higher in R. hominis-treated animals at 14d (Fig. S6B). These findings are consistent with recent data revealing the role of Firmicutes in energy harvest through dietary fermentation, but also support the notion that gut bacteria can in fact modulate the brain-gut axis and appetite-regulating hormones. Discussion
The long-term co-evolution of host-microbe mutualism has likely driven the selection of functionally important bacterial species in the gut, the majority of which are not highly represented in other ecosystems. Currently, there is limited information regarding the contribution of individual members of the microbial community to intestinal functions, particularly in relation to development of the mucosal immune system. Recent work using a reversible colonization model based on E. coli (HA 107) has demonstrated that live bacteria are required in numbers approaching 108 CFUs per gram of content for the immune-inducing effects on IgA (Hapfelmeier et al. 2010). The specific functions of SFB and Bacteroides fragilis have been investigated in the mouse gut to define their individual contributions to T cell biology and both these bacteria have been shown to be potent inducers of Tregs and Th17 cells (Mazmanian ef al. 2005, Gaboriau-Routhiau ei ai. 2009, Ivanov et al. 2009). The effects of individual members of the cluster XlVa Firmicutes have not been reported previously, although their presence in the ASF and the contribution of a mixed culture of 46 Clostridial strains, which also affects T cell differentiation has been noted (Geuking et al. 2011 , Atarashi ef al. 2011).
Reported here is the first successful mono-association of the germ-free mouse gut with an anaerobic bacterium, R. hominis, which is a member of the Firmicutes phylum. The extreme oxygen sensitivity of bacteria like Roseburia requires strict anaerobic culture techniques, making it difficult to perform functional characterization. The stable mono-colonization of R. hominis in germfree mice has been established and the complete annotated genomic sequence to uncover its metabolic organization, physiology, and symbiotic properties has been produced. It was found that the transcriptional responses of R. hominis following colonization could be attributed to both the host gut environment and diet. The host-driven effects dominated the response of R. hominis following mono-association. These included gene transfer, membrane transport, chemotaxis and motility subsystems. The strong up- regulation of genes involved in mobilization transfer supports the view that the gut environment is highly conducive to horizontal gene exchange between members of the gut microbiota. Thus, this environment may accelerate the dissemination of genes important for bacterial survival, colonization and function within the gut ecosystem. The role of motility and flagellar apparatus in host colonization is well-elaborated for pathogenic bacteria but much less is known about the role of flagellar proteins in commensal bacteria. In vivo experiments revealed a stimulatory effect of the host intestinal environment on the expression of flagellin genes.
A clear role for R. hominis in promoting gut barrier function and innate immunity in the mouse colon has been established. Tight junctions, gap junctions and adherens junctions operate to limit bacterial translocation to the subepithelial layer (Werth et al. 2010). Both Crohn's disease and ulcerative colitis are characterized by loss of barrier function and tight junction integrity. Interestingly, dysbiosis of the gut microbiota in IBD is associated with a reduction in Firmicutes (Spor, Koren & Ley 2011 , Qin er al. 2010). The observation herein that R. hominis actively enhances the expression of barrier genes suggests that their loss in IBD patients may be functionally significant. Activation of tight junction complexes is not just the prerogative of R. hominis; other commensals, such as Bacteroides thetaiotaomicron and Lactobacillus acidophilus, also enhance mucosal barrier function (Hooper et al. 2001 , Ukena et al. 2007), inferring probiotic opportunities with these bacteria in human IBD. The effects of hominis on the gut immune system are intriguing. The strongest effects were noted in the ascending colon and genes such as Ly6g6c were strongly up-regulated, as well as pathways involved in T cell regulation and differentiation and actin polymerization at the immune synapse, which are implicated in T cell activation and effector functions. The most affected T cell pathways included those related to IL-10, ICOS and CTLA-4, which are all involved in supporting Treg differentiation. Importantly, it has been demonstrated that significant increases in CD3+CD4+CD25+FoxP3+ cells in the colons of germ-free mice and conventional mice colonized with R. hominis using both flow cytometry and immunocytochemistry. These findings complement the recent data on other Clostridium species that drive Treg differentiation. Clearly, R. hominis can as a single bacterial species promote mucosal T cell expansion and impact on T cell differentiation.
Flagellin signals are perceived by host TLR5 receptors and many pathogenic flagellin structures induce strong pro-inflammatory responses (Hayashi et al. 2001). Signalling through TLR5 in response to resident flagellated commensals may be important for homeostasis, since deletion of TLR5 results in spontaneous colitis in mice (Vijay-Kumar et al. 2007). The enhanced expression of R. hominis flagellin FlaA1 (RH1) in vivo and its potency in activating epithelial cells and BMDCs is of great interest. Other work has shown that E. coli flagellin mutants have a colonization advantage over wild-type flagellated strains, possibly due to absence of innate recognition by TLR5 signalling (De Paepe ef al. 2011 , Giraud et al. 2008). Herein it is shown that for certain Firmicutes, the expression or possibly up-regulation of flagellin is a natural response to gut colonization. R. hominis flagellin protein remains expressed in vivo and correlates with sustained colonization, absence of overt inflammation and expansion of T cells of regulatory phenotype. The recent confirmation of flagellin genes in SFB (Prakash ef al. 2011 , Sczesnak ef al. 2011) may correlate with the host T cell responses induced by this bacterium (Gaboriau-Routhiau ef al. 2009, Ivanov et al. 2009). Interestingly, RH1 induced a unique effect on both epithelial and DC cultures compared to other flagellins, although all tested structures possess the conserved Arg90 associated with flagellins that bind and activate TLR5 (Yoon ef al. 2012) suggesting that other sequence/structural differences may account for the unique signalling responses mediated by RH1. The significance of flagellin-TLR5 signalling in Treg responses induced by R. hominis was confirmed using TLR5KO. Without wishing to be bound by theory, certain commensal flagellin structures may help to direct immune tolerance responses through TLR5 expressed on either CD103+DC or Treg subsets (Flores-Langarica et al. 2012, Kinnebrew et al. 2012, Crellin ef al. 2005). Furthermore, the immune homeostatic effect of R. hominis was confirmed in DSS-treated mice, although other signalling moieties, such as butyrate, may also contribute to immune tolerance. This data suggests a potential therapeutic benefit of R. hominis in IBD.
An interesting additional biological effect of R. hominis colonization was the regulation of genes influencing responses to food and control of appetite. In particular, the satiety hormones Cck and Gcg were significantly reduced. The effects of Cck on food intake are mediated via a vagal afferent pathway. This is the major neural pathway by which information about ingested nutrients reaches the central nervous system to influence both gut function and feeding behaviour. Cck acts on the vagal system to decrease expression of molecules that stimulate appetite and feeding, and to increase expression of molecules that inhibit feeding and decrease appetite {Npy2r and Cartpt, both down-regulated two-fold in the current study). No link between Cck, Gcg and commensal bacteria has been reported thus far, however, both fatty acids and proteins are potent inducers of Cck and Gcg (Geraedts ef al. 2010). R. hominis produces short-chain fatty acids such as butyrate with aliphatic tails of less than six carbons; this metabolic activity has been reported to reduce the stimulatory effect on plasma Cck observed with longer chain fatty acids (McLaughlin et al. 1999). Carcass weight analysis revealed that both body weight and lipid content was indeed significantly increased with R. hominis, consistent with body weight increases observed in conventionalization of germfree mice (Turnbaugh ef al. 2006). Whether this is a direct effect of a reduction in satiety hormones as seen in the current study remains to be seen, as the involvement of Cck and Gcg has not been reported previously. However, it is important to acknowledge that a link between microbiota colonization and energy harvest from the diet, in part through release of SCFAs, has been shown previously (Turnbaugh et al. 2006) (Tremaroli, Kovatcheva-Datchary & Backhed 2010). Given that R. hominis is a major butyrate producer, this mechanism is likely also to contribute to the metabolic efficiency observed following R. hominis treatment.
In summary, mono-association of the murine gut with R. hominis induced strong bi-directional gene expression events culminating in commensal bacterial adaptation and host tolerance. The flagellin product RH1 seems to exert a unique signaling effect, which preferentially drives expansion of Tregs. The importance of TLR5 in directing Treg differentiation and expansion has been demonstrated. Collectively, this data highlights additional functionality of commensal flagellins, TLR5 signaling and the net direction of the mucosal T cell response.
Functional Assays
In vitro Model Analysis of the response of intestinal epithelial cells (lECs) to different recombinant flagellins.
Molecular analysis of CCL20 gene expression (a pro-inflammatory gene) after stimulation of lECs to different recombinant flagellins (Figure D.2) pathogenic flagellins (SE, ST, LF, and HM) induced similar but not identical levels of CCL20 mRNA, commensal flagellins displayed much more variable levels of induction. ER (Eubacterium rectale 33656), K12 (Escherichia coli K12), RH1 and RI3 flagellins induced CCL20 at similar levels to pathogenic flagellins, RI and RI4 had intermediate stimulatory activity, RH2 revealed as a low inducer of CCL20 in HT-29 and was devoid of agonistic potential in Caco-2 cells, and RI2 had no observable activity in both cell lines. In conclusion, the inventors distinguished three categories of TLR5 agonists (i) those with no or very low immunostimulatory activity, (ii) those with intermediate immunostimulatory activity and (iii) those with high immunostimulatory activity.
Table D2.
Figure imgf000167_0001
Table D2 indicates significant differences between each treatment calculated with paired t test in HT-29 (upper right) and Caco-2 (lower left). T tests used were unilateral to compare treatments to unstimulated cells (unstim) and bilateral to compare one treatment with another. NS (non significant); *(p<0.05); ** (p<0.01); *** (p<0.001).
Cellular and immunological analysis of the effects of the recombinant flagellins on the lECs was determined by measurement of cytokines, CXCL8, CXCL10 and CCL2 (MCP-1) secreted. I ECS were stimulated for 24hrs with recombinant flagellins (Figure D3).
The flagellins ST, SE, K12, ER, RI3 and RH1 induced the secretion of variable but similar levels of IL-8, IP-10 and MCP-1 chemokines, while RI1 , RI2, RI4 and RH2, especially in Caco-2 behaved as low agonists of TLR5, inducing significantly lower amounts of secreted chemokines.
T
Figure imgf000168_0001
T
Table D3c Table D3d
Figure imgf000168_0002
Tables D3a, D3b, D3c and D3d indicate significant differences between each treatment calculated with paired t test. The upper right side of Table D3a and D3b give t values for IL-8 and the lower left side for IP-10, and Tables D3c and D3d give t values for MCP-1. NS (non significant); *(p<0.05); ** (p<0.01); *** (p<0.001).
As shown in Figure D4, neutralization of TLR5 with an anti-TLR5 specific antibody abolished the flagellin-mediated inflammatory response, independent of the commensal or pathogenic origin of flagellin. Therefore, the pro-inflammatory effects of flagellin observed in Caco-2 cells are dependent on TLR5 activation.
Generation of bone marrow-derived dendritic cells and cultures Bone marrow was harvested from femur and tibia of C3H/HeN and C57BI6 mice. For GMCSF-derived dendritic cells, bone marrow cells were resuspended at 1x10s/mL in RPMI supplemented with 10% FCS and 20ng/ml_ rmGM-CSF and seeded at 10mL/plate in 100mm2 tissue culture plates. After three days culture, loosely adherent cells were collected and replated with GM-CSF supplemented media at 1x106/ml_ in 12 well tissue culture plates. At day 5, cells were stimulated with 100ng/mL flagellins before being harvested on day 6. For Flt3L-derived dendritic cells, bone marrow cells were resuspended at 2x106/mL in RPMI supplemented with 10% FCS and 200ng/mL rmFlt3 and seeded at 2ml_/well in 12-well tissue culture plates. Cells were cultured for 10 days with Flt3 supplemented media added to each well on day 4. At day 9, cells were stimulated with 100ng/mL flagellins before being harvested on day 10 and analyzed by flow cytometry.
Flow Cytometry Analysis of GM-CSF/IL-4 derived dendritic cells (Figure D5) and Flt3L derived dendritic cells (Figure D6) stimulated with recombinant flagellins was carried out. Flagellin Rh1 was most potent at inducing cellular response in GM-CSF/IL-4 derived dendritic cells with Ri4 and Ri3 having a similar response to commensal flagellins K12 and Er and pathogenic flagellins SE and ST. In contrast Rh2, and Ri2 did not induce cellular response with the GM-CSF/IL-4 derived dendritic cells but significantly increase cellular responses to Flt3L derived dendritic cells. These flagellins and in particular Ri1 , are distinctive in their ability to elicit difference in responses with the activation of Flt3L -derived dendritic cells. This response signifies the specificity of the flagellins to a specific subset of dendritic cells. These Flt3L derived dendritic cells are categorised as plasmocytoid dendritic cells which play an important role in immunological tolerance.
In Vivo Model
BOY/J WT and TLR5KO mice were used to evaluate the functional importance of R. hominis and its flagellins. The mice were colonised with R. hominis. The animals were euthanized and intestinal tissue sampling was performed. Small intestine was collected for immunological analysis by flow cytometry.
Flow cytometry analysis of T cell populations, in particular, T regulatory (Treg) cells, in small intestine lamina propria was carried out (figure 6 A and B). The percentage of FoxP3+CD25+ cells in CD4+ T cell population was significantly higher in the BOY/J WT mice in comparison to the TLR5KO mice. This indicates that R. hominis and more specifically the flagellins influences T regs by promoting CD4+ FoxP3+CD25+ regulatory T cells Therefore it can be concluded that flagellins are important in directing host immune response through TLR5 interactions.
SUMMARY CLAUSES The present invention is defined in the claims and the accompanying description. For convenience other aspects of the present invention are presented herein by way of numbered clauses.
1. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in regulating the immune system of a subject.
2. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 1 for use in regulating the adaptive immune system of a subject.
3. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 1 for use in regulating the innate immune system of a subject. 4. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in maintaining immune homeostasis in a subject.
5. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in treating an immune disorder in a subject.
6. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to clause 5, wherein the immune disorder is selected from ulcerative colitis, pouchitis, other autoimmune conditions including rheumatoid arthritis, psoriasis, multiple sclerosis, allergies including coeliac disease, atopic dermatitis and rhinitis. 7. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in treating a disorder selected from an inflammatory disorder, an immune disorder and an intestinal disorder in a subject.
8. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to clause 7, wherein the disorder is selected from irritable bowel syndrome (IBS), colitis, inflammatory bowel disorder (IBD), including Crohn's disease and ulcerative colitis, pouchitis, functional dyspepsia, functional constipation, functional diarrhoea (including antibiotic associated diarrhoea, traveller's diarrhoea and pediatric diarrhoea), functional abdominal pain, functional bloating, Epigastric Pain Syndrome, Postprandial Distress Syndrome, gastrointestinal reflux disease (GERD), autoimmune diseases such as diabetes, arthritis, multiple sclerosis and psoriasis allergies, atopic diseases e.g. atopic dermatitis, necrotising enterocolitis, other infections, and combinations thereof.
9. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in improving intestinal microbiota in a subject.
10. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in regulating appetite in a subject.
1 1. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in promoting gut health in a subject.
12. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in promoting Tregs cells and tolerance mechanisms in the immune system of a subject.
13. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any one of clauses 1 to 12, which regulates the induction and/or expression of at least one mobilization or chemotaxis gene.
14. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to clause 13, which upregulates the expression of at least one mobilization or chemotaxis gene, and wherein said gene is selected from MobA and MobL.
15. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which regulates at least one gene selected from FlaA1, Fla2, FlaA3, and FlaB.
16. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which regulates the expression of at least one of the following: acetyl-CoA acetyltransferase, 3-hydroxyacyl-CoA dehydrogenase, butyryl-CoA dehydrogenase, electron transfer flavoprotein beta subunit, electron transfer flavoprotein alpha subunit.
17. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which downregulates the expression of at least one gene selected from Agt, Cartpt, Cck, Cxcl12 and Gcg.
18. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which activates at least one immune response gene in the colon or ileum. 19. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause, which activates the adaptive immune response by regulating the induction and/or expression of genes associated with T-cell regulation.
20. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause which upregulates expression of at least one gene selected from Ly6g6c and Ly6g6e in the ascending colon.
21. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to any preceding clause which regulates the expression of at least one gene selected from Tlr5, Tlr1, Vnn1, Defb37, Pla2g, Muc16, Itln, Sprrla, Cldn4, Pmp22, Crb3, Magi3, Marveld3, Mpp7, Defcr20, Pcgf2, Ltbp4, Igsf8 and 7cfe2a.
22. Use of Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, in the preparation of a medicament for regulating the immune system of a subject.
23. Use of Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 22 in the preparation of a medicament for regulating the innate immune system of a subject.
24. Use of Roseburia (such as a bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or the polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, according to clause 22 in the preparation of a medicament for regulating the adaptive immune system of a subject. 25. Use of Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or a polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, in the preparation of a medicament for maintaining immune homeostasis in a subject.
26. Use of Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, in the preparation of a medicament for treating an immune disorder in a subject. 27. A method of regulating the immune system of a subject, said method comprising administering to the subject a composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
28. A method of activating the innate immune system of a subject, said method comprising administering to the subject a composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
29. A method of activating the adaptive immune system of a subject, said method comprising administering to the subject a composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
30. A method of treating an immune disorder in a subject, said method comprising administering to the subject a pharmaceutically effective amount of Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence. 31. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence for use according to any one of clauses 1 to 21 , or a method according to any one of clauses 27 to 30, or a use according to any one of clauses 22 to 26, wherein the subject is a mammal.
32. Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, for use in medicine. 33. A pharmaceutical composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and a pharmaceutically acceptable excipient, carrier or diluent.
34. A nutritional supplement comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence, and a nutritionally acceptable excipient, carrier or diluent.
35. A probiotic composition comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
36. A feedstuff, food product, dietary supplement, nutritional supplement or food additive comprising Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or polypeptide FlaA1 , and/or a polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or a vector comprising said polynucleotide sequence, and/or a host cell comprising said vector, and/or a host cell comprising said polynucleotide sequence.
37. A process for producing a pharmaceutical composition according to clause 32, said process comprising admixing Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flageilin, and/or a polynucleotide encoding said Roseburia flageilin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, with a pharmaceutically acceptable excipient, carrier or diluent.
38. A process for producing a nutritional supplement according to clause 33, said process comprising admixing Roseburia (such as the bacterial species Roseburia hominis, or the bacterial species Roseburia intestinalis), and/or the polypeptide FlaA1 , and/or the polynucleotide sequence encoding said polypeptide, and/or Roseburia flagellin, and/or a polynucleotide encoding said Roseburia flagellin, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, with a nutritionally acceptable excipient, carrier or diluent.
SUMMARY PARAGRAPHS
For convenience other aspects of the present invention are presented herein by way of numbered paragraphs.
1 . Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in modulating the inflammation of a tissue or an organ in a subject.
2. The polypeptide or the polynucleotide according to paragraph 1 wherein said polypeptide or polynucleotide reduces the inflammation of the tissue or the organ.
3. The polypeptide or the polynucleotide according to paragraph 2 wherein said polypeptide or polynucleotide reduces the inflammation by epithelial cells of the tissue or the organ. 4. The polypeptide or the polynucleotide according to paragraph 3 wherein said epithelial cells are epithelial cells of the alimentary canal.
5. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in modulating the production of T cells in a subject; preferably, the polypeptide or the polynucleotide increases the production of T regulatory cells in a subject.
6. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in restoring immunological tolerance. 7. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the immune system and restoring immunological tolerance of a subject.
8. The polypeptide or the polynucleotide according to paragraph 7 for use in regulating the adaptive immune system of a subject.
9. The polypeptide or the polynucleotide according to paragraph 7 for use in regulating the innate immune system of a subject. 10. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in treating a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
11. The polypeptide or the polynucleotide according to paragraph 10 wherein said disorder affects the alimentary canal or a section thereof of said subject.
12. The polypeptide or the polynucleotide according to paragraph 10 wherein said disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes, coeliac disease, atopic dermatitis, rhinitis, irritable bowel syndrome (IBS), colitis, inflammatory bowel disorder (IBD), ulcerative colitis, pouchitis, Crohn's disease, functional dyspepsia, atopic diseases, necrotising enterocolitis, and combinations thereof. 13. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in modulating dendritic cells and/or epithelial cells in a tissue or an organ of a subject.
14. The polypeptide or the polynucleotide according to paragraph 13 wherein said polypeptide or polynucleotide activates dendritic cells and/or epithelial cells.
15. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the production of IL-10 and/or TGF in a cell or cells of a subject.
16. The polypeptide or the polynucleotide according to paragraph 15 wherein the production of IL-10 is by dendritic cells.
17. The polypeptide or the polynucleotide according to paragraph 15 or 16 wherein said polypeptide or polynucleotide upregulates the production of IL-10 and/or TGF . 18. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the production of CD40 and/or l-A/l-E in a cell or cells of a subject.
19. The polypeptide or the polynucleotide according to paragraph 18 wherein the production of CD40 and/or l-A/l-E is by dendritic cells.
20. The polypeptide or the polynucleotide according to paragraph 18 or 19 wherein said polypeptide or polynucleotide upregulates the production CD40 and/or l-A/l-E. 21. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the expression of one or more Type I IFN genes in a cell or cells of a subject. 22. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the expression of one or more pro-inflammatory genes in a cell or cells of a subject.
23. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in improving intestinal microbiota in a subject.
24. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating appetite in a subject. 25. The polypeptide or polynucleotide according to paragraph 24 wherein said polypeptide or polynucleotide stimulates the appetite in the subject.
26. The polypeptide or polynucleotide according to paragraph 24 or 25 wherein the level of cholecystokinin (Cck) and/or glucagon (Gcg) is reduced in the blood of a subject.
27. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in regulating the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject. 28. Polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for use in improving alimentary canal health in a subject.
29. The polypeptide or polynucleotide according to any one of paragraphs 1 to 28 wherein said polypeptide or polynucleotide is encapsulated.
30. A pharmaceutical composition comprising polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and a pharmaceutically acceptable excipient, carrier or diluent. 31. The pharmaceutical composition according to paragraph 30 wherein said polypeptide or polynucleotide is encapsulated. 32. A nutritional supplement comprising polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and a nutritional acceptable excipient, carrier or diluent.
33. The nutritional supplement according to paragraph 32 wherein said polypeptide or polynucleotide is encapsulated.
34. A feedstuff, food product, dietary supplement, or food additive comprising polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide. 35. The feedstuff, food product, dietary supplement, or food additive according to paragraph 34 wherein said feedstuff, food product, dietary supplement, or food additive is encapsulated.
36. A process for producing a pharmaceutical composition according to paragraph 30, said process comprising admixing said polypeptide or polynucleotide with a pharmaceutically acceptable excipient, carrier or diluent; optionally said polypeptide or polynucleotide is encapsulated.
37. A process for producing a nutritional supplement according to paragraph 32, said process comprising admixing said polypeptide or polynucleotide with a nutritionally acceptable excipient, carrier or diluent; optionally said polypeptide or polynucleotide is encapsulated.
38. A method of modulating the inflammation of a tissue or an organ in a subject, said method comprising administering to the subject polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, and wherein the inflammation of the tissue or organ in the subject is modulated.
39. A method of modulating the production of T cells in a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, and wherein the production of T cells in the subject is modulated, in particular T regulatory cells.
40. A method of regulating the immune system of a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, and wherein the immune system of the subject is regulated.
A method of treating a disorder in a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
42. A method of modulating dendritic cells and/or epithelial cells in a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, and wherein dendritic cells and/or epithelial cells in the subject are modulated.
43. A method of regulating the production of IL-10 and/or TGF in a cell or cells of a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide to the subject, and wherein the production of IL-10 and/or TGF3 in a cell or cells of the subject is regulated.
44. A method of regulating the production of CD40 and/or l-A/l-E in a cell or cells of a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide to the subject, and wherein the production of CD40 and/or l-A l-E in a cell or cells of the subject is regulated.
45. A method of regulating the expression of one of more Type I IFN genes in a cell or cells of a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide wherein the expression of one of more Type I IFN genes in a cell or cells of the subject is regulated.
46. A method of regulating the expression of one or more pro-inflammatory genes in a cell or cells of a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, wherein the expression of one or more pro-inflammatory genes in a cell or cells of the subject is regulated.
47. A method of improving intestinal microbiota in a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and wherein the intestinal microbiota in a subject is improved.
48. A method of regulating appetite in a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and wherein the appetite in the subject is regulated.
49. A method of regulating the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and wherein the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of the subject is regulated.
50. A method of improving alimentary canal health in a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide, and wherein alimentary canal health in a subject is improved. 51. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for modulating the inflammation of a tissue or an organ in a subject.
52. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for modulating the production of T cells in a subject.
53. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for regulating the immune system of a subject. 54. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for the treatment of a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
55. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for modulating dendritic cells and/or epithelial cells in a tissue or an organ of a subject.
56. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for regulating the production of IL-10 and/or TGFp in a cell or cells of a subject.
57. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for regulating the production of CD40 and/or l-A/l-E in a cell or cells of a subject.
58. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for regulating the expression of one of more Type I IFN genes in a cell or cells of a subject.
59. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for regulating the expression of one or more proinflammatory genes in a cell or cells of a subject.
60. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for improving intestinal microbiota in a subject. 61. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for regulating appetite in a subject.
62. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for regulating the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
63. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for improving alimentary canal health in a subject.
64. Use of polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide for the manufacture of a medicament for restoring immunological tolerance in a subject.
65. A method of restoring immunological tolerance in a subject, said method comprising administering polypeptide FlaA1 or a polynucleotide sequence encoding said polypeptide and wherein the immunological tolerance in a subject is restored.
REFERENCES
Aminov, R.I., Walker, A.W., Duncan, S.H. , Harmsen, H.J., Welling, G.W. & Flint, H.J. 2006, "Molecular diversity, cultivation, and improved detection by fluorescent in situ hybridization of a dominant group of human gut bacteria related to Roseburia spp. or Eubacterium rectale",
Applied and Environmental Microbiology, vol. 72, no. 9, pp. 6371 -6376.
Atarashi, K., Tanoue, T., Shima, T., Imaoka, A., Kuwahara, T., Momose, Y., Cheng, G.,
Yamasaki, S., Saito, T., Ohba, Y., Taniguchi, T., Takeda, K., Hori, S., Ivanov, 1.1., Umesaki, Y., Itoh, K. & Honda, K. 201 1 , "Induction of colonic regulatory T cells by indigenous
Clostridium species", Science (New York, N. Y.), vol. 331 , no. 6015, pp. 337-341.
Berg, D.J., Davidson, N., Kuhn, R., Muller, W., enon, S., Holland, G., Thompson-Snipes, L, Leach, M.W. & Rennick, D. 1996, "Enterocolitis and colon cancer in interleukin-10-deficient mice are associated with aberrant cytokine production and CD4(+) TH1 -like responses", The Journal of clinical investigation, vol. 98, no. 4, pp. 1010-1020.
Chung, H. & Kasper, D.L. 2010, "Microbiota-stimulated immune mechanisms to maintain gut homeostasis", Current opinion in immunology, vol. 22, no. 4, pp. 455-460.
Crellin, N.K., Garcia, R.V., Hadisfar, O., Allan, S.E., Steiner, T.S. & Levings, M.K. 2005, "Human CD4+ T cells express TLR5 and its ligand flagellin enhances the suppressive capacity and expression of FOXP3 in CD4+CD25+ T regulatory cells", Journal of immunology (Baltimore, Md.: 1950), vol. 175, no. 12, pp. 8051-8059.
De Paepe, M., Gaboriau-Routhiau, V., Rainteau, D., Rakotobe, S., Taddei, F. & Cerf-
Bensussan, N. 20 1 , "Trade-off between bile resistance and nutritional competence drives Escherichia coli diversification in the mouse gut", PLoS genetics, vol. 7, no. 6, pp. e1002107. Duck, L.W., Walter, M.R., Novak, J. , Kelly, D„ Tomasi, M., Cong, Y. & Elson, CO. 2007, "Isolation of flagellated bacteria implicated in Crohn's disease", Inflammatory bowel diseases, vol. 13, no. 10, pp. 1191-1201.
Duncan, S.H., Aminov, R.I., Scott, K.P., Louis, P., Stanton, T.B. & Flint, H.J. 2006, "Proposal of Roseburia faecis sp. nov., Roseburia hominis sp. nov. and Roseburia inulinivorans sp. nov., based on isolates from human faeces", International Journal of Systematic and
Evolutionary Microbiology, vol. 56, no. Pt 10, pp. 2437-2441.
Eckburg, P.B., Bik, E.M., Bernstein, C.N., Purdom, E., Dethlefsen, L, Sargent, M., Gill, S.R., Nelson, K.E. & Relman, D.A. 2005, "Diversity of the human intestinal microbial flora", Science (New York, N. Y.), vol. 308, no. 5728, pp. 1635-1638.
Flores-Langarica, A., Marshall, J.L., Hitchcock, J., Cook, C, Jobanputra, J., Bobat, S., Ross,
E.A., Coughlan, R.E., Henderson, I.R., Uematsu, S., Akira, S. & Cunningham, A.F. 2012, "Systemic flagellin immunization stimulates mucosal CD103+ dendritic cells and drives
Foxp3+ regulatory T CELL and IgA responses in the mesenteric lymph node", Journal of immunology (Baltimore, Md.: 1950), vol. 189, no. 12, pp. 5745-5754.
Frank, D.N., St Amand, A.L., Feldman, R.A., Boedeker, E.C., Harpaz, N. & Pace, N.R. 2007,
"Molecular-phylogenetic characterization of microbial community imbalances in human inflammatory bowel diseases", Proceedings of the National Academy of Sciences of the
United States of America, vol. 104, no. 34, pp. 13780-13785.
Gaboriau-Routhiau, V., Rakotobe, S., Lecuyer, E., Mulder, I., Lan, A., Bridonneau, C, Rochet, V., Pisi, A., De Paepe, M., Brandi, G., Eberl, G., Snel, J., Kelly, D. & Cerf- Bensussan, N. 2009, "The key role of segmented filamentous bacteria in the coordinated maturation of gut helper T cell responses", Immunity, vol. 31 , no. 4, pp. 677-689.
Geraedts, M.C., Troost F.J., Tinnemans, R., Soderholm, J.D., Brummer, R.J. & Saris, W.H. 2010, "Release of satiety hormones in response to specific dietary proteins is different between human and murine small intestinal mucosa", Annals of Nutrition & Metabolism, vol. 56, no. 4, pp. 308-313.
Geuking, M.B., Cahenzli, J. , Lawson, MA , Ng, D.C. , Slack, E., Hapfelmeier, S. , McCoy, K.D. & Macpherson, A.J. 201 1 , "Intestinal bacterial colonization induces mutualistic regulatory T cell responses", Immunity, vol. 34, no. 5, pp. 794-806.
Giraud, A., Arous, S., De Paepe, M., Gaboriau-Routhiau, V., Bambou, J.C., Rakotobe, S. , Lindner, A.B., Taddei, F. & Cerf-Bensussan, N. 2008, "Dissecting the genetic components of adaptation of Escherichia coli to the mouse gut", PLoS genetics, vol. 4, no. 1 , pp. e2.
Hapfelmeier, S., Lawson, M.A., Slack, E., Kirundi, J.K. , Stoel, M., Heikenwalder, M. ,
Cahenzli, J., Velykoredko, Y., Balmer, M.L., Endt, K. , Geuking, M.B. , Curtiss, R.,3rd, McCoy, K.D. & Macpherson, A.J. 2010, "Reversible microbial colonization of germ-free mice reveals the dynamics of IgA immune responses", Science (New York, N. Y.), vol. 328, no. 5986, pp. 1705-1709.
Hayashi, F., Smith, K. D. , Ozinsky, A., Hawn, T. R., Yi, E.C., Goodlett, D.R. , Eng, J.K., Akira, S., Underhill, D.M. & Aderem, A. 2001 , "The innate immune response to bacterial flagellin is mediated by Toll-like receptor 5", Nature, vol. 410, no. 6832, pp. 1099- 103.
Hooper, L.V., Wong, M.H. , Thelin, A., Hansson, L, Falk, P.G. & Gordon, J.I. 2001 ,
"Molecular analysis of commensal host-microbial relationships in the intestine", Science (New York, N. Y.), vol. 291 , no. 5505, pp. 881 -884.
Hossain, M.S. , Jaye, D.L., Pollack, B.P. , Farris, A.B., Tselanyane, M.L. , David, E., Roback, J.D., Gewirtz, A.T. & Waller, E.K. 2011 , "Flagellin, a TLR5 agonist, reduces graft-versus-host disease in allogeneic hematopoietic stem cell transplantation recipients while enhancing antiviral immunity", Journal of immunology (Baltimore, Md.: 1950), vol. 187, no. 10, pp. 5130- 5140.
Ivanov, 1.1., Atarashi, K., Manel, N„ Brodie, E L , Shima, T, Karaoz, U., Wei, D., Goldfarb, K.C., Santee, C.A., Lynch, S.V., Tanoue, T, Imaoka, A. , Itoh, K., Takeda, K., Umesaki, Y. , Honda, K. & Liftman, D.R. 2009, "Induction of intestinal Th 17 cells by segmented filamentous bacteria", Cell, vol. 139, no. 3, pp. 485-498.
Kang, S. , Denman, S.E., Morrison, M. , Yu, Z., Dore, J., Leclerc, M. & McSweeney, C.S. 2010, "Dysbiosis of fecal microbiota in Crohn's disease patients as revealed by a custom phylogenetic microarray", Inflammatory bowel diseases, vol. 16, no. 12, pp. 2034-2042. Kelly, D., Campbell, J. I., King, TP., Grant, G., Jansson, E.A., Coutts, A.G., Pettersson, S. & Conway, S. 2004, "Commensal anaerobic gut bacteria attenuate inflammation by regulating nuclear-cytoplasmic shuttling of PPAR-gamma and RelA", Nature immunology, vol. 5, no. 1 , pp. 104-1 12.
Kinnebrew, M.A. , Buffie, C.G., Diehl, G. E., Zenewicz, LA, Leiner, I., Hohl, T.M., Flavell, RA , Littman, D. R. & Pamer, E.G. 2012, "Interleukin 23 production by intestinal CD103(+)CD11 b(+) dendritic cells in response to bacterial flagellin enhances mucosal innate immune defense", Immunity, vol. 36, no. 2, pp. 276-287.
Letran, S.E., Lee, S.J., Atif, S.M., Flores-Langarica, A., Uematsu, S., Akira, S., Cunningham, A.F. & McSorley, S.J. 2011 , "TLR5-deficient mice lack basal inflammatory and metabolic defects but exhibit impaired CD4 T cell responses to a flagellated pathogen", Journal of immunology (Baltimore, Md.: 1950), vol. 186, no. 9, pp. 5406-5412.
Machiels K., Joossens M., Sabino J., De Preter V., Arijs I., Ballet V., Claes K., Verhaegen J., Van Assche G., Rutgeerts P. & Vermeire S. 2013, "Predominant dysbiosis in patients with ulcerative colitis is different from Crohn's disease patients", Inflammatory Bowel Diseases. 8th Congress of ECCO, Feb 14-16, 2013.
Macpherson, A.J. 2006, "IgA adaptation to the presence of commensal bacteria in the intestine", Current topics in microbiology and immunology, vol. 308, pp. 1 17-136.
Macpherson, A.J., Hunziker, L, McCoy, K. & Lamarre, A. 2001 , "IgA responses in the intestinal mucosa against pathogenic and non-pathogenic microorganisms", Microbes and infection / Institut Pasteur, vol. 3, no. 12, pp. 1021 -1035.
Macpherson, A.J., Martinic, M.M. & Harris, N. 2002, "The functions of mucosal T cells in containing the indigenous commensal flora of the intestine", Cellular and molecular life sciences : CMLS, vol. 59, no. 12, pp. 2088-2096.
Mahowald, M.A., Rey, F.E., Seedorf, H., Turnbaugh, P. J., Fulton, R.S., Wollam, A., Shah, N., Wang, C, Magrini, V., Wilson, R.K., Cantarel, B.L., Coutinho, P.M., Henrissat, B., Crock, L.W., Russell, A., Verberkmoes, N.C., Hettich, R.L. & Gordon, J.I. 2009, "Characterizing a model human gut microbiota composed of members of its two dominant bacterial phyla", Proceedings of the National Academy of Sciences of the United States of America, vol. 106, no. 14, pp. 5859-5864.
Mallya, M., Campbell, R.D. & Aguado, B. 2006, "Characterization of the five novel Ly-6 superfamily members encoded in the MHC, and detection of cells expressing their potential ligands", Protein science : a publication of the Protein Society, vol. 15, no. 10, pp. 2244- 2256.
Mazmanian, S.K., Liu, C.H., Tzianabos, A.O. & Kasper, D.L. 2005, "An immunomodulatory molecule of symbiotic bacteria directs maturation of the host immune system", Cell, vol. 122, no. 1 , pp. 107-118.
McLaughlin, J., Grazia Luca, M., Jones, M.N., D'Amato, M., Dockray, G.J. & Thompson, D.G. 1999, "Fatty acid chain length determines cholecystokinin secretion and effect on human gastric motility", Gastroenterology, vol. 1 16, no. 1 , pp. 46-53.
Monteleone, I., Piatt, A.M., Jaensson, E., Agace, W.W. & Mowat, A.M. 2008, "IL-10- dependent partial refractoriness to Toll-like receptor stimulation modulates gut mucosal dendritic cell function", European journal of immunology, vol. 38, no. 6, pp. 1533-1547. Nutsch, K.M. & Hsieh, C.S. 2012, "T cell tolerance and immunity to commensal bacteria", Current opinion in immunology, vol. 24, no. 4, pp. 385-391 .
Prakash, T., Oshima, K., Morita, H., Fukuda, S., Imaoka, A., Kumar, N. , Sharma, V.K., Kim, S.W., Takahashi, M., Saitou, N., Taylor T.D., Ohno, H. , Umesaki, Y. & Hattori, M. 201 1 , "Complete genome sequences of rat and mouse segmented filamentous bacteria, a potent inducer of th17 cell differentiation", Cell host & microbe, vol. 10, no. 3, pp. 273-284.
Qin, J., Li, R., Raes, J., Arumugam, M. , Burgdorf, K.S., Manichanh, C, Nielsen, T., Pons, N., Levenez, F., Yamada, T. , Mende, D.R., Li, J. , Xu, J., Li, S., Li, D., Cao, J., Wang, B. , Liang, H., Zheng, H., Xie, Y., Tap, J., Lepage, P., Bertalan, M., Batto, J.M., Hansen, T., Le Paslier, D., Linneberg, A., Nielsen, H.B., Pelletier, E., Renault, P. , Sicheritz-Ponten, T., Turner, K., Zhu, H., Yu, C , Li, S., Jian, M., Zhou, Y., Li, Y., Zhang, X. , Li, S., Qin, N., Yang, H., Wang, J., Brunak, S., Dore, J. , Guarner, F. , Kristiansen, K., Pedersen, O., Parkhill, J., Weissenbach, J., MetaHIT Consortium, Bork, P., Ehrlich, S. D. & Wang, J. 2010, "A human gut microbial gene catalogue established by metagenomic sequencing", Nature, vol. 464, no. 7285, pp. 59-65.
Round, J.L., Lee, S.M., Li, J. , Tran, G., Jabri, B., Chatila, T.A. & Mazmanian, S.K. 201 1 , "The Toll-like receptor 2 pathway establishes colonization by a commensal of the human microbiota", Science (New York, N. Y.), vol. 332, no. 6032, pp. 974-977.
Scanlan, P.D., Shanahan, F. , O'Mahony, C. & Marchesi, J.R. 2006, "Culture-independent analyses of temporal variation of the dominant fecal microbiota and targeted bacterial subgroups in Crohn's disease", Journal of clinical microbiology, vol. 44, no. 1 1 , pp. 3980- 3988.
Schuike, S., Burggraf, M., Waibler, Z., Wangorsch, A, , Wolfheimer, S. , Kalinke, U., Vieths, S., Toda, M. & Scheurer, S. 201 1 , "A fusion protein of flagellin and ovalbumin suppresses the TH2 response and prevents murine intestinal allergy", The Journal of allergy and clinical immunology, vol. 128, no. 6, pp. 1340-1348. e12.
Sczesnak, A., Segata, N., Qin, X., Gevers, D., Petrosino, J.F., Huttenhower, C, Littman, D.R.
& Ivanov, I .I . 201 1 , "The genome of th17 cell-inducing segmented filamentous bacteria reveals extensive auxotrophy and adaptations to the intestinal environment", Cell host & microbe, vol. 10, no. 3, pp. 260-272.
Spor, A., Koren, O. & Ley, R. 201 1 , "Unravelling the effects of the environment and host genotype on the gut microbiome", Nature reviews.Microbiology, vol. 9, no. 4, pp. 279-290.
Tremaroli, V., Kovatcheva-Datchary, P. & Backhed, F. 2010, "A role for the gut microbiota in energy harvesting?", Gut, vol. 59, no. 12, pp. 1589-1590.
Turnbaugh, P.J., Backhed, F. , Fulton, L. & Gordon, J. I. 2008, "Diet-induced obesity is linked to marked but reversible alterations in the mouse distal gut microbiome", Cell host & microbe, vol. 3, no. 4, pp. 213-223. Turnbaugh, P.J., Ley, R.E., Mahowald, M.A., Magrini, V., Mardis, E.R. & Gordon, J.I. 2006, "An obesity-associated gut microbiome with increased capacity for energy harvest", Nature, vol. 444, no. 7122, pp. 1027-1031.
Ukena, S.N., Singh, A, Dringenberg, U., Engelhardt, R., Seidler, U., Hansen, W., Bleich, A., Bruder, D., Franzke, A., Rogler, G., Suerbaum, S., Buer, J., Gunzer, F. & Westendorf, A.M. 2007, "Probiotic Escherichia coli Nissle 1917 inhibits leaky gut by enhancing mucosal integrity", PloS one, vol. 2, no. 12, pp. e1308.
Vijay-Kumar, M., Sanders, C.J., Taylor, R.T., Kumar, A, Aitken, J.D., Sitaraman, S.V., Neish, A.S., Uematsu, S., Akira, S., Williams, I.R. & Gewirtz, AT. 2007, "Deletion of TLR5 results in spontaneous colitis in mice", The Journal of clinical investigation, vol. 1 17, no. 12, pp. 3909- 3921.
Werth, M., Walentin, K., Aue, A., Schonheit, J., Wuebken, A., Pode-Shakked, N.,
Vilianovitch, L., Erdmann, B., Dekel, B., Bader, M., Barasch, J., Rosenbauer, F., Luft, F.C. & Schmidt-Ott, K.M. 2010, "The transcription factor grainyhead-like 2 regulates the molecular composition of the epithelial apical junctional complex", Development (Cambridge, England), vol. 137, no. 22, pp. 3835-3845.
Wilson, R.H., aruoka, S., Whitehead, G.S., Foley, J.F., Flake, G.P., Sever, .L., Zeldin, D C, Kraft, M., Garantziotis, S., Nakano, H. & Cook, D.N. 2012, "The Toll-like receptor 5 ligand flagellin promotes asthma by priming allergic responses to indoor allergens", Nature medicine, vol. 18, no. 11 , pp. 1705-1710.
Yoon, S.I., Kurnasov, O., Natarajan, V., Hong, M., Gudkov, A.V., Osterman, A.L. & Wilson, I.A. 2012, "Structural basis of TLR5-flagellin recognition and signaling", Science (New York, N. Y.), vol. 335, no. 6070, pp. 859-864.
Reference List for Supplementary Information
(1 ) Genome sequence assembly using trace signals and additional sequence information. Computer Science and Biology: Proceedings of the German Conference on Bioinformatics (GCB); 1999.
(2) Aziz RK, Bartels D, Best AA, DeJongh M, Disz T, Edwards RA, et al. The RAST Server: rapid annotations using subsystems technology. BMC Genomics 2008 Feb 8;9:75-2164-9- 75.
(3) Dennis G,Jr, Sherman BT, Hosack DA, Yang J, Gao W, Lane HC, et al. DAVID: Database for Annotation, Visualization, and Integrated Discovery. Genome Biol 2003;4(5):P3.
(4) Untergasser A, Nijveen H, Rao X, Bisseling T, Geurts R, Leunissen JA. Primer3Plus, an enhanced web interface to Primer3. Nucleic Acids Res 2007 Jul;35(Web Server issue):W71- 4.
(5) Duck LW, Walter MR, Novak J, Kelly D, Tomasi M, Cong Y, et al. Isolation of flagellated bacteria implicated in Crohn's disease. Inflamm Bowel Dis 2007 Oct;13(10):1191-1201. (6) Berg DJ, Davidson N, Kuhn R, Muller W, Menon S, Holland G, Thompson-Snipes L, Leach MW, Rennick D. Enterocolitis and colon cancer in interleukin-10-deficient mice are associated with aberrant cytokine production and CD4(+) TH1-like responses. J. Clin. Invest., 1996, 98, 4, 1010-1020.
(7) Monteleone I, Piatt AM, Jaensson E, Agace WW, Mowat AM. IL-10-dependent partial refractoriness to Toll-like receptor stimulation modulates gut mucosal dendritic cell function. Eur J Immunol. 2008 38(6): 1533-47
(8) Inaba K, Inaba M, Romani N, Aya H, Deguchi M, Ikehara S, ef al. Generation of large numbers of dendritic cells from mouse bone marrow cultures supplemented with
granulocyte/macrophage colony-stimulating factor. J Exp Med 1992 Dec 1 ;176(6): 1693- 1702.
(9) Brasel K, De Smedt T, Smith JL, Maliszewski CR. Generation of murine dendritic cells from flt3-ligand-supplemented bone marrow cultures. Blood 2000 Nov 1 ;96(9):3029-3039.
(10) Weigel BJ, Nath N, Taylor PA, Panoskaltsis-Mortari A, Chen W, Krieg AM, ef al.
Comparative analysis of murine marrow-derived dendritic cells generated by Flt3L or GM- CSF/IL-4 and matured with immune stimulatory agents on the in vivo induction of
antileukemia responses. Blood 2002 Dec 1 ; 100(12):4169-4176.
(10) Xu Y, Zhan Y, Lew AM, Naik SH, Kershaw MH. Differential development of murine dendritic cells by GM-CSF versus Flt3 ligand has implications for inflammation and trafficking. J Immunol 2007 Dec 1 ;179(1 1):7577-7584.
(12) Olivera L, Canul RR, Pereira-Pacheco F, Cockburn J, Soldani F, McKenzie NH, ef al. Nutritional and physiological responses of young growing rats to diets containing raw cowpea seed meal, protein isolate (globulins), or starch. J Agric Food Chem 2003 Jan 1 ;51 (1 ):319- 325.
All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in biochemistry and molecular biology or related fields are intended to be within the scope of the following claims.

Claims

1. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in modulating the inflammation of a tissue or an organ in a subject.
2. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for the use according to claim 1 wherein said Roseburia flagellin is selected from the group consisting of:
polypeptides having at least 75% identity to SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID NO 12 or variants, homologues, fragments or derivatives thereof and combinations thereof;
and wherein the polynucleotide sequence encoding said Roseburia flagellin is selected from the group consisting of:
polynucleotide sequences encoding a polypeptide having at least 75% identity to
SEQ ID NO 2, SEQ ID NO 4, SEQ ID NO 6, SEQ ID NO 8, SEQ ID NO 10 or SEQ ID
NO 12 or variants, homologues, fragments or derivatives thereof;
polynucleotide sequences having at least 75% identity to SEQ ID NO 1 , SEQ ID NO
3, SEQ ID NO 5, SEQ ID NO 7, SEQ ID NO 9 or SEQ ID NO 11 or variants, homologues, fragments or derivatives thereof;
and combinations thereof.
3. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 1 or 2 wherein said Roseburia flagellin, and/or polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell comprising including bacteria said polynucleotide sequence, reduces the inflammation of the tissue or the organ.
4. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 3 wherein said Roseburia flagellin, and/or polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, reduces the inflammation by epithelial cells of the tissue or the organ.
5. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to claim 4 wherein said epithelial cells are epithelial cells of the alimentary canal.
6. Roseburia flagellin, or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in modulating the production of T cells in a subject; preferably, the Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, increases the production of T regulatory cells in a subject.
7. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in restoring immunological tolerance.
8. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in regulating the immune system and restoring immunological tolerance of a subject.
9. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 8 for use in regulating the adaptive immune system of a subject.
10. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 8 for use in regulating the innate immune system of a subject.
1 1. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in treating a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
12. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 1 1 wherein said disorder affects the alimentary canal or a section thereof of said subject.
13. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 1 1 wherein said disorder is selected from the group consisting of rheumatoid arthritis, psoriasis, multiple sclerosis, type I diabetes, coeliac disease, atopic dermatitis, rhinitis, irritable bowel syndrome (IBS), colitis, inflammatory bowel disorder (IBD), ulcerative colitis, pouchitis, Crohn's disease, functional dyspepsia, atopic diseases, necrotising enterocolitis, and combinations thereof.
14. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in modulating dendritic cells and/or epithelial cells in a tissue or an organ of a subject.
15. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 14 wherein said Roseburia flagellin, and/or polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, activates dendritic cells and/or epithelial cells.
16. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in regulating the production of IL-10 and/or TGF in a cell or cells of a subject.
17. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 16 wherein the production of IL-10 is by dendritic cells.
18. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 16 or 17 wherein said Roseburia flagellin, and/or polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, upregulates the production of IL-10 and/or TGF .
19. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject.
20. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 9 wherein the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent is by dendritic cells.
21. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 19 or 20 wherein said Roseburia flagellin, and/or polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, upregulates the production of CD40 and/or l-A/l-E.
22. Rosebuha flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in regulating the expression of one or more Type I IFN genes in a cell or cells of a subject.
23. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in regulating the expression of one or more proinflammatory genes in a cell or cells of a subject.
24. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in improving intestinal microbiota in a subject.
25. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in regulating appetite in a subject.
26. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell comprising said vector, and/or the host cell comprising said polynucleotide sequence, for use according to claim 24 wherein said Roseburia flagellin, and/or polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, stimulates the appetite in the subject.
27. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, for use according to claim 25 or 26 wherein the level of cholecystokinin (Cck) and/or glucagon (Gcg) is reduced in the blood of a subject.
28. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in regulating the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
29. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for use in improving alimentary canal health in a subject.
30. The Roseburia flagellin, and/or the polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, according to any one of claims 1 to 29 wherein said Roseburia flagellin and/or polynucleotide sequence, and/or the vector, and/or the host cell, including bacteria, comprising said vector, and/or the host cell, including bacteria, comprising said polynucleotide sequence, is encapsulated.
31. A pharmaceutical composition comprising Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and a pharmaceutically acceptable excipient, carrier or diluent.
32. The pharmaceutical composition according to claim 31 wherein said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell, including bacteria, comprising said vector, and/or said host cell, including bacteria, comprising said polynucleotide sequence, is encapsulated.
33. A nutritional supplement comprising Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and a nutritional acceptable excipient, carrier or diluent.
34. The nutritional supplement according to claim 33 wherein said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell, including bacteria, comprising said vector, and/or said host cell, including bacteria, comprising said polynucleotide sequence, is encapsulated.
35. A feedstuff, food product, dietary supplement, or food additive comprising a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence.
36. The feedstuff, food product, dietary supplement, or food additive according to claim 35 wherein said feedstuff, food product, dietary supplement, or food additive is encapsulated.
37. A process for producing a pharmaceutical composition according to claim 31 , said process comprising admixing said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell, including bacteria, comprising said vector, and/or said host cell, including bacteria, comprising said polynucleotide sequence, with a pharmaceutically acceptable excipient, carrier or diluent; optionally said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host ceil, including bacteria, comprising said vector, and/or said host cell, including bacteria, comprising said polynucleotide sequence, is encapsulated.
38. A process for producing a nutritional supplement according to claim 33, said process comprising admixing said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell, including bacteria, comprising said vector, and/or said host cell, including bacteria, comprising said polynucleotide sequence, with a nutritionally acceptable excipient, carrier or diluent; optionally said Roseburia flagellin, and/or said polynucleotide sequence, and/or said vector, and/or said host cell, including bacteria, comprising said vector, and/or said host cell, including bacteria, comprising said polynucleotide sequence, is encapsulated.
39. A method of modulating the inflammation of a tissue or an organ in a subject, said method comprising administering to the subject a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein the inflammation of the tissue or organ in the subject is modulated.
40. A method of modulating the production of T cells in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein the production of T cells in the subject is modulated, in particular T regulatory cells.
41. A method of regulating the immune system of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein the immune system of the subject is regulated.
42. A method of treating a disorder in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
43. A method of modulating dendritic cells and/or epithelial cells in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein dendritic cells and/or epithelial cells in the subject are modulated.
44. A method of regulating the production of IL-10 and/or TGF in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, to the subject, and wherein the production of IL-10 and/or TGF in a cell or cells of the subject is regulated.
45. A method of regulating the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2, CD103, CD80,
CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, to the subject, and wherein the production of cell surface markers involved in immune responses and antigen recognition such as CD40, l-A/l-E, CD317/BST-2, CD103, CD80, CD86, CD83 and/or Siglec-H and/or the species equivalent in a cell or cells of the subject is regulated.
46. A method of regulating the expression of one of more Type I I FN genes in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, wherein the expression of one of more Type I I FN genes in a cell or cells of the subject is regulated.
47. A method of regulating the expression of one or more pro-inflammatory genes in a cell or cells of a subject, said method comprising administering a Roseburia flagellin, or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, wherein the expression of one or more pro-inflammatory genes in a cell or cells of the subject is regulated.
48. A method of improving intestinal microbiota in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein the intestinal microbiota in a subject is improved.
49. A method of regulating appetite in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein the appetite in the subject is regulated.
50. A method of regulating the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject, said method comprising administering a Roseburia fiagellin, and/or a polynucleotide sequence encoding said Roseburia fiagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of the subject is regulated.
51. A method of improving alimentary canal health in a subject, said method comprising administering a Roseburia fiagellin, and/or a polynucleotide sequence encoding said Roseburia fiagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein alimentary canal health in a subject is improved.
52. Use of a Roseburia fiagellin, and/or a polynucleotide sequence encoding said Roseburia fiagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for modulating the inflammation of a tissue or an organ in a subject.
53. Use of a Roseburia fiagellin, and/or a polynucleotide sequence encoding said Roseburia fiagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for modulating the production of T cells in a subject.
54. Use of a Roseburia fiagellin, and/or a polynucleotide sequence encoding said Roseburia fiagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for regulating the immune system of a subject.
55. Use of a Roseburia fiagellin, and/or a polynucleotide sequence encoding said Roseburia fiagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for the treatment of a disorder in a subject, wherein said disorder is an inflammatory disorder and/or an autoimmune disorder.
56. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, or a host cell, including bacteria, comprising said vector, or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for modulating dendritic cells and/or epithelial cells in a tissue or an organ of a subject.
57. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for regulating the production of IL-10 and/or TGFp in a cell or cells of a subject.
58. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for regulating the production of CD40 and/or l-A/l-E in a cell or cells of a subject.
59. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for regulating the expression of one of more Type I I FN genes in a cell or cells of a subject.
60. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for regulating the expression of one or more pro-inflammatory genes in a cell or cells of a subject.
61. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for improving intestinal microbiota in a subject.
62. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for regulating appetite in a subject.
63. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for regulating the expression of the gene encoding cholecystokinin (Cck) and/or the expression of the gene encoding glucagon (Gcg) in a cell or cells of a subject.
64. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for improving alimentary canal health in a subject.
65. Use of a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for the manufacture of a medicament for restoring immunological tolerance in a subject.
66. A method of restoring immunological tolerance in a subject, said method comprising administering a Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, and wherein the immunological tolerance in a subject is restored.
67. Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, for a use substantially as described herein.
68. A pharmaceutical composition, or a nutritional supplement, or a feedstuff, food product, dietary supplement or food additive, or a process for producing a pharmaceutical composition, or a process for producing a nutritional composition, or a method using Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, or use of Roseburia flagellin, and/or a polynucleotide sequence encoding said Roseburia flagellin, and/or a vector comprising said polynucleotide sequence, and/or a host cell, including bacteria, comprising said vector, and/or a host cell, including bacteria, comprising said polynucleotide sequence, substantially as described herein.
PCT/GB2014/051123 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation Ceased WO2014167338A1 (en)

Priority Applications (21)

Application Number Priority Date Filing Date Title
RU2015147864A RU2682651C2 (en) 2013-04-10 2014-04-10 Polypeptide and immune modulation
CN201480033216.6A CN105407908A (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
PL17204215T PL3318268T3 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
MEP-2018-55A ME03020B (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
NO14717823A NO3010523T3 (en) 2013-04-10 2014-04-10
DK14717823.0T DK3010523T3 (en) 2013-04-10 2014-04-10 ROSEBURIA FLAGELLIN AND IMMUNE MODULATION
LTEP14717823.0T LT3010523T (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
HRP20180360TT HRP20180360T1 (en) 2013-04-10 2014-04-10 ROSEBURIA FLAGELIN AND IMMUNOMODULATION
SM20180122T SMT201800122T1 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
RS20180240A RS56909B1 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
MX2015014281A MX363015B (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation.
EP14717823.0A EP3010523B1 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
ES14717823.0T ES2660823T3 (en) 2013-04-10 2014-04-10 Roseburia flagelins and immune modulation
JP2016507061A JP6641262B2 (en) 2013-04-10 2014-04-10 Polypeptides and immunomodulation
HK16111589.6A HK1223289B (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
EP17204215.2A EP3318268B1 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
SI201430604T SI3010523T1 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
PL14717823T PL3010523T3 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation
BR112015025854A BR112015025854A8 (en) 2013-04-10 2014-04-10 roseburia flagellin, polynucleotide sequence, vector, host cell, pharmaceutical composition, nutritional supplement, foodstuff, food product, food supplement, food additive, and uses thereof
CY20181100235T CY1120177T1 (en) 2013-04-10 2018-02-27 FLAGGELLIN ROSEBURIA AND IMMUNIZATION
CY20211101016T CY1124805T1 (en) 2013-04-10 2021-11-24 ROSEBURIA FLAGELIN AND IMMUNE MODULATION

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
GBGB1306536.2A GB201306536D0 (en) 2013-04-10 2013-04-10 Polypeptide and immune modulation
GB1306536.2 2013-04-10

Publications (1)

Publication Number Publication Date
WO2014167338A1 true WO2014167338A1 (en) 2014-10-16

Family

ID=48483707

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2014/051123 Ceased WO2014167338A1 (en) 2013-04-10 2014-04-10 Roseburia flagellin and immune modulation

Country Status (25)

Country Link
US (3) US9796762B2 (en)
EP (2) EP3318268B1 (en)
JP (3) JP6641262B2 (en)
CN (1) CN105407908A (en)
AU (2) AU2014202021B2 (en)
BR (1) BR112015025854A8 (en)
CA (1) CA2848725A1 (en)
CY (2) CY1120177T1 (en)
DK (2) DK3010523T3 (en)
ES (2) ES2660823T3 (en)
GB (1) GB201306536D0 (en)
HR (2) HRP20180360T1 (en)
HU (2) HUE056167T2 (en)
LT (2) LT3010523T (en)
ME (1) ME03020B (en)
MX (1) MX363015B (en)
NO (1) NO3010523T3 (en)
PL (2) PL3010523T3 (en)
PT (2) PT3318268T (en)
RS (2) RS62599B1 (en)
RU (1) RU2682651C2 (en)
SI (2) SI3010523T1 (en)
SM (2) SMT202100690T1 (en)
TR (1) TR201802752T4 (en)
WO (1) WO2014167338A1 (en)

Cited By (47)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9796762B2 (en) 2013-04-10 2017-10-24 4D Pharma Research Limited Polypeptide and immune modulation
US9839655B2 (en) 2015-11-20 2017-12-12 4D Pharma Research Limited Compositions comprising bacterial strains
US20170360856A1 (en) 2015-06-15 2017-12-21 4D Pharma Research Limited Compositions comprising bacterial strains
JP2018500270A (en) * 2015-06-15 2018-01-11 フォーディー ファーマ リサーチ リミテッド4D Pharma Research Limited Composition comprising a bacterial strain
US9937211B2 (en) 2011-10-07 2018-04-10 4D Pharma Research Limited Composition of Roseburia hominis
WO2018088933A1 (en) * 2016-11-14 2018-05-17 Limited Liability Company "Panacela Labs" Anti-tumor effects of a viral vector encoding a toll-like receptor and a toll-like receptor agonist
US9987311B2 (en) 2015-11-23 2018-06-05 4D Pharma Research Limited Compositions comprising bacterial strains
US10046015B2 (en) 2015-11-20 2018-08-14 4D Pharma Research Limited Compositions comprising bacterial strains
US10058574B2 (en) 2015-06-15 2018-08-28 4D Pharma Research Limited Compositions comprising bacterial strains
US10080772B2 (en) 2016-07-13 2018-09-25 4D Pharma Plc Compositions comprising bacterial strains
US10086022B2 (en) 2016-03-04 2018-10-02 4D Pharma Plc Compositions comprising bacterial strains
US10086021B2 (en) 2016-12-12 2018-10-02 4D Pharma Plc Compositions comprising bacterial strains
WO2018229236A2 (en) 2017-06-14 2018-12-20 4D Pharma Research Limited Compositions comprising bacterial strains
US10226489B2 (en) 2014-12-23 2019-03-12 4D Pharma Research Limited Composition of bacteroides thetaiotaomicron for immune modulation
WO2019141997A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
WO2019141998A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
WO2019141999A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
WO2019141996A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
US10391128B2 (en) 2015-11-23 2019-08-27 4D Pharma Research Limited Compositions comprising bacterial strains
US10456444B2 (en) 2014-12-23 2019-10-29 4D Pharma Research Limited Pirin polypeptide and immune modulation
WO2019215345A1 (en) 2018-05-11 2019-11-14 4D Pharma Research Limited Compositions comprising bacterial strains
US10493112B2 (en) 2015-06-15 2019-12-03 4D Pharma Research Limited Compositions comprising bacterial strains
WO2019238969A1 (en) 2018-06-14 2019-12-19 4D Pharma Research Ltd Compositions comprising bacterial strains
WO2020002370A1 (en) 2018-06-25 2020-01-02 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020016252A1 (en) 2018-07-16 2020-01-23 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020035623A1 (en) 2018-08-17 2020-02-20 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020058499A1 (en) 2018-09-20 2020-03-26 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020074569A1 (en) 2018-10-09 2020-04-16 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020079282A1 (en) 2018-10-19 2020-04-23 4D Pharma Research Ltd Compositions comprising bacterial strains
WO2020089488A1 (en) 2018-11-02 2020-05-07 4D Pharma Research Limited Compositions comprising bacterial strains
EP3650033A1 (en) 2015-06-15 2020-05-13 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020120716A1 (en) 2018-12-12 2020-06-18 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020120717A1 (en) 2018-12-12 2020-06-18 4D Pharma Research Limited Compositions comprising parabacteroides bacterial strains for treating cancer
WO2020120714A1 (en) 2018-12-12 2020-06-18 4D Pharma Research Limited Compositions comprising bacterial strains
JP2020523341A (en) * 2017-06-14 2020-08-06 フォーディー ファーマ リサーチ リミテッド4D Pharma Research Limited Composition comprising a bacterial strain
WO2020229428A1 (en) 2019-05-10 2020-11-19 4D Pharma Research Limited Compositions comprising bacterial strains
JP2020534858A (en) * 2017-09-28 2020-12-03 コバイオラブス,インコーポレーテッド Composition for diagnosis and treatment of alcoholic liver disease using changes in short-chain fatty acid-producing gut flora community
WO2021004958A2 (en) 2019-07-05 2021-01-14 4D Pharma Research Limited Compositions comprising bacterial strains
US10987387B2 (en) 2017-05-24 2021-04-27 4D Pharma Research Limited Compositions comprising bacterial strain
US11013773B2 (en) 2011-07-14 2021-05-25 4D Pharma Research Limited Lactic acid bacterial strains
WO2021098991A1 (en) 2019-11-20 2021-05-27 4D Pharma Research Limited Compositions comprising bacterial strains
EP3838281A1 (en) 2019-12-20 2021-06-23 4D Pharma Research Limited Compositions comprising bacterial strains
EP3858367A1 (en) 2017-06-14 2021-08-04 4D Pharma Research Limited Compositions comprising bacterial strains
WO2021151946A1 (en) 2020-01-27 2021-08-05 4D Pharma Research Limited Compositions comprising bacterial strains
US11123378B2 (en) 2017-05-22 2021-09-21 4D Pharma Research Limited Compositions comprising bacterial strains
US11224620B2 (en) 2016-07-13 2022-01-18 4D Pharma Plc Compositions comprising bacterial strains
US11419931B2 (en) 2018-03-19 2022-08-23 4D Pharma Research Limited Compositions comprising bacterial strains

Families Citing this family (81)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080124355A1 (en) 2006-09-22 2008-05-29 David Gordon Bermudes Live bacterial vaccines for viral infection prophylaxis or treatment
US8241623B1 (en) 2009-02-09 2012-08-14 David Bermudes Protease sensitivity expression system
US9457077B2 (en) 2009-11-18 2016-10-04 Katherine Rose Kovarik Method and system for targeting the microbiome to promote health and treat allergic and inflammatory diseases
US9585920B2 (en) 2011-02-04 2017-03-07 Katherine Rose Kovarik Method and system for treating cancer cachexia
US8771669B1 (en) 2010-02-09 2014-07-08 David Gordon Bermudes Immunization and/or treatment of parasites and infectious agents by live bacteria
US9597379B1 (en) 2010-02-09 2017-03-21 David Gordon Bermudes Protease inhibitor combination with therapeutic proteins including antibodies
US8524220B1 (en) 2010-02-09 2013-09-03 David Gordon Bermudes Protease inhibitor: protease sensitivity expression system composition and methods improving the therapeutic activity and specificity of proteins delivered by bacteria
US10548761B2 (en) 2011-02-04 2020-02-04 Joseph E. Kovarik Method and system for reducing the likelihood of colorectal cancer in a human being
US9730967B2 (en) 2011-02-04 2017-08-15 Katherine Rose Kovarik Method and system for treating cancer cachexia
US11998479B2 (en) 2011-02-04 2024-06-04 Seed Health, Inc. Method and system for addressing adverse effects on the oral microbiome and restoring gingival health caused by sodium lauryl sulphate exposure
US10111913B2 (en) 2011-02-04 2018-10-30 Joseph E. Kovarik Method of reducing the likelihood of skin cancer in an individual human being
US10842834B2 (en) 2016-01-06 2020-11-24 Joseph E. Kovarik Method and system for reducing the likelihood of developing liver cancer in an individual diagnosed with non-alcoholic fatty liver disease
US11191665B2 (en) 2011-02-04 2021-12-07 Joseph E. Kovarik Method and system for reducing the likelihood of a porphyromonas gingivalis infection in a human being
US11951140B2 (en) 2011-02-04 2024-04-09 Seed Health, Inc. Modulation of an individual's gut microbiome to address osteoporosis and bone disease
US11273187B2 (en) 2015-11-30 2022-03-15 Joseph E. Kovarik Method and system for reducing the likelihood of developing depression in an individual
US12257272B2 (en) 2015-12-24 2025-03-25 Seed Health, Inc. Method and system for reducing the likelihood of developing depression in an individual
US10086018B2 (en) 2011-02-04 2018-10-02 Joseph E. Kovarik Method and system for reducing the likelihood of colorectal cancer in a human being
US10245288B2 (en) 2011-02-04 2019-04-02 Joseph E. Kovarik Method and system for reducing the likelihood of developing NASH in an individual diagnosed with non-alcoholic fatty liver disease
US11523934B2 (en) 2011-02-04 2022-12-13 Seed Health, Inc. Method and system to facilitate the growth of desired bacteria in a human's mouth
US12533312B2 (en) 2011-02-04 2026-01-27 Seed Health, Inc. Method and system for preventing sore throat in humans
US11419903B2 (en) 2015-11-30 2022-08-23 Seed Health, Inc. Method and system for reducing the likelihood of osteoporosis
US11951139B2 (en) 2015-11-30 2024-04-09 Seed Health, Inc. Method and system for reducing the likelihood of osteoporosis
US10512661B2 (en) 2011-02-04 2019-12-24 Joseph E. Kovarik Method and system for reducing the likelihood of developing liver cancer in an individual diagnosed with non-alcoholic fatty liver disease
US10314865B2 (en) 2011-02-04 2019-06-11 Katherine Rose Kovarik Method and system for treating cancer and other age-related diseases by extending the healthspan of a human
US10010568B2 (en) 2011-02-04 2018-07-03 Katherine Rose Kovarik Method and system for reducing the likelihood of a spirochetes infection in a human being
US10687975B2 (en) 2011-02-04 2020-06-23 Joseph E. Kovarik Method and system to facilitate the growth of desired bacteria in a human's mouth
US10940169B2 (en) 2015-11-30 2021-03-09 Joseph E. Kovarik Method for reducing the likelihood of developing cancer in an individual human being
US12279989B2 (en) 2011-02-04 2025-04-22 Seed Health, Inc. Method and system for increasing beneficial bacteria and decreasing pathogenic bacteria in the oral cavity
US10583033B2 (en) 2011-02-04 2020-03-10 Katherine Rose Kovarik Method and system for reducing the likelihood of a porphyromonas gingivalis infection in a human being
US10835560B2 (en) 2013-12-20 2020-11-17 Joseph E. Kovarik Reducing the likelihood of skin cancer in an individual human being
US11844720B2 (en) 2011-02-04 2023-12-19 Seed Health, Inc. Method and system to reduce the likelihood of dental caries and halitosis
US9987224B2 (en) 2011-02-04 2018-06-05 Joseph E. Kovarik Method and system for preventing migraine headaches, cluster headaches and dizziness
US10085938B2 (en) 2011-02-04 2018-10-02 Joseph E. Kovarik Method and system for preventing sore throat in humans
US11357722B2 (en) 2011-02-04 2022-06-14 Seed Health, Inc. Method and system for preventing sore throat in humans
US9593339B1 (en) 2013-02-14 2017-03-14 David Gordon Bermudes Bacteria carrying bacteriophage and protease inhibitors for the treatment of disorders and methods of treatment
US11969445B2 (en) 2013-12-20 2024-04-30 Seed Health, Inc. Probiotic composition and method for controlling excess weight, obesity, NAFLD and NASH
US11980643B2 (en) 2013-12-20 2024-05-14 Seed Health, Inc. Method and system to modify an individual's gut-brain axis to provide neurocognitive protection
US12318377B2 (en) 2013-12-20 2025-06-03 Seed Health, Inc. Method and system for reducing the likelihood of a porphyromonas gingivalis infection in a human being
US11826388B2 (en) 2013-12-20 2023-11-28 Seed Health, Inc. Topical application of Lactobacillus crispatus to ameliorate barrier damage and inflammation
US11998574B2 (en) 2013-12-20 2024-06-04 Seed Health, Inc. Method and system for modulating an individual's skin microbiome
US11642382B2 (en) 2013-12-20 2023-05-09 Seed Health, Inc. Method for treating an individual suffering from bladder cancer
US12005085B2 (en) 2013-12-20 2024-06-11 Seed Health, Inc. Probiotic method and composition for maintaining a healthy vaginal microbiome
US11529379B2 (en) 2013-12-20 2022-12-20 Seed Health, Inc. Method and system for reducing the likelihood of developing colorectal cancer in an individual human being
US11672835B2 (en) 2013-12-20 2023-06-13 Seed Health, Inc. Method for treating individuals having cancer and who are receiving cancer immunotherapy
US11839632B2 (en) 2013-12-20 2023-12-12 Seed Health, Inc. Topical application of CRISPR-modified bacteria to treat acne vulgaris
US12246043B2 (en) 2013-12-20 2025-03-11 Seed Health, Inc. Topical application to treat acne vulgaris
US12329783B2 (en) 2013-12-20 2025-06-17 Seed Health, Inc. Method and system to improve the health of a person's skin microbiome
US11026982B2 (en) 2015-11-30 2021-06-08 Joseph E. Kovarik Method for reducing the likelihood of developing bladder or colorectal cancer in an individual human being
US11213552B2 (en) 2015-11-30 2022-01-04 Joseph E. Kovarik Method for treating an individual suffering from a chronic infectious disease and cancer
US11833177B2 (en) 2013-12-20 2023-12-05 Seed Health, Inc. Probiotic to enhance an individual's skin microbiome
CN118979001A (en) 2014-06-17 2024-11-19 皇冠实验室有限公司 Genetically modified bacteria and methods for genetic modification of bacteria
US10676723B2 (en) 2015-05-11 2020-06-09 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
US10675347B2 (en) 2015-11-30 2020-06-09 Joseph E. Kovarik Method and system for protecting honey bees from fipronil pesticides
US10568916B2 (en) 2015-11-30 2020-02-25 Joseph E. Kovarik Method and system for protecting honey bees, bats and butterflies from neonicotinoid pesticides
US11529412B2 (en) 2015-11-30 2022-12-20 Seed Health, Inc. Method and system for protecting honey bees from pesticides
US12239706B2 (en) 2015-11-30 2025-03-04 Seed Health, Inc. Method and system for protecting monarch butterflies from pesticides
US10933128B2 (en) 2015-11-30 2021-03-02 Joseph E. Kovarik Method and system for protecting honey bees from pesticides
US10086024B2 (en) 2015-11-30 2018-10-02 Joseph E. Kovarik Method and system for protecting honey bees, bats and butterflies from neonicotinoid pesticides
WO2017147507A1 (en) 2016-02-24 2017-08-31 Xycrobe Therapeutics, Inc. Skin probiotic formulation
KR102637610B1 (en) 2016-08-23 2024-02-19 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 Proteolytically cleavable chimeric polypeptides and methods of use thereof
US10738338B2 (en) 2016-10-18 2020-08-11 The Research Foundation for the State University Method and composition for biocatalytic protein-oligonucleotide conjugation and protein-oligonucleotide conjugate
US11180535B1 (en) 2016-12-07 2021-11-23 David Gordon Bermudes Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria
US11129906B1 (en) 2016-12-07 2021-09-28 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
SG11201906735RA (en) 2017-01-23 2019-08-27 Regeneron Pharma Hydroxysteroid 17-beta dehydrogenase 13 (hsd17b13) variants and uses thereof
US11666627B2 (en) 2017-04-07 2023-06-06 Second Genome, Inc. Proteins for the treatment of epithelial barrier function disorders
SG11201909334TA (en) * 2017-04-07 2019-11-28 Second Genome Inc Proteins for the treatment of epithelial barrier function disorders
JP2020516283A (en) 2017-04-11 2020-06-11 リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. Assay for screening the activity of modulators of hydroxysteroid (17-beta) dehydrogenase (HSD17B) family members
KR20240125690A (en) 2017-10-11 2024-08-19 리제너론 파마슈티칼스 인코포레이티드 Inhibition of hsd17b13 in the treatment of liver disease in patients expressing the pnpla3 i148m variation
CN108159397A (en) * 2018-02-28 2018-06-15 中南大学湘雅三医院 A kind of intestines Ross Salmonella recombination flagellin is preparing the application in preventing inflammatory bowel medicine
CN112020556A (en) 2018-03-21 2020-12-01 瑞泽恩制药公司 Type 13 17β-hydroxysteroid dehydrogenase (HSD17B13) iRNA composition and method of use
US11505583B2 (en) 2018-04-06 2022-11-22 Second Genome, Inc. Proteins for the treatment of epithelial barrier function disorders
US12150967B2 (en) 2018-08-18 2024-11-26 Seed Health, Inc. Methods and compositions for honey bee health
EP3930735A1 (en) 2019-02-26 2022-01-05 The Regents of the University of Colorado, a body corporate Method and composition for treating gastrointestinal inflammatory disorders
KR102169663B1 (en) * 2019-03-28 2020-10-26 가톨릭대학교 산학협력단 Composition for Preventing or Treating Graft Versus Host Disease Comprising TLR5 Agonist Derived from Flagellin As Active Ingredient
KR102524577B1 (en) 2019-04-22 2023-04-21 전남대학교산학협력단 Flagellin fusion protein and uses thereof
CN112578123B (en) * 2019-09-27 2022-10-25 成都中医药大学 Application of reagent for detecting content of calprotectin in preparation of uterine lesion screening kit
KR102215592B1 (en) * 2019-12-11 2021-02-15 주식회사 에이치이엠 A novel strain of Lactobacillus fermentum HEM 1036, and composition for improving gut environment comprising the strain or its culture fluid
US10973908B1 (en) 2020-05-14 2021-04-13 David Gordon Bermudes Expression of SARS-CoV-2 spike protein receptor binding domain in attenuated salmonella as a vaccine
BR112022026237A2 (en) 2020-06-23 2023-01-17 Crown Laboratories Inc PROBIOTICAL FORMULATIONS FOR SKIN
US12537071B1 (en) 2020-07-22 2026-01-27 David Gordon Bermudes Bacteria having boolean control pathways expressing therapeutic proteins including immunotherapeutic cytotoxins
US20220226465A1 (en) 2021-01-18 2022-07-21 ConserV Bioscience Coronavirus Immunogenic Compositions, Methods and Uses Thereof

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002085933A1 (en) * 2001-04-20 2002-10-31 The Institute For Systems Biology Toll-like receptor 5 ligands and methods of use
WO2003053220A2 (en) * 2001-12-17 2003-07-03 Corixa Corporation Compositions and methods for the therapy and diagnosis of inflammatory bowel disease
WO2005030133A2 (en) * 2003-09-22 2005-04-07 Yale University Treatment with agonists of toll-like receptors
WO2005107381A2 (en) * 2004-05-07 2005-11-17 Hans-Gustaf Ljunggren Use of flagellin as an adjuvant for vaccine
JP2006265212A (en) * 2005-03-25 2006-10-05 Institute Of Physical & Chemical Research IL-21 production inducer
WO2009128949A2 (en) * 2008-04-18 2009-10-22 Vaxinnate Corporation Compositions of dengue viral proteins and methods of use
WO2013050792A1 (en) * 2011-10-07 2013-04-11 Gt Biologics Ltd Bacterium for use as a probiotic for nutritional and medical applications

Family Cites Families (351)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
NL154598B (en) 1970-11-10 1977-09-15 Organon Nv PROCEDURE FOR DETERMINING AND DETERMINING LOW MOLECULAR COMPOUNDS AND PROTEINS THAT CAN SPECIFICALLY BIND THESE COMPOUNDS AND TEST PACKAGING.
US3817837A (en) 1971-05-14 1974-06-18 Syva Corp Enzyme amplification assay
US3939350A (en) 1974-04-29 1976-02-17 Board Of Trustees Of The Leland Stanford Junior University Fluorescent immunoassay employing total reflection for activation
US3996345A (en) 1974-08-12 1976-12-07 Syva Company Fluorescence quenching with immunological pairs in immunoassays
US4275149A (en) 1978-11-24 1981-06-23 Syva Company Macromolecular environment control in specific receptor assays
US4277437A (en) 1978-04-05 1981-07-07 Syva Company Kit for carrying out chemically induced fluorescence immunoassay
US4366241A (en) 1980-08-07 1982-12-28 Syva Company Concentrating zone method in heterogeneous immunoassays
NL8300698A (en) 1983-02-24 1984-09-17 Univ Leiden METHOD FOR BUILDING FOREIGN DNA INTO THE NAME OF DIABIC LOBAL PLANTS; AGROBACTERIUM TUMEFACIENS BACTERIA AND METHOD FOR PRODUCTION THEREOF; PLANTS AND PLANT CELLS WITH CHANGED GENETIC PROPERTIES; PROCESS FOR PREPARING CHEMICAL AND / OR PHARMACEUTICAL PRODUCTS.
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
DK122686D0 (en) 1986-03-17 1986-03-17 Novo Industri As PREPARATION OF PROTEINS
FR2613624B1 (en) 1987-04-10 1990-11-23 Roussy Inst Gustave ORAL ADMINISTRATIVE PHARMACEUTICAL COMPOSITION FOR REDUCING THE EFFECTS OF B-LACTAMINES
DE68928665T2 (en) 1988-08-02 1998-11-12 Gastro Services Pty Ltd TREATING GASTRO-INTESTINAL DISEASES
US5443826A (en) 1988-08-02 1995-08-22 Borody; Thomas J. Treatment of gastro-intestinal disorders with a fecal composition or a composition of bacteroides and E. Coli
KR100225087B1 (en) 1990-03-23 1999-10-15 한스 발터라벤 The expression of phytase in plants
CA2082279C (en) 1990-05-09 2007-09-04 Grethe Rasmussen Cellulase preparation comprising an endoglucanase enzyme
GB9107305D0 (en) 1991-04-08 1991-05-22 Unilever Plc Probiotic
US5443951A (en) 1992-07-20 1995-08-22 Kabushiki Kaisha Yakult Honsha Species-specific oligonucleotides for bifidobacteria and a method of detection using the same
ATE219143T1 (en) 1992-12-10 2002-06-15 Dsm Nv PRODUCTION OF HETEROLOGUE PROTEINS IN FILAMENTOUS FUNGI
US5741665A (en) 1994-05-10 1998-04-21 University Of Hawaii Light-regulated promoters for production of heterologous proteins in filamentous fungi
US5599795A (en) 1994-08-19 1997-02-04 Mccann; Michael Method for treatment of idiopathic inflammatory bowel disease (IIBD)
AUPM823094A0 (en) 1994-09-16 1994-10-13 Goodman Fielder Limited Probiotic compositions
AUPM864894A0 (en) 1994-10-07 1994-11-03 Borody, Thomas Julius Treatment of bowel-dependent neurological disorders
RU2078815C1 (en) 1995-01-17 1997-05-10 Московский научно-исследовательский институт эпидемиологии и микробиологии им.Г.Н.Габричевского Strain of bacterium bifidobacterium breve used for preparing the bacterial curative-prophylaxis bifido-containing preparations
JPH08259450A (en) 1995-03-17 1996-10-08 Nichinichi Seiyaku Kk Interferon production enhancer
US6861053B1 (en) 1999-08-11 2005-03-01 Cedars-Sinai Medical Center Methods of diagnosing or treating irritable bowel syndrome and other disorders caused by small intestinal bacterial overgrowth
AUPN698495A0 (en) 1995-12-06 1996-01-04 Pharma Pacific Pty Ltd Improved therapeutic formulation and method
SE508045C2 (en) 1996-02-26 1998-08-17 Arla Ekonomisk Foerening Adhesion inhibitors, preparations containing the same and process for their preparation
KR20000064729A (en) 1996-03-20 2000-11-06 번스 필프 앤드 컴파니 리미티드 Alteration of microbial populations in the gastrointestinal tract
AUPN881396A0 (en) 1996-03-20 1996-04-18 Arnott's Biscuits Limited Enhancement of microbial colonization of the gastrointestinal tract
CN1120235C (en) 1996-03-27 2003-09-03 诺沃奇梅兹有限公司 Alkaline protease deficient filamentous fungi
US6033864A (en) 1996-04-12 2000-03-07 The Regents Of The University Of California Diagnosis, prevention and treatment of ulcerative colitis, and clinical subtypes thereof, using microbial UC pANCA antigens
SE9604322D0 (en) 1996-11-25 1996-11-25 Astra Ab Bacterial antigens and vaccine compositions II
AU6773598A (en) 1997-03-26 1998-10-20 Institut Pasteur Treatment of gastrointestinal disease with ppar modulators
SE511524C2 (en) 1997-06-02 1999-10-11 Essum Ab Lactobacillus casei rhamnosus strain and pharmaceutical preparation for the control of pathogenic intestinal bacteria
US5925657A (en) 1997-06-18 1999-07-20 The General Hospital Corporation Use of PPARγ agonists for inhibition of inflammatory cytokine production
AUPO758297A0 (en) 1997-06-27 1997-07-24 Rowe, James Baber Control of acidic gut syndrome
US5951977A (en) 1997-10-14 1999-09-14 The United States Of America, As Represented By The Secretary Of Agriculture Competitive exclusion culture for swine
IT1298918B1 (en) 1998-02-20 2000-02-07 Mendes Srl USE OF ARGININE DEIMINASE BACTERIA TO INDUCE APOPTOSIS AND / OR REDUCE AN INFLAMMATORY REACTION AND PHARMACEUTICAL COMPOSITIONS
DE19826928A1 (en) 1998-06-17 1999-12-23 Novartis Consumer Health Gmbh Medicines containing viable anaerobic bacteria that inhibit sulfate reduction by sulfate-reducing bacteria
ID29150A (en) 1999-01-15 2001-08-02 Entpr Ireland Cs USE OF LACTOBACILLUS SALIVARIUS
US7090973B1 (en) 1999-04-09 2006-08-15 Oscient Pharmaceuticals Corporation Nucleic acid sequences relating to Bacteroides fragilis for diagnostics and therapeutics
DK1206457T3 (en) 1999-08-27 2004-02-16 Lilly Co Eli Biaryl-oxa (thia) zole derivatives and their use as modulators PPAPs
KR20020077421A (en) 2000-02-08 2002-10-11 에프. 호프만-라 로슈 아게 Use of acid-stable subtilisin proteases in animal feed
FR2808689B1 (en) 2000-05-11 2004-09-03 Agronomique Inst Nat Rech USE OF HYDROGENOTROPHIC ACETOGENIC STRAINS FOR THE PREVENTION OR TREATMENT OF DIGESTIVE DISORDERS
US20020013270A1 (en) 2000-06-05 2002-01-31 Bolte Ellen R. Method for treating a mental disorder
AUPQ899700A0 (en) 2000-07-25 2000-08-17 Borody, Thomas Julius Probiotic recolonisation therapy
EP1414853A2 (en) 2000-11-27 2004-05-06 Washington University Method for studying the effects of commensal microflora on mammalian intestine and treatments of gastrointestinal-associated disease based thereon
DE10101793A1 (en) 2001-01-17 2002-08-01 Manfred Nilius Use of SLPI to treat inflammatory bowel disease
EP1227152A1 (en) 2001-01-30 2002-07-31 Société des Produits Nestlé S.A. Bacterial strain and genome of bifidobacterium
KR100437497B1 (en) 2001-03-07 2004-06-25 주식회사 프로바이오닉 Acid-tolerant Lactobacillus reuteri Probio-16 suppressing the growth of pathogenic microorganisms and rotavirus, and Probiotics containing the same
EP1243273A1 (en) 2001-03-22 2002-09-25 Societe Des Produits Nestle S.A. Composition comprising a prebiotic for decreasing infammatory process and abnormal activation of non-specific immune parameters
EP1260227A1 (en) 2001-05-23 2002-11-27 Societe Des Produits Nestle S.A. Lipoteichoic acid from lactic acid bacteria and its use to modulate immune responses mediated by gram-negative bacteria, potential pathogenic gram-positive bacteria
US20030092163A1 (en) 2001-07-26 2003-05-15 Collins John Kevin Probiotic bifidobacterium strains
MXPA04001999A (en) 2001-09-05 2004-07-16 Vsl Pharmaceuticals Inc Lactic acid bacteria comprising unmethylated cytosine-guanine dinucleotides for use in therapy.
GB0127916D0 (en) 2001-11-21 2002-01-16 Rowett Res Inst Method
EP1529054A4 (en) 2001-11-27 2005-12-28 Univ Washington THERAPEUTIC PROTEIN AND TREATMENTS
US7101565B2 (en) 2002-02-05 2006-09-05 Corpak Medsystems, Inc. Probiotic/prebiotic composition and delivery method
DE10206995B4 (en) 2002-02-19 2014-01-02 Orthomol Pharmazeutische Vertriebs Gmbh Micronutrient combination product with pro- and prebiotics
JP2003261453A (en) 2002-03-11 2003-09-16 Nippon Berumu Kk Antitumor agent and radiation-protecting agent consisting of e. faecalis
DE60322570D1 (en) 2002-06-28 2008-09-11 Puleva Biotech Sa PROBIOTIC STRAINS, METHOD FOR THEIR SELECTION, THESE INGREDIENT COMPOSITIONS AND THEIR USE
US20040005304A1 (en) 2002-07-08 2004-01-08 Mak Wood, Inc. Novel compositions and methods for treating neurological disorders and associated gastrointestinal conditions
GB0307026D0 (en) 2003-03-27 2003-04-30 Rowett Res Inst Bacterial supplement
EP1481681A1 (en) 2003-05-30 2004-12-01 Claudio De Simone Lactic acid bacteria combination and compositions thereof
GB0316915D0 (en) 2003-07-18 2003-08-20 Glaxo Group Ltd Compounds
AU2003247193A1 (en) 2003-07-23 2005-02-04 M.D.Lab Corp. Acid tolerant probiotic lactobacillus plantarum probio-38 that can suppress the growth of pathogenic microorganism and tge coronavirus
US7485325B2 (en) 2003-08-06 2009-02-03 Gayle Dorothy Swain Animal food supplement compositions and methods of use
JP4683881B2 (en) 2003-08-27 2011-05-18 有限会社アーク技研 Antitumor active
US8192733B2 (en) 2003-08-29 2012-06-05 Cobb & Associates Probiotic composition useful for dietary augmentation and/or combating disease states and adverse physiological conditions
GB0323039D0 (en) 2003-10-01 2003-11-05 Danisco Method
JP4740866B2 (en) 2003-10-24 2011-08-03 ナムローゼ フェンノートシャップ ニュートリシア Symbiotic composition for infants
US20050239706A1 (en) 2003-10-31 2005-10-27 Washington University In St. Louis Modulation of fiaf and the gastrointestinal microbiota as a means to control energy storage in a subject
CA2550106A1 (en) 2003-12-17 2005-06-30 N.V. Nutricia Lactic acid producing bacteria and lung function
ES2235642B2 (en) 2003-12-18 2006-03-01 Gat Formulation Gmbh CONTINUOUS MULTI-MICROENCAPSULATION PROCESS FOR THE IMPROVEMENT OF STABILITY AND STORAGE OF BIOLOGICALLY ACTIVE INGREDIENTS.
CA2557800A1 (en) 2004-03-22 2005-10-06 Yossef Raviv Cellular and viral inactivation
PE20060426A1 (en) 2004-06-02 2006-06-28 Schering Corp TARTARIC ACID DERIVATIVES AS INHIBITORS OF MMPs, ADAMs, TACE AND TNF-alpha
US7638513B2 (en) 2004-06-02 2009-12-29 Schering Corporation Compounds for the treatment of inflammatory disorders
NZ586338A (en) 2004-06-07 2012-02-24 Qu Biolog Inc Bacterial compositions for the treatment of cancer
PT1629850E (en) 2004-08-24 2007-08-14 Nutricia Nv Nutritional composition comprising indigestible oligosaccharides
US20060062773A1 (en) 2004-09-21 2006-03-23 The Procter & Gamble Company Compositions for maintaining and restoring normal gastrointestinal flora
KR100468522B1 (en) 2004-10-12 2005-01-31 주식회사 프로바이오닉 2 -63new acid tolerant probiotic enterococcus faecium probio-63 that can suppress the growth of corona virus and porcine circovirus type 2
US20060115465A1 (en) 2004-10-29 2006-06-01 Macfarlane George Treatment of gastrointestinal disorders
ITMI20042189A1 (en) 2004-11-16 2005-02-16 Anidral Srl COMPOSITION BASED ON PROBIOTIC BACTERIA AND ITS USE IN THE PREVENTION OF E-OR IN THE TREATMENT OF PATHOLOGIES AND-OR RESPIRATORY INFECTIONS AND IN THE IMPROVEMENT OF INTESTINAL FUNCTIONALITY
PL1855550T3 (en) 2005-02-28 2012-03-30 Nutricia Nv Nutritional composition with probiotics
EP1861490A4 (en) 2005-03-23 2010-11-17 Univ St Louis USE OF ARRAYS TO MODULATE NUTRIENT CAPTURE FUNCTIONS BY THE GASTROINTESTINAL MICROBIOTE
WO2006102536A2 (en) 2005-03-23 2006-09-28 University Of Southern California Treatment of disease conditions through modulation of hydrogen sulfide produced by small intestinal bacterial overgrowth
US20100233312A9 (en) 2005-04-11 2010-09-16 The Procter & Gamble Company Compositions comprising probiotic and sweetener components
EP1714660A1 (en) 2005-04-21 2006-10-25 N.V. Nutricia Uronic acid and probiotics
WO2006114778A1 (en) 2005-04-26 2006-11-02 Teagasc- The Agriculture And Food Development Authority Probiotic composition suitable for animals
PL2161336T5 (en) 2005-05-09 2017-10-31 Ono Pharmaceutical Co Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US7572474B2 (en) 2005-06-01 2009-08-11 Mead Johnson Nutrition Company Method for simulating the functional attributes of human milk oligosaccharides in formula-fed infants
US8075934B2 (en) 2008-10-24 2011-12-13 Mead Johnson Nutrition Company Nutritional composition with improved digestibility
JP2007084533A (en) 2005-08-24 2007-04-05 Prima Meat Packers Ltd Immune response modulating composition and food containing the composition as an active ingredient
US7625704B2 (en) 2005-08-31 2009-12-01 Fred Hutchinson Cancer Research Center Methods and compositions for identifying bacteria associated with bacteria vaginosis
SI1933869T1 (en) 2005-09-01 2010-02-26 Schering Corp Use of il-23 and il-17 antagonists to treat autoimmune ocular inflammatory disease
US20090028840A1 (en) 2005-09-23 2009-01-29 Gwangju Institute Of Sciecne And Technology Compositions For Preventing Or Treating Arthritis Comprising Lactic Acid Bacteria and Collangen As Active Ingredients
EP1776877A1 (en) 2005-10-21 2007-04-25 N.V. Nutricia Method for stimulating the intestinal flora
EP1940243B1 (en) 2005-10-24 2011-08-03 Nestec S.A. Dietary fiber formulation and method of administration
JP2007116991A (en) 2005-10-28 2007-05-17 Eternal Light General Institute Inc Functional food
US7767420B2 (en) 2005-11-03 2010-08-03 Momenta Pharmaceuticals, Inc. Heparan sulfate glycosaminoglycan lyase and uses thereof
US7553864B2 (en) 2005-12-01 2009-06-30 Schering Corporation Compounds for the treatment of inflammatory disorders and microbial diseases
WO2007098371A2 (en) 2006-02-16 2007-08-30 Wayne State University Use of flagellin to prevent and treat gram negative bacterial infection
US20080260906A1 (en) 2006-03-17 2008-10-23 Marko Stojanovic Compositions comprising probiotic and sweetener components
JP5031249B2 (en) 2006-03-22 2012-09-19 学校法人北里研究所 Bacteria-containing composition having anti-inflammatory effect
WO2007136719A2 (en) 2006-05-18 2007-11-29 Biobalance Llc Biotherapeutic compositions comprising probiotic escherichia coli and uses thereof
WO2007140230A2 (en) 2006-05-26 2007-12-06 Nestec S.A. Methods of use and nutritional compositions of touchi extract
WO2007140613A1 (en) 2006-06-06 2007-12-13 Mcgill University Fermented milk product and use thereof
TW200819540A (en) 2006-07-11 2008-05-01 Genelux Corp Methods and compositions for detection of microorganisms and cells and treatment of diseases and disorders
US8691213B2 (en) 2006-08-04 2014-04-08 SHS International Protein free formula
WO2008031438A2 (en) 2006-09-13 2008-03-20 Region Hovedstaden V/Gentofte Hospital Treatment of asthma, eczema and/or allergy using non-pathogenic organisms
US20080069861A1 (en) 2006-09-19 2008-03-20 National Starch And Chemical Investment Holding Corporation Probiotic/Non-Probiotic Combinations
RU2420538C2 (en) 2006-10-27 2011-06-10 Пфайзер Продактс Инк. Hard capsules made from hydroxypropyl methylcellulose and method of producing said capsules
WO2008053444A2 (en) 2006-11-01 2008-05-08 The Procter & Gamble Company Treating a respiratory condition with bifidobacterium
EP1920782A1 (en) 2006-11-10 2008-05-14 Glycotope Gmbh Carboyhdrate specific cellular immunity inducing microorganisms and fractions thereof
WO2008064489A1 (en) 2006-12-01 2008-06-05 Mcmaster University Probiotics to inhibit inflammation
WO2008076696A2 (en) 2006-12-18 2008-06-26 Washington University In St. Louis The gut microbiome as a biomarker and therapeutic target for treating obesity or an obesity related disorder
DE102006062250A1 (en) 2006-12-22 2008-06-26 Roland Saur-Brosch Use of a composition of minerals and / or vitamins and optionally acetogenic and / or butyrogenic bacteria for oral or rectal administration for the treatment and prevention of abdominal discomfort
WO2008083157A2 (en) 2006-12-29 2008-07-10 Washington University In St. Louis Altering pgc-1alapha, ampk, fiaf, or the gastrointestinal microbiota as a means to modulate body fat and/or weight loss in a subject
JP2008195635A (en) 2007-02-09 2008-08-28 Crossfield Bio Inc Lactic acid bacteria preparation for horse
MX2009008875A (en) 2007-02-28 2009-08-28 Mead Johnson Nutrition Co Product containing inactivated probiotic for children or infants.
RU2473681C2 (en) 2007-03-28 2013-01-27 Элиментари Хелт Лимитед PROBIOTIC STRAIN OF Bifidobacterium longum, COMPOSITION CONTAINING SUCH STRAIN AND USE THEREOF
RU2466185C2 (en) 2007-03-28 2012-11-10 Элиментари Хелт Лимитед PROBIOTIC STRAIN Bifidobacterium longum, PROBIOTIC COMPOSITION AND USE OF STRAIN Bifidobacterium longum
US20080299098A1 (en) 2007-04-24 2008-12-04 Chea-Yun Se Broad-Spectrum Antibacterial and Antifungal Activity of Lactobacillus Johnsonii D115
EP1997499A1 (en) 2007-05-31 2008-12-03 Puleva Biotech, S.A. Mammalian milk microorganisms, compositions containing them and their use for the treatment of mastitis
EP1997906A1 (en) 2007-06-01 2008-12-03 Friesland Brands B.V. Lactobacillus
EP1997907A1 (en) 2007-06-01 2008-12-03 Friesland Brands B.V. Bifidobacteria
EP1997905A1 (en) 2007-06-01 2008-12-03 Friesland Brands B.V. Nucleic acid amplification
WO2008153377A1 (en) 2007-06-15 2008-12-18 N.V. Nutricia Nutrition with non-viable bifidobacterium and non-digestible oligosaccharide
EP2522358B1 (en) 2007-06-27 2016-11-09 Laboratorios Ordesa, S.l. Peptides against rotavirus infection
HUP0700552A2 (en) 2007-08-27 2009-03-30 Janos Dr Feher Method and composition inhibiting inflammation
WO2009030254A1 (en) 2007-09-04 2009-03-12 Curevac Gmbh Complexes of rna and cationic peptides for transfection and for immunostimulation
WO2009043856A2 (en) 2007-10-01 2009-04-09 University College Cork, National University Of Ireland, Cork Modulation of tissue fatty acid composition of a host by human gut bacteria
ES2431572T3 (en) 2007-10-20 2013-11-27 Université de Liège Bifidobacterial species
CA2740434C (en) 2007-10-26 2017-11-07 Brenda E. Moore Probiotic compositions and methods for inducing and supporting weight loss
ES2567079T3 (en) 2007-11-02 2016-04-19 Momenta Pharmaceuticals, Inc. Polysaccharide compositions that are not anticoagulants
EP2065048A1 (en) 2007-11-30 2009-06-03 Institut Pasteur Use of a L. casei strain, for the preparation of a composition for inhibiting mast cell activation
BRPI0821165B8 (en) 2007-12-07 2021-05-25 Nutricia Nv use of a composition
WO2009079564A2 (en) 2007-12-17 2009-06-25 Emory University Immunogenic compositions and methods of use thereof
ES2343499B1 (en) 2007-12-24 2011-06-10 Consejo Superior De Investigaciones Cientificas MICROORGANISMS TO IMPROVE THE STATE OF HEALTH OF INDIVIDUALS WITH DISORDERS RELATED TO THE INTAKE OF GLUTEN.
WO2009100331A2 (en) 2008-02-06 2009-08-13 The Procter & Gamble Company Compositions methods and kits for enhancing immune response to a respiratory condition
EP2103226A1 (en) 2008-03-18 2009-09-23 Friesland Brands B.V. Long-life probiotic food product
CA2722738C (en) 2008-05-13 2017-04-25 Glycotope Gmbh Fermentation process
MX2008006546A (en) 2008-05-21 2009-11-23 Sigma Alimentos Sa De Cv Bifidobacteria that produces folic acid, food composition and use of said bifidobacteria.
CN101590081A (en) 2008-05-28 2009-12-02 青岛东海药业有限公司 Preparations of Eubacterium protrudoides and Eubacterium dimorpha and their application
CN102940652B (en) 2008-05-28 2015-03-25 青岛东海药业有限公司 Eubacterium biforme preparation and use thereof
WO2009149149A1 (en) 2008-06-04 2009-12-10 Trustees Of Dartmouth College Prevention or treatment of immune-relevant disease by modification of microfloral populations
EP2133088A3 (en) 2008-06-09 2010-01-27 Nestec S.A. Rooibos and inflammation
WO2009151315A1 (en) 2008-06-13 2009-12-17 N.V. Nutricia Nutritional composition for infants delivered via caesarean section
WO2009154463A2 (en) 2008-06-20 2009-12-23 Stichting Top Institute Food And Nutrition Butyrate as a medicament to improve visceral perception in humans
EP2138186A1 (en) 2008-06-24 2009-12-30 Nestec S.A. Probiotics, secretory IgA and inflammation
WO2010002241A1 (en) 2008-06-30 2010-01-07 N.V. Nutricia Nutritional composition for infants delivered via caesarean section
KR101017448B1 (en) 2008-09-18 2011-02-23 주식회사한국야쿠르트 Bifidobacterium long gum H.Y.8004 having the health promoting effect of large intestine and product containing it as an active ingredient
US8137718B2 (en) 2008-09-19 2012-03-20 Mead Johnson Nutrition Company Probiotic infant products
US20100074870A1 (en) 2008-09-19 2010-03-25 Bristol-Myers Squibb Company Probiotic infant products
KR101057357B1 (en) 2008-09-22 2011-08-17 광주과학기술원 Pharmaceutical and Food Compositions for Preventing or Treating Arthritis Comprising Lactic Acid Bacteria and Collagen as Active Ingredients
US9603876B2 (en) 2008-09-25 2017-03-28 New York University Compositions and methods for restoring gastrointestinal microbiota following antibiotic treatment
WO2010037408A1 (en) 2008-09-30 2010-04-08 Curevac Gmbh Composition comprising a complexed (m)rna and a naked mrna for providing or enhancing an immunostimulatory response in a mammal and uses thereof
WO2010037402A1 (en) 2008-10-02 2010-04-08 Dako Denmark A/S Molecular vaccines for infectious disease
BRPI0922296A2 (en) 2008-12-05 2015-08-11 Nestec Sa Compositions for use in low birth weight newborns.
CA2746805A1 (en) 2008-12-19 2010-06-24 Nestec S.A. Prevention and treatment of rotavirus diarrhoea
IT1392672B1 (en) 2009-01-12 2012-03-16 Wyeth Consumer Healthcare S P A COMPOSITIONS INCLUDING PROBIOTIC COMPONENTS AND PREBIOTICS AND MINERAL SALTS, WITH LACTOFERRINA
TW201613969A (en) 2009-03-05 2016-04-16 Abbvie Inc IL-17 binding proteins
JP5710876B2 (en) 2009-03-26 2015-04-30 クロスフィールドバイオ株式会社 Novel Bifidobacterium and its utilization
MX2011011659A (en) 2009-05-07 2012-02-28 Tate & Lyle Ingredients France SAS Compositions and methods for making alpha-(1,2)-branched alpha-(1,6) oligodextrans.
JP5860396B2 (en) 2009-05-11 2016-02-16 ネステク ソシエテ アノニム Lactobacillus johnsonii La1NCC533 (CNCMI-1225) and immune disorders
EP2251020A1 (en) 2009-05-11 2010-11-17 Nestec S.A. Short-time high temperature treatment generates microbial preparations with anti-inflammatory profiles
EP2251022A1 (en) 2009-05-11 2010-11-17 Nestec S.A. Non-replicating micro-organisms and their immune boosting effect
KR20100128168A (en) 2009-05-27 2010-12-07 중앙대학교 산학협력단 New strain with excellent conjugated linoleic acid production capacity
US20100311686A1 (en) 2009-06-03 2010-12-09 Kasper Lloyd H Nutraceutical composition and methods for preventing or treating multiple sclerosis
WO2010143940A1 (en) 2009-06-12 2010-12-16 N.V. Nutricia Synergistic mixture of beta-galacto-oligosaccharides with beta-1,3 and beta-1,4/1,6 linkages
WO2010147714A1 (en) 2009-06-16 2010-12-23 The Trustees Of Columbia University In The City Of New York Autism-associated biomarkers and uses thereof
WO2011005756A1 (en) 2009-07-06 2011-01-13 Puretech Ventures, Llc Delivery of agents targeted to microbiota niches
WO2011011094A1 (en) 2009-07-24 2011-01-27 Dowd Scot E Universal microbial diagnosis, detection, quantification, and specimen-targeted therapy
PT2467032T (en) 2009-08-18 2018-04-04 Nestec Sa A nutritional composition comprising bifidobacterium longum strains and reducing food allergy symptoms, especially in infants and children
US20110053829A1 (en) 2009-09-03 2011-03-03 Curevac Gmbh Disulfide-linked polyethyleneglycol/peptide conjugates for the transfection of nucleic acids
JP2013505289A (en) 2009-09-23 2013-02-14 トーマス・ジュリアス・ボロディ Treatment of intestinal infections
EP2308498A1 (en) 2009-09-30 2011-04-13 Nestec S.A. Administration of Bifidobacterium breve during infancy to prevent inflammation later in life
EP2486143A1 (en) 2009-10-05 2012-08-15 AAK Patent B.V. Methods for diagnosing irritable bowel syndrome
EP3144004A1 (en) 2009-10-06 2017-03-22 Scott Dorfner Antibiotic formulations providing reduced gastrointestinal side effects and clostridium difficile infection relapse, and related methods
RU2546251C2 (en) 2009-11-11 2015-04-10 Алиментари Хелс Лимитед Probiotic strain of bifidus bacteria
CN102651973A (en) 2009-12-18 2012-08-29 希尔氏宠物营养品公司 Pet food compositions containing probiotics and methods of making and using same
US20150104418A1 (en) 2014-12-18 2015-04-16 Microbios, Inc. Bacterial composition
FR2955774A1 (en) 2010-02-02 2011-08-05 Aragan PREPARATION FOR TREATING PONDERAL EXCES AND ASSOCIATED DISORDERS AND APPLICATIONS THEREOF
NL2004200C2 (en) 2010-02-05 2011-08-08 Friesland Brands Bv Use of sialyl oligosaccharides in weight management.
NL2004201C2 (en) 2010-02-05 2011-08-08 Friesland Brands Bv Use of sialyl oligosaccharides to modulate the immune system.
IT1398553B1 (en) 2010-03-08 2013-03-01 Probiotical Spa COMPOSITION INCLUDING PROBIOTIC BACTERIA FOR THE TREATMENT OF PATHOLOGIES ASSOCIATED WITH THE ALTERATION OF THE IMMUNE SYSTEM.
JP5737646B2 (en) 2010-03-24 2015-06-17 森下仁丹株式会社 Antiallergic agent
WO2011121379A1 (en) 2010-03-30 2011-10-06 Assistance Publique - Hopitaux De Paris Use of bifidobacteria for preventing allergy in breastfed infants
US8951512B2 (en) 2010-05-04 2015-02-10 New York University Methods for treating bone disorders by characterizing and restoring mammalian bacterial microbiota
WO2011149335A1 (en) 2010-05-25 2011-12-01 N.V. Nutricia Immune imprinting nutritional composition
WO2011153226A2 (en) 2010-06-01 2011-12-08 Moore Research Enterprises Llc Cellular constituents from bacteroides, compositions thereof, and therapeutic methods employing bacteroides or cellular constituents thereof
WO2011151941A1 (en) 2010-06-04 2011-12-08 国立大学法人東京大学 Composition having activity of inducing proliferation or accumulation of regulatory t cell
TWI417054B (en) 2010-06-15 2013-12-01 Jen Shine Biotechnology Co Ltd Novel enterococcus faecium ljs-01 and its use for probiotic
EP2397145A1 (en) 2010-06-18 2011-12-21 Nestec S.A. L. johnsonii La1, B. longum NCC2705 and immune disorders
FR2962045B1 (en) 2010-07-05 2012-08-17 Bifinove MACROMOLECULAR COMPLEX OF BACTERIAL ORIGIN AND USE OF SAID MOLECULAR COMPLEX FOR PREVENTING AND TREATING INFLAMMATORY RHUMATISMS
TWI401086B (en) 2010-07-20 2013-07-11 Univ China Medical Lactobacillus plantarum and uses thereof
RU2581922C2 (en) 2010-07-26 2016-04-20 Кью Байолоджикс Инк. Immunogenic anti-inflammatory compositions
KR102435108B1 (en) 2010-08-04 2022-08-22 핀치 테라퓨틱스 홀딩스 엘엘씨 Compositions for fecal floral transplantation and methods for making and using them and devices for delivering them
WO2012024638A2 (en) 2010-08-20 2012-02-23 New York University Compositions and methods for treating obesity and related disorders by characterizing and restoring mammalian bacterial microbiota
KR101250463B1 (en) 2010-10-12 2013-04-15 대한민국 Oxygen tolerant Bifidobacterium longum from Korean neonate fecal samples and probiotic compositions produced by the same
KR20130113476A (en) 2010-10-27 2013-10-15 ?티백트 에이/에스 Capture of target dna and rna by probes comprising intercalator molecules
CN102031235B (en) 2010-11-09 2012-07-25 中国农业大学 Enterococcus faecium ANSE228 and application thereof
EP2455092A1 (en) 2010-11-11 2012-05-23 Nestec S.A. Non-replicating probiotic micro-organisms protect against upper respiratory tract infections
WO2012071380A1 (en) 2010-11-24 2012-05-31 Oragenics, Inc. Use of bacteria to treat and prevent respiratory infections
CN102093967B (en) 2010-12-02 2013-01-30 中国农业科学院特产研究所 A strain of Enterococcus faecium derived from mink and its application
ES2389547B1 (en) 2010-12-07 2013-08-08 Consejo Superior De Investigaciones Científicas (Csic) BIFIDOBACTERIUM CECT 7765 AND ITS USE IN THE PREVENTION AND / OR TREATMENT OF OVERWEIGHT, OBESITY AND ASSOCIATED PATHOLOGIES.
KR20140030132A (en) 2011-01-10 2014-03-11 클리브랜드 바이오랩스, 아이엔씨. Use of toll-like receptor agonist for treating cancer
HUE033189T2 (en) 2011-01-31 2017-11-28 Synformulas Gmbh Bifidobacterium bifidum strains for application in gastrointestinal diseases
JP5840368B2 (en) 2011-02-02 2016-01-06 カルピス株式会社 Substances for preventing and improving arthritis
PL2672980T3 (en) 2011-02-09 2018-05-30 Lavivo Ab Synbiotic compositions for restoration and reconstitution of gut microbiota
CN103561752B (en) 2011-03-09 2016-04-20 明尼苏达大学评议会 Compositions and methods for transplanting colonic microbiota
BRPI1100857A2 (en) 2011-03-18 2013-05-21 Eduardo Nowill Alexandre immunomodulatory agent and combinations thereof, their use and immunotherapeutic method for real time recontextualization, reprogramming and rebuilding of the immune system
WO2012140636A1 (en) 2011-04-11 2012-10-18 Alimentary Health Limited A probiotic formulation
WO2012142605A1 (en) 2011-04-15 2012-10-18 Samaritan Health Services Rapid recolonization deployment agent
KR20140053887A (en) 2011-04-20 2014-05-08 미코 바이오, 인크. Composition and method for enhancing an immune response
EP2707379A4 (en) 2011-05-13 2014-10-08 Glycosyn LLC USE OF PURIFIED 2'-FUCOSYLLACTOSE, 3-FUCOSYLLACTOSE AND LACTODIFUCOTÉTOSE AS PREBIOTICS
KR20120133133A (en) 2011-05-30 2012-12-10 한국 한의학 연구원 Composition for Prevention or Treatment of Respiratory Disease Comprising Herbal Extract and Fermentation Product thereof with Lactic acid Bacteria
US20140171339A1 (en) 2011-06-06 2014-06-19 The University Of North Carolina At Chapel Hill Methods and kits for detecting adenomas, colorectal cancer, and uses thereof
GB201110095D0 (en) 2011-06-15 2011-07-27 Danisco Method of treatment
JP2013005759A (en) 2011-06-24 2013-01-10 Kyodo Milk Industry Co Ltd Method for estimating intestinal bacterial flora of mouse
JP6222626B2 (en) 2011-07-07 2017-11-01 長岡香料株式会社 Fructose absorption inhibitor
US20130017999A1 (en) 2011-07-14 2013-01-17 Marc Fremont Methods and Compositions for Evaluating and/or Treating Chronic Immune Diseases
GB201112091D0 (en) 2011-07-14 2011-08-31 Gt Biolog Ltd Bacterial strains isolated from pigs
US20130022575A1 (en) 2011-07-19 2013-01-24 Microbial Rx Systems and methods of replacing intestinal flora
CN102304483A (en) 2011-08-12 2012-01-04 北京金泰得生物科技股份有限公司 Enterococcus faecium for feeding and applications thereof
KR101261872B1 (en) 2011-08-23 2013-05-14 대한민국 (식품의약품안전처장) A intestinal microbial enzyme mixture and it's preparation thereof
US20140363397A1 (en) 2011-09-14 2014-12-11 Queen's University At Kingston Method for treatment of disorders of the gastrointestinal system
EA201490512A1 (en) 2011-10-11 2014-09-30 Ачим Байотерапьютикс Аб COMPOSITIONS CONTAINING CULTIVATED IN ANAEROBIC CONDITIONS HUMAN INTESTINE MICROBIOT
CN103082292B (en) 2011-11-02 2015-03-04 深圳华大基因研究院 Use of Roseburia for the treatment and prevention of obesity-related diseases
CN102373172B (en) 2011-11-03 2013-03-20 北京龙科方舟生物工程技术有限公司 Enterococcus faecium and application thereof
EP2785828B1 (en) 2011-12-01 2020-04-08 The University of Tokyo Human-derived bacteria that induce proliferation or accumulation of regulatory t cells
ES2408279B1 (en) 2011-12-15 2014-09-09 Universidad De Las Palmas De Gran Canaria PROBIOTIC LACTIC ACID BACTERIA
ITBG20120010A1 (en) 2012-02-24 2013-08-25 Milano Politecnico DEVICE FOR SURGICAL TRAINING
ITMI20120471A1 (en) 2012-03-26 2013-09-27 Giovanni Mogna COMPOSITION BASED ON BACTERIA BIFID BACTERIUM LONGUM STRIPS ABLE TO HELP THE EXTENSION OF LIFE
JP5792105B2 (en) 2012-03-27 2015-10-07 森永乳業株式会社 Method for producing lacto-N-biose I
WO2013146319A1 (en) 2012-03-30 2013-10-03 味の素株式会社 Diabetes-inducible bacterium
WO2013154826A2 (en) 2012-04-11 2013-10-17 Nestec Sa Methods for diagnosing impending diarrhea
EP2836218A4 (en) 2012-04-13 2015-10-21 Trustees Boston College PREBIOTIC COMPOSITIONS AND METHODS OF USE
GB201206599D0 (en) 2012-04-13 2012-05-30 Univ Manchester Probiotic bacteria
EP2850202B1 (en) 2012-05-18 2020-03-11 Genome Research Limited Methods and groups
ES2436251B1 (en) 2012-05-25 2014-10-08 Consejo Superior De Investigaciones Científicas (Csic) BACTEROIDS CECT 7771 AND ITS USE IN THE PREVENTION AND TREATMENT OF OVERWEIGHT, OBESITY AND METABOLIC AND IMMUNOLOGICAL ALTERATIONS.
EP3659598A1 (en) 2012-06-04 2020-06-03 Gaurav Agrawal Compositions and methods for treating crohn's disease and related conditions and infections
CN106620189B (en) 2012-06-06 2021-11-19 上海交通大学 Method for improving intestinal flora structure and application
EP2864355B1 (en) 2012-06-25 2016-10-12 Orega Biotech Il-17 antagonist antibodies
ES2609654T3 (en) 2012-07-31 2017-04-21 Nestec S.A. Nutritive composition to promote the health of the musculoskeletal system of patients suffering from inflammatory bowel disease (IBD)
WO2014019271A1 (en) 2012-08-01 2014-02-06 Bgi Shenzhen Biomarkers for diabetes and usages thereof
EP2890808A4 (en) 2012-08-29 2016-09-28 California Inst Of Techn DIAGNOSIS AND TREATMENT OF AUTISM SPECTRUM DISORDER
KR20150046310A (en) 2012-08-29 2015-04-29 샐릭스 파마슈티컬스 인코포레이티드 Laxative compositions and methods for treating constipation and related gastrointestinal diseases and conditions
CA2884816A1 (en) 2012-09-13 2014-03-20 Massachusetts Institute Of Technology Programmable drug delivery profiles of tumor-targeted bacteria
KR101473058B1 (en) 2012-09-19 2014-12-16 주식회사 쎌바이오텍 Composition for preventing or treating irritable bowel syndrome
CN103652322B (en) 2012-09-21 2016-02-10 临沂思科生物科技有限公司 A kind of preparation method of lactobacteria-containing composite probiotics feed additive
US20150299776A1 (en) 2012-10-03 2015-10-22 Metabogen Ab Identification of a Person having Risk for Atherosclerosis and Associated Disease by the Person's Gut Microbiome and the Prevention of such Diseases
FR2997091B1 (en) 2012-10-22 2016-05-06 Fond Mediterranee Infection USE OF ANTIOXIDANT COMPOUND FOR THE CULTURE OF BACTERIA SENSITIVE TO OXYGEN TENSION
EP2914275A1 (en) 2012-10-30 2015-09-09 Nestec S.A. Compositions comprising microparticles and probiotics to deliver a synergistic immune effect
WO2014070225A1 (en) 2012-10-30 2014-05-08 Deerland Enzymes, Inc. Prebiotic compositions comprising one or more types of bacteriophage
JP2015535280A (en) 2012-11-01 2015-12-10 レイクスユニフェルシテイト フローニンゲン Methods and compositions for stimulating beneficial bacteria in the gastrointestinal tract
WO2014075745A1 (en) 2012-11-19 2014-05-22 Université Catholique de Louvain Use of akkermansia for treating metabolic disorders
US8906668B2 (en) 2012-11-23 2014-12-09 Seres Health, Inc. Synergistic bacterial compositions and methods of production and use thereof
NZ709392A (en) 2012-11-23 2016-10-28 Seres Therapeutics Inc Synergistic bacterial compositions and methods of production and use thereof
JP2016501852A (en) 2012-11-26 2016-01-21 トーマス・ジュリアス・ボロディ Compositions for the recovery of fecal microbiota and methods for making and using them
EP2931898B1 (en) 2012-12-12 2016-03-09 The Broad Institute, Inc. Engineering and optimization of systems, methods and compositions for sequence manipulation with functional domains
IL239317B (en) 2012-12-12 2022-07-01 Broad Inst Inc Delivery, engineering and optimization of systems, methods and compositions for sequence manipulation and therapeutic applications
ES2576126T3 (en) 2012-12-12 2016-07-05 The Broad Institute, Inc. Modification by genetic technology and optimization of improved enzyme systems, methods and compositions for sequence manipulation
US20140193464A1 (en) 2013-01-08 2014-07-10 Imagilin Technology, Llc Effects of probiotics on humans and animals under environmental or biological changes
US11185562B2 (en) 2013-02-04 2021-11-30 Seres Therapeutics, Inc. Compositions and methods for inhibition of pathogenic bacterial growth
EP3904502A3 (en) 2013-02-04 2022-02-23 Seres Therapeutics, Inc. Compositions and methods
CA2940226A1 (en) 2013-02-22 2014-08-28 The Regents Of The University Of California Compositions and methods for promoting growth of beneficial microbes to treat or prevent disease or prolong life
MX2015011700A (en) 2013-03-05 2016-07-20 Univ Groningen Use of faecali bacterium prausnitzii htf-f (dsm 26943) to suppress inflammation.
AU2014239883B2 (en) 2013-03-14 2019-01-17 Therabiome, Llc Targeted gastrointestinal tract delivery of probiotic organisms and/or therapeutic agents
EP2971148A4 (en) 2013-03-14 2016-08-17 Seres Therapeutics Inc Methods for pathogen detection and enrichment from materials and compositions
US9669059B2 (en) 2013-03-15 2017-06-06 University Of Florida Research Foundation, Incorporated Butyrogenic bacteria as probiotics to treat clostridium difficile
HK1220326A1 (en) 2013-03-15 2017-05-05 Seres Therapeutics, Inc. Network-based microbial compositions and methods
CN103156888A (en) 2013-03-18 2013-06-19 广州知光生物科技有限公司 Application of bacteroides fragilis in preparation of composition for treating inflammatory bowel diseases
CN103142656A (en) 2013-03-18 2013-06-12 广州知光生物科技有限公司 Application of bacteroides fragilis in preparing composition for preventing and treating colon cancer
CN103146620A (en) 2013-03-25 2013-06-12 广州知光生物科技有限公司 Bacteroides fragilis with characteristics of probiotics
JP2014196260A (en) 2013-03-29 2014-10-16 公立大学法人奈良県立医科大学 Preventive or therapeutic composition of chronic obstructive pulmonary disease
GB201306536D0 (en) 2013-04-10 2013-05-22 Gt Biolog Ltd Polypeptide and immune modulation
WO2014182966A1 (en) 2013-05-10 2014-11-13 California Institute Of Technology Probiotic prevention and treatment of colon cancer
US9511099B2 (en) 2013-06-05 2016-12-06 Rebiotix, Inc. Microbiota restoration therapy (MRT), compositions and methods of manufacture
EP4234011A3 (en) 2013-06-05 2023-09-20 Rebiotix, Inc. Microbiota restoration therapy (mrt), compositions and methods of manufacture
WO2014201037A2 (en) 2013-06-10 2014-12-18 New York University Methods for manipulating immune responses by altering microbiota
WO2014200334A1 (en) 2013-06-14 2014-12-18 N.V. Nutricia Synbiotic composition for treatment of infections in allergic patients
WO2015003001A1 (en) 2013-07-01 2015-01-08 The Washington University Methods for identifying supplements that increase gut colonization by an isolated bacterial species, and compositions derived therefrom
WO2015003305A1 (en) 2013-07-08 2015-01-15 吉瑞高新科技股份有限公司 Electronic cigarette case
JP2016530239A (en) 2013-07-09 2016-09-29 ピュアテック ベンチャーズ、エルエルシー Disease treatment composition comprising a combination of microbiota-derived bioactive molecules
WO2015013214A2 (en) 2013-07-21 2015-01-29 Whole Biome, Inc. Methods and systems for microbiome characterization, monitoring and treatment
US20160192689A1 (en) 2013-07-31 2016-07-07 Wikifoods, Inc. Encapsulated functional food compositions
EP3033091B1 (en) 2013-08-16 2022-09-07 Versitech Limited Probiotic composition and use thereof in the prevention and treatment of hepatocellular carcinoma
CN103509741B (en) 2013-08-22 2015-02-18 河北农业大学 Braun bacterium AUH-JLD56 and application thereof in arctigenin conversion
ITMI20131467A1 (en) 2013-09-06 2015-03-07 Sofar Spa USE OF A COMPOSITION INCLUDING MICRO-ORGANISMS TO INCREASE THE INTESTINAL PRODUCTION OF BUTIRRIC ACID, FOLIC ACID OR NIACINE ACID AND / OR TO REDUCE THE INTESTINAL PRODUCTION OF SUCCINIC ACID
WO2015038731A1 (en) 2013-09-12 2015-03-19 The Johns Hopkins University Biofilm formation to define risk for colon cancer
EP3071052B1 (en) 2013-10-18 2020-02-26 InnovaChildfood AB A nutritionally balanced composite meal for infants and small children and a method of producing said meal
PL229020B1 (en) 2013-11-13 2018-05-30 Inst Biotechnologii Surowic I Szczepionek Biomed Spolka Akcyjna New strain of Bifidobacterium breve
MX367109B (en) 2013-11-25 2019-08-05 Seres Therapeutics Inc Synergistic bacterial compositions and methods of production and use thereof.
WO2015095241A2 (en) 2013-12-16 2015-06-25 Seres Health, Inc. Bacterial compositions and methods of use thereof for treatment of immune system disorders
CN103981115B (en) 2013-12-24 2018-10-26 北京大伟嘉生物技术股份有限公司 One plant height resistance enterococcus faecium and its application
CN103981117B (en) 2013-12-24 2018-10-26 北京大伟嘉生物技术股份有限公司 One plant height resistance enterococcus faecium and its cultural method and application
CN103820363B (en) 2014-01-27 2016-02-24 福建省农业科学院生物技术研究所 A kind of preparation and application of faecium bacterium powder
CN103865846B (en) 2014-02-27 2016-03-30 扬州绿保生物科技有限公司 A kind of faecium and preparation method thereof
CN103849590B (en) 2014-03-25 2016-07-06 上海交通大学 The one acidproof bifidobacterium breve BB8dpH of strain and application thereof
KR101683474B1 (en) 2014-03-26 2016-12-08 주식회사 쎌바이오텍 Composition for preventing or treating irritable bowel syndrome
US9783858B2 (en) 2014-04-02 2017-10-10 Northwestern University Altered microbiome of chronic pelvic pain
KR101583546B1 (en) 2014-04-09 2016-01-11 국립암센터 Method for prediction of reactivity to sorafenib treatment Using gene polymorphism
CN106659746A (en) 2014-04-10 2017-05-10 国立研究开发法人理化学研究所 Compositions and methods for induction of TH17 cells
CN104195075B (en) 2014-08-14 2017-04-19 生合生物科技股份有限公司 A kind of Enterococcus faecium EF08 and its feed additive and feed
WO2015168534A1 (en) 2014-05-02 2015-11-05 Novogy, Inc. Therapeutic treatment of gastrointestinal microbial imbalances through competitive microbe displacement
JP6629840B2 (en) 2014-05-08 2020-01-15 パノプテス・ファーマ・ゲーエムベーハー Compounds for treating ophthalmic diseases and disorders
CN106687130B (en) 2014-08-05 2020-01-21 深圳华大基因科技有限公司 Use of Eubacterium spp in the prevention and treatment of colorectal cancer-related diseases
WO2016033439A2 (en) 2014-08-28 2016-03-03 Yale University Compositions and methods for the treating an inflammatory disease or disorder
WO2016036615A1 (en) 2014-09-03 2016-03-10 California Institute Of Technology Microbe-based modulation of serotonin biosynthesis
CN104546934B (en) 2014-09-30 2019-04-09 深圳华大基因科技有限公司 Application of Parabacteroides faecalis in the treatment or prevention of rheumatoid arthritis or its related diseases
CN104546933A (en) 2014-09-30 2015-04-29 深圳华大基因科技有限公司 Application of bacteroides caccae in treatment or prevention of rheumatoid arthritis or related diseases thereof
CN104546932A (en) 2014-09-30 2015-04-29 深圳华大基因科技有限公司 Application of bacteroides ovatus in treating or preventing rheumatoid arthritis or related diseases thereof
CN104546935A (en) 2014-09-30 2015-04-29 深圳华大基因科技有限公司 Application of bacteroides thetaiotaomicron in treating or preventing rheumatoid arthritis or related diseases thereof
CN104546942A (en) 2014-09-30 2015-04-29 深圳华大基因科技有限公司 Application of bacteroides dorei in treating or preventing rheumatoid arthritis or related diseases thereof
CN104546940A (en) 2014-09-30 2015-04-29 深圳华大基因科技有限公司 Application of common bacteroides in treatment or prevention of rheumatoid arthritis or related diseases thereof
US10046030B2 (en) 2014-10-07 2018-08-14 University Of Virginia Patent Foundation Compositions and methods for preventing and treating infection
US10716816B2 (en) 2014-10-24 2020-07-21 Evolve Biosystems Inc. Activated bifidobacteria and methods of use thereof
CA2966363A1 (en) 2014-10-30 2016-05-06 California Institute Of Technology Compositions and methods comprising bacteria for improving behavior in neurodevelopmental disorders
CN107106616A (en) 2014-10-30 2017-08-29 加利福尼亚技术学院 The composition and method of bacterium including improvement neurodevelopmental disorder behavior
CA2964480A1 (en) 2014-10-31 2016-05-06 Whole Biome Inc. Methods and compositions relating to microbial treatment and diagnosis of disorders
CN104435000A (en) 2014-11-12 2015-03-25 江南大学 Application of lactic acid bacteria for treating bronchial asthma
MA41020A (en) 2014-11-25 2017-10-03 Evelo Biosciences Inc PROBIOTIC AND PREBIOTIC COMPOSITIONS, AND THEIR METHODS OF USE FOR MODULATION OF THE MICROBIOME
AU2015353465B2 (en) 2014-11-25 2021-07-29 Memorial Sloan-Kettering Cancer Center Intestinal microbiota and GVHD
KR20170091157A (en) 2014-12-23 2017-08-08 4디 파마 리서치 리미티드 Pirin polypeptide and immune modulation
PL3065748T3 (en) 2014-12-23 2018-07-31 4D Pharma Research Limited A bacteroides thetaiotaomicron strain and its use in reducing inflammation
CN104560820B (en) 2014-12-30 2017-10-20 杭州师范大学 VREF KQ2.6 and application
KR102735818B1 (en) 2015-01-23 2024-11-28 템플 유니버시티-오브 더 커먼웰쓰 시스템 오브 하이어 에듀케이션 Uses of short-chain fatty acids in cancer prevention
CN105982919A (en) 2015-02-26 2016-10-05 王汉成 Biological retarder anti-cancer technology
WO2016139217A1 (en) 2015-03-04 2016-09-09 Ab-Biotics, S.A. Composition comprising anaerobically cultivated human intestinal microbiota
GB2553701A (en) 2015-03-18 2018-03-14 Whole Biome Inc Methods and compositions relating to microbial treatment and diagnosis of skin disorders
US20180078587A1 (en) 2015-03-18 2018-03-22 Trustees Of Tufts College Compositions and methods for preventing colorectal cancer
WO2016196605A1 (en) 2015-06-01 2016-12-08 The University Of Chicago Treatment of cancer by manipulation of commensal microflora
EA201890050A1 (en) 2015-06-15 2018-06-29 4Д Фарма Рисёрч Лимитед COMPOSITIONS CONTAINING BACTERIAL STRAINS
MD3650033T2 (en) 2015-06-15 2022-08-31 4D Pharma Res Ltd Compositions comprising bacterial strains
MA41010B1 (en) 2015-06-15 2020-01-31 4D Pharma Res Ltd Compositions comprising bacterial strains
SI3240554T1 (en) 2015-06-15 2019-12-31 4D Pharma Research Limited, Blautia stercosis and wexlerae for use in the treatment of inflammatory and autoimmune diseases
MA41060B1 (en) 2015-06-15 2019-11-29 4D Pharma Res Ltd Compositions comprising bacterial strains
CN105112333A (en) 2015-08-31 2015-12-02 江南大学 Bifidobacterium longum with good intestinal tract colonizing ability and screening method and application of bifidobacterium longum
AU2016357554B2 (en) 2015-11-20 2019-04-04 Cj Bioscience, Inc. Compositions comprising bacterial strains
GB201520497D0 (en) 2015-11-20 2016-01-06 4D Pharma Res Ltd Compositions comprising bacterial strains
GB201520638D0 (en) 2015-11-23 2016-01-06 4D Pharma Res Ltd Compositions comprising bacterial strains
GB201520631D0 (en) 2015-11-23 2016-01-06 4D Pharma Res Ltd Compositions comprising bacterial strains
EP3379935A4 (en) 2015-11-25 2019-08-28 Memorial Sloan-Kettering Cancer Center METHODS AND COMPOSITIONS FOR REDUCING ENTEROCOCCI INFECTION OR COLONIZATION
EP3520801A1 (en) 2016-03-04 2019-08-07 4D Pharma Plc Compositions comprising bacterial blautia strains for treating visceral hypersensitivity
TW201821093A (en) 2016-07-13 2018-06-16 英商4D製藥有限公司 Composition comprising a bacterial strain
GB201621123D0 (en) 2016-12-12 2017-01-25 4D Pharma Plc Compositions comprising bacterial strains
WO2018112365A2 (en) 2016-12-16 2018-06-21 Evelo Biosciences, Inc. Methods of treating colorectal cancer and melanoma using parabacteroides goldsteinii
WO2018112363A1 (en) 2016-12-16 2018-06-21 Evelo Biosciences, Inc. Methods of treating cancer using parabacteroides
TW201907931A (en) 2017-05-24 2019-03-01 英商4D製藥研究有限公司 Composition comprising a bacterial strain
TW201906620A (en) 2017-07-05 2019-02-16 美商艾弗洛生物科技股份有限公司 Composition and method for treating cancer using BIFIDOBACTERIUM ANIMALIS SSP. LACTIS

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2002085933A1 (en) * 2001-04-20 2002-10-31 The Institute For Systems Biology Toll-like receptor 5 ligands and methods of use
WO2003053220A2 (en) * 2001-12-17 2003-07-03 Corixa Corporation Compositions and methods for the therapy and diagnosis of inflammatory bowel disease
WO2005030133A2 (en) * 2003-09-22 2005-04-07 Yale University Treatment with agonists of toll-like receptors
WO2005107381A2 (en) * 2004-05-07 2005-11-17 Hans-Gustaf Ljunggren Use of flagellin as an adjuvant for vaccine
JP2006265212A (en) * 2005-03-25 2006-10-05 Institute Of Physical & Chemical Research IL-21 production inducer
WO2009128949A2 (en) * 2008-04-18 2009-10-22 Vaxinnate Corporation Compositions of dengue viral proteins and methods of use
WO2013050792A1 (en) * 2011-10-07 2013-04-11 Gt Biologics Ltd Bacterium for use as a probiotic for nutritional and medical applications

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
"PhD Thesis, University College Cork.", 15 January 2013, ANNE NEVILLE, Cork, Republic of Ireland, article B ANNE NEVILLE: "Functional genomics of motile commensal intestinal bacteria", XP055133403 *
GEWIRTZ A T ET AL: "Cutting edge: bacterial flagellin activates basolaterally expressed TLR5 to induce epithelial proinflammatory gene expression", THE JOURNAL OF IMMUNOLOGY, THE AMERICAN ASSOCIATION OF IMMUNOLOGISTS, US, vol. 167, no. 4, 15 August 2001 (2001-08-15), pages 1882 - 1885, XP002500275, ISSN: 0022-1767 *
I. JARCHUM ET AL: "Toll-Like Receptor 5 Stimulation Protects Mice from Acute Clostridium difficile Colitis", INFECTION AND IMMUNITY, vol. 79, no. 4, 18 January 2011 (2011-01-18), pages 1498 - 1503, XP055133749, ISSN: 0019-9567, DOI: 10.1128/IAI.01196-10 *
MONA HEDAYAT ET AL: "Prophylactic and therapeutic implications of toll-like receptor ligands", MEDICINAL RESEARCH REVIEWS, vol. 32, no. 2, 1 March 2012 (2012-03-01), pages 294 - 325, XP055039310, ISSN: 0198-6325, DOI: 10.1002/med.20214 *

Cited By (104)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11013773B2 (en) 2011-07-14 2021-05-25 4D Pharma Research Limited Lactic acid bacterial strains
US9937211B2 (en) 2011-10-07 2018-04-10 4D Pharma Research Limited Composition of Roseburia hominis
US11266698B2 (en) 2011-10-07 2022-03-08 4D Pharma Research Limited Bacterium for use as a probiotic for nutritional and medical applications
US10851137B2 (en) 2013-04-10 2020-12-01 4D Pharma Research Limited Polypeptide and immune modulation
US9796762B2 (en) 2013-04-10 2017-10-24 4D Pharma Research Limited Polypeptide and immune modulation
US11414463B2 (en) 2013-04-10 2022-08-16 4D Pharma Research Limited Polypeptide and immune modulation
US11723933B2 (en) 2014-12-23 2023-08-15 Cj Bioscience, Inc. Composition of bacteroides thetaiotaomicron for immune modulation
US10973872B2 (en) 2014-12-23 2021-04-13 4D Pharma Research Limited Pirin polypeptide and immune modulation
US10456444B2 (en) 2014-12-23 2019-10-29 4D Pharma Research Limited Pirin polypeptide and immune modulation
US10226489B2 (en) 2014-12-23 2019-03-12 4D Pharma Research Limited Composition of bacteroides thetaiotaomicron for immune modulation
EP3636272A1 (en) 2015-06-15 2020-04-15 4D Pharma Research Limited Compositions comprising bacterial strains
US10391130B2 (en) 2015-06-15 2019-08-27 4D Pharma Research Limited Compositions comprising bacterial strains
EP3884953A1 (en) 2015-06-15 2021-09-29 4D Pharma Research Limited Compositions comprising bacterial strains
US10780134B2 (en) 2015-06-15 2020-09-22 4D Pharma Research Limited Compositions comprising bacterial strains
US10744167B2 (en) 2015-06-15 2020-08-18 4D Pharma Research Limited Compositions comprising bacterial strains
US10736926B2 (en) 2015-06-15 2020-08-11 4D Pharma Research Limited Compositions comprising bacterial strains
US10058574B2 (en) 2015-06-15 2018-08-28 4D Pharma Research Limited Compositions comprising bacterial strains
US10864236B2 (en) 2015-06-15 2020-12-15 4D Pharma Research Limited Compositions comprising bacterial strains
US10322151B2 (en) 2015-06-15 2019-06-18 4D Pharma Research Limited Compositions comprising bacterial strains
US11273185B2 (en) 2015-06-15 2022-03-15 4D Pharma Research Limited Compositions comprising bacterial strains
US11433106B2 (en) 2015-06-15 2022-09-06 4D Pharma Research Limited Compositions comprising bacterial strains
US20170360856A1 (en) 2015-06-15 2017-12-21 4D Pharma Research Limited Compositions comprising bacterial strains
US11389493B2 (en) 2015-06-15 2022-07-19 4D Pharma Research Limited Compositions comprising bacterial strains
JP2018500270A (en) * 2015-06-15 2018-01-11 フォーディー ファーマ リサーチ リミテッド4D Pharma Research Limited Composition comprising a bacterial strain
EP3662917A1 (en) 2015-06-15 2020-06-10 4D Pharma Research Limited Compositions comprising bacterial strains
EP3626248A1 (en) 2015-06-15 2020-03-25 4D Pharma Research Limited Compositions comprising bacterial strains
US10500237B2 (en) 2015-06-15 2019-12-10 4D Pharma Research Limited Compositions comprising bacterial strains
US10493112B2 (en) 2015-06-15 2019-12-03 4D Pharma Research Limited Compositions comprising bacterial strains
EP3650033A1 (en) 2015-06-15 2020-05-13 4D Pharma Research Limited Compositions comprising bacterial strains
US11331352B2 (en) 2015-06-15 2022-05-17 4D Pharma Research Limited Compositions comprising bacterial strains
US11040075B2 (en) 2015-06-15 2021-06-22 4D Pharma Research Limited Compositions comprising bacterial strains
US10471108B2 (en) 2015-11-20 2019-11-12 4D Pharma Research Limited Compositions comprising bacterial strains
US9974815B2 (en) 2015-11-20 2018-05-22 4D Pharma Research Limited Compositions comprising bacterial strains
US10357520B2 (en) 2015-11-20 2019-07-23 4D Pharma Research Limited Compositions comprising bacterial strains
US11058732B2 (en) 2015-11-20 2021-07-13 4D Pharma Research Limited Compositions comprising bacterial strains
US20180078585A1 (en) 2015-11-20 2018-03-22 4D Pharma Research Limited Compositions comprising bacterial strains
US10046015B2 (en) 2015-11-20 2018-08-14 4D Pharma Research Limited Compositions comprising bacterial strains
US9839655B2 (en) 2015-11-20 2017-12-12 4D Pharma Research Limited Compositions comprising bacterial strains
US10610550B2 (en) 2015-11-20 2020-04-07 4D Pharma Research Limited Compositions comprising bacterial strains
US10391128B2 (en) 2015-11-23 2019-08-27 4D Pharma Research Limited Compositions comprising bacterial strains
EP3659613A1 (en) 2015-11-23 2020-06-03 4D Pharma Research Limited Compositions comprising bacterial strains
US10744166B2 (en) 2015-11-23 2020-08-18 4D Pharma Research Limited Compositions comprising bacterial strains
US9987311B2 (en) 2015-11-23 2018-06-05 4D Pharma Research Limited Compositions comprising bacterial strains
US10086022B2 (en) 2016-03-04 2018-10-02 4D Pharma Plc Compositions comprising bacterial strains
US10583158B2 (en) 2016-03-04 2020-03-10 4D Pharma Plc Compositions comprising bacterial strains
US10086023B2 (en) 2016-03-04 2018-10-02 4D Pharma Plc Compositions comprising bacterial strains
US11224620B2 (en) 2016-07-13 2022-01-18 4D Pharma Plc Compositions comprising bacterial strains
US10610548B2 (en) 2016-07-13 2020-04-07 4D Pharma Plc Compositions comprising bacterial strains
US10610549B2 (en) 2016-07-13 2020-04-07 4D Pharma Plc Composition comprising bacterial strains
US10960031B2 (en) 2016-07-13 2021-03-30 4D Pharma Plc Compositions comprising bacterial strains
US10080772B2 (en) 2016-07-13 2018-09-25 4D Pharma Plc Compositions comprising bacterial strains
US10086020B2 (en) 2016-07-13 2018-10-02 4D Pharma Plc Compositions comprising bacterial strains
US10967010B2 (en) 2016-07-13 2021-04-06 4D Pharma Plc Compositions comprising bacterial strains
WO2018088933A1 (en) * 2016-11-14 2018-05-17 Limited Liability Company "Panacela Labs" Anti-tumor effects of a viral vector encoding a toll-like receptor and a toll-like receptor agonist
US10543238B2 (en) 2016-12-12 2020-01-28 4D Pharma Plc Compositions comprising bacterial strains
US10485830B2 (en) 2016-12-12 2019-11-26 4D Pharma Plc Compositions comprising bacterial strains
US10086021B2 (en) 2016-12-12 2018-10-02 4D Pharma Plc Compositions comprising bacterial strains
US10898526B2 (en) 2016-12-12 2021-01-26 4D Pharma Plc Compositions comprising bacterial strains
US11123378B2 (en) 2017-05-22 2021-09-21 4D Pharma Research Limited Compositions comprising bacterial strains
US11382936B2 (en) 2017-05-22 2022-07-12 4D Pharma Research Limited Compositions comprising bacterial strains
US11376284B2 (en) 2017-05-22 2022-07-05 4D Pharma Research Limited Compositions comprising bacterial strains
US10987387B2 (en) 2017-05-24 2021-04-27 4D Pharma Research Limited Compositions comprising bacterial strain
EP3858367A1 (en) 2017-06-14 2021-08-04 4D Pharma Research Limited Compositions comprising bacterial strains
US12048720B2 (en) 2017-06-14 2024-07-30 Cj Bioscience, Inc. Compositions comprising bacterial strains
JP2020523341A (en) * 2017-06-14 2020-08-06 フォーディー ファーマ リサーチ リミテッド4D Pharma Research Limited Composition comprising a bacterial strain
US11123379B2 (en) 2017-06-14 2021-09-21 4D Pharma Research Limited Compositions comprising bacterial strains
US11779613B2 (en) 2017-06-14 2023-10-10 Cj Bioscience, Inc. Compositions comprising a bacterial strain of the genus Megasphera and uses thereof
US11007233B2 (en) 2017-06-14 2021-05-18 4D Pharma Research Limited Compositions comprising a bacterial strain of the genus Megasphera and uses thereof
WO2018229236A2 (en) 2017-06-14 2018-12-20 4D Pharma Research Limited Compositions comprising bacterial strains
US11660319B2 (en) 2017-06-14 2023-05-30 4D Pharma Research Limited Compositions comprising bacterial strains
EP3690026A4 (en) * 2017-09-28 2021-06-23 Kobiolabs, Inc. Composition for diagnosis and treatment of alcoholic liver disease, using change in short-chain fatty acid producing gut bacterial community
JP2020534858A (en) * 2017-09-28 2020-12-03 コバイオラブス,インコーポレーテッド Composition for diagnosis and treatment of alcoholic liver disease using changes in short-chain fatty acid-producing gut flora community
US11510948B2 (en) 2017-09-28 2022-11-29 Kobiolabs, Inc. Composition for diagnosis and treatment of alcoholic liver disease, using change in short-chain fatty acid producing gut bacterial community
JP7033655B2 (en) 2017-09-28 2022-03-10 コバイオラブス,インコーポレーテッド Composition for diagnosis and treatment of alcoholic liver disease using changes in short-chain fatty acid-producing intestinal bacterial community
WO2019141997A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
WO2019141998A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
WO2019141999A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
WO2019141996A1 (en) 2018-01-19 2019-07-25 4D Pharma Research Limited Combination therapy for treating or preventing cancer
US11419931B2 (en) 2018-03-19 2022-08-23 4D Pharma Research Limited Compositions comprising bacterial strains
US11857614B2 (en) 2018-03-19 2024-01-02 Cj Bioscience, Inc. Enterococcus gallinarum flagellin polypeptides
US11419902B2 (en) 2018-05-11 2022-08-23 4D Pharma Research Limited Compositions comprising bacterial strains
WO2019215345A1 (en) 2018-05-11 2019-11-14 4D Pharma Research Limited Compositions comprising bacterial strains
WO2019215346A1 (en) 2018-05-11 2019-11-14 4D Pharma Research Limited Compositions comprising bacterial strains
WO2019238969A1 (en) 2018-06-14 2019-12-19 4D Pharma Research Ltd Compositions comprising bacterial strains
EP3922256A1 (en) 2018-06-25 2021-12-15 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020002370A1 (en) 2018-06-25 2020-01-02 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020016252A1 (en) 2018-07-16 2020-01-23 4D Pharma Research Limited Compositions comprising bacterial strains
US11504405B2 (en) 2018-07-16 2022-11-22 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020035623A1 (en) 2018-08-17 2020-02-20 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020058499A1 (en) 2018-09-20 2020-03-26 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020074569A1 (en) 2018-10-09 2020-04-16 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020079282A1 (en) 2018-10-19 2020-04-23 4D Pharma Research Ltd Compositions comprising bacterial strains
WO2020089488A1 (en) 2018-11-02 2020-05-07 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020120716A1 (en) 2018-12-12 2020-06-18 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020120714A1 (en) 2018-12-12 2020-06-18 4D Pharma Research Limited Compositions comprising bacterial strains
US11446336B2 (en) 2018-12-12 2022-09-20 4D Pharma Research Limited Compositions comprising bacterial strains
WO2020120717A1 (en) 2018-12-12 2020-06-18 4D Pharma Research Limited Compositions comprising parabacteroides bacterial strains for treating cancer
WO2020229428A1 (en) 2019-05-10 2020-11-19 4D Pharma Research Limited Compositions comprising bacterial strains
WO2021004958A2 (en) 2019-07-05 2021-01-14 4D Pharma Research Limited Compositions comprising bacterial strains
WO2021098991A1 (en) 2019-11-20 2021-05-27 4D Pharma Research Limited Compositions comprising bacterial strains
WO2021099624A1 (en) 2019-11-20 2021-05-27 4D Pharma Research Limited Compositions comprising a bacterial strain of the genus fusicatenibacter
EP3838281A1 (en) 2019-12-20 2021-06-23 4D Pharma Research Limited Compositions comprising bacterial strains
WO2021123378A1 (en) 2019-12-20 2021-06-24 4D Pharma Research Limited Compositions comprising bacterial strains
WO2021151946A1 (en) 2020-01-27 2021-08-05 4D Pharma Research Limited Compositions comprising bacterial strains

Also Published As

Publication number Publication date
RU2015147864A (en) 2017-05-12
LT3010523T (en) 2018-03-12
EP3010523A1 (en) 2016-04-27
RS56909B1 (en) 2018-05-31
DK3318268T3 (en) 2021-12-20
CY1120177T1 (en) 2018-12-12
MX363015B (en) 2019-03-04
US20150071957A1 (en) 2015-03-12
JP2016517848A (en) 2016-06-20
CN105407908A (en) 2016-03-16
RU2682651C2 (en) 2019-03-20
US9796762B2 (en) 2017-10-24
HRP20211643T1 (en) 2022-04-01
MX2015014281A (en) 2017-03-01
BR112015025854A8 (en) 2019-12-24
SI3318268T1 (en) 2021-11-30
ES2898918T3 (en) 2022-03-09
CY1124805T1 (en) 2022-11-25
AU2014202021B2 (en) 2019-02-28
CA2848725A1 (en) 2014-10-10
ME03020B (en) 2018-10-20
ES2660823T3 (en) 2018-03-26
JP6641262B2 (en) 2020-02-05
GB201306536D0 (en) 2013-05-22
US11414463B2 (en) 2022-08-16
US20210054031A1 (en) 2021-02-25
AU2019203688B2 (en) 2020-10-15
AU2019203688A1 (en) 2019-06-20
US10851137B2 (en) 2020-12-01
RS62599B1 (en) 2021-12-31
HUE036109T2 (en) 2018-06-28
TR201802752T4 (en) 2018-03-21
SI3010523T1 (en) 2018-06-29
US20180072778A1 (en) 2018-03-15
SMT202100690T1 (en) 2022-01-10
PT3318268T (en) 2021-11-30
HUE056167T2 (en) 2022-01-28
RU2015147864A3 (en) 2018-04-25
EP3318268A1 (en) 2018-05-09
PL3318268T3 (en) 2022-01-24
EP3010523B1 (en) 2017-11-29
JP2022050448A (en) 2022-03-30
NO3010523T3 (en) 2018-04-28
LT3318268T (en) 2021-11-10
DK3010523T3 (en) 2018-02-19
JP2020075925A (en) 2020-05-21
BR112015025854A2 (en) 2017-07-25
EP3318268B1 (en) 2021-09-15
HRP20180360T1 (en) 2018-04-20
HK1223289A1 (en) 2017-07-28
PL3010523T3 (en) 2018-05-30
SMT201800122T1 (en) 2018-05-02
PT3010523T (en) 2018-03-08
AU2014202021A1 (en) 2014-10-30

Similar Documents

Publication Publication Date Title
US11414463B2 (en) Polypeptide and immune modulation
AU2017202497B2 (en) Bacterium for use as a probiotic for nutritional and medical applications
HK1247090A1 (en) Roseburia flagellin and immune modulation
HK1247090B (en) Roseburia flagellin and immune modulation
HK1223289B (en) Roseburia flagellin and immune modulation
HK1230077A (en) Bacterium for use as a probiotic for nutritional and medical applications
HK1230077A1 (en) Bacterium for use as a probiotic for nutritional and medical applications
HK1230077B (en) Bacterium for use as a probiotic for nutritional and medical applications
HK1200116B (en) Bacterium for use as a probiotic for nutritional and medical applications
NZ764713B2 (en) A Bacteroides thetaiotaomicron strain and its use in reducing inflammation

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201480033216.6

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14717823

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2016507061

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/014281

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

REEP Request for entry into the european phase

Ref document number: 2014717823

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2014717823

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2015147864

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015025854

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112015025854

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20151009