WO2014165985A1 - Use of antibody-urease conjugates for diagnostic and therapeutic purposes - Google Patents

Use of antibody-urease conjugates for diagnostic and therapeutic purposes Download PDF

Info

Publication number
WO2014165985A1
WO2014165985A1 PCT/CA2014/050334 CA2014050334W WO2014165985A1 WO 2014165985 A1 WO2014165985 A1 WO 2014165985A1 CA 2014050334 W CA2014050334 W CA 2014050334W WO 2014165985 A1 WO2014165985 A1 WO 2014165985A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
urease
conjugate
enzyme
antibodies
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2014/050334
Other languages
French (fr)
Inventor
Heman Chao
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Helix Biopharma Corp
Original Assignee
Helix Biopharma Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Helix Biopharma Corp filed Critical Helix Biopharma Corp
Priority to US14/783,153 priority Critical patent/US10316311B2/en
Priority to CN201480025121.XA priority patent/CN105247047A/en
Priority to EP14782795.0A priority patent/EP2984170B1/en
Priority to CA2908475A priority patent/CA2908475C/en
Priority to JP2016505666A priority patent/JP2016524459A/en
Priority to HK16104650.5A priority patent/HK1216903A1/en
Priority to AU2014252666A priority patent/AU2014252666B2/en
Publication of WO2014165985A1 publication Critical patent/WO2014165985A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14—Hydrolases (3)
    • C12N9/78—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • C12N9/80—Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5) acting on amide bonds in linear amides (3.5.1)
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6815—Enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/96—Stabilising an enzyme by forming an adduct or a composition; Forming enzyme conjugates
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12Y—ENZYMES
    • C12Y305/00—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/01—Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in linear amides (3.5.1)
    • C12Y305/01005—Urease (3.5.1.5)

Definitions

  • This disclosure provides antibody-urease conjugates having therapeutic and diagnostic utility. More specifically, the disclosure relates to diagnostic and/or therapeutic conjugates that are prepared by conjugating one or more whole antibodies to urease.
  • Cancer accounts for one-fifth of the total mortality in the United States, and is the second leading cause of death. Cancer is typically characterized by the uncontrolled division of a population of cells. This uncontrolled division may involve blood cells, such as various types of lymphomas, or cells that aggregate in or are native to a particular tissue or organ, e.g., solid tumors, such as secondary or primary tumors of the breast, lung, liver, esophagus, stomach, intestines, brain, bone, or prostate.
  • blood cells such as various types of lymphomas, or cells that aggregate in or are native to a particular tissue or organ, e.g., solid tumors, such as secondary or primary tumors of the breast, lung, liver, esophagus, stomach, intestines, brain, bone, or prostate.
  • a variety of treatment modalities have been proposed for cancer therapy.
  • One such treatment modality relates to the use of particular enzymes to inhibit growth of cancer cells.
  • urease an enzyme that catalyzes the hydrolysis of urea into carbon dioxide and ammonia. More specifically, urease catalyzes the hydrolysis of urea to produce ammonia and carbamate, the carbamate produced is subsequently degraded by spontaneous hydrolysis to produce another ammonia and carbonic acid. In this regard, urease activity tends to increase the pH of the local environment in which it is as it produces
  • ammonia as it is a basic molecule.
  • the antibody employed need only to have a high binding affinity to the corresponding antigen.
  • therapeutic antibodies can be used with the urease, ongoing clinical trials employ only a high affinity antibody fragment.
  • the conjugate comprises one or two antibodies covalently bound to a urease enzyme to form an antibody-urease conjugate said conjugate optionally containing bound to either the urease or the antibody one or more therapeutic agents.
  • an antibody-urease conjugate comprising an antibody covalently bound to a urease enzyme to form an antibody-urease conjugate.
  • the conjugate further comprises a therapeutic agent covalently bound to the antibody or the urease enzyme.
  • the antibody-urease conjugate comprises at least two antibodies covalently bound to the urease enzyme. In some aspects, at least one of the antibodies is covalently bound to the urease enzyme at two or more sites. In some aspects, at least one of the antibodies is covalently bound to the urease enzyme at three or more sites. In some aspects, each of the antibodies is covalently bound to the urease enzyme at two or more sites.
  • the antibodies is a full antibody.
  • the full antibody in some aspects, comprises at least two Fab fragments and an Fc fragment.
  • the full antibody has a molecular weight that is at least 120 kDa, or 130 kDa, or 140 kDa or 150 kDa.
  • the full antibody is covalently bound to the urease enzyme at two or more sites.
  • the antibodies are not directed to aberrant prions. [0011]
  • compositions and methods are intended to mean that the compositions and methods include the recited elements, but not excluding others.
  • Consisting essentially of when used to define compositions and methods shall mean excluding other elements of any essential significance to the combination for the stated purpose. Thus, a composition or process consisting essentially of the elements as defined herein would not exclude other materials or steps that do not materially affect the basic and novel characteristic(s) of the claimed disclosure.
  • Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps. Embodiments defined by each of these transition terms are within the scope of this disclosure.
  • Urease refers to an enzyme having the enzymatic activity of a urea amidohydrolase (E.C. 3.5.1.5), either naturally occurring or obtained by, e.g., recombinant nucleic acid techniques and/or chemical synthesis. Urease also includes fusion proteins comprising the entire urease, subunits, or fragments thereof, and/or urease with amino acid substitutions, deletions or additions that preserve the urea amidohydrolase activity of the polypeptide.
  • urea amidohydrolase E.C. 3.5.1.5
  • Urease also includes fusion proteins comprising the entire urease, subunits, or fragments thereof, and/or urease with amino acid substitutions, deletions or additions that preserve the urea amidohydrolase activity of the polypeptide.
  • a “conjugate” refers to two or more molecules that are covalently linked to form a larger construct.
  • the conjugate includes the urease enzyme bound to one or two antibodies which are covalently linked.
  • the linkage is a direct linkage wherein a reactive functional group on the urease binds to a complementary reactive functional group on the antibody such as an amino functionality of lysine binding to a carboxyl functionality of aspartic or glutamic acid. It being understood, that such reactions may require conventional modification of the carboxyl group to render it more reactive.
  • the linkage is through a linker having two or more functionalities, such as carboxy or amino, that allow it to react with both the ureases and the antibody.
  • Linkers are well known in the art and typically comprise from 1-20 atoms including carbon, nitrogen, hydrogen, oxygen, sulfur and the like.
  • the reactive functionalities can be the same such as oxalic acid, succinic acid, and the like or can be orthogonal functionalities such as amino (which becomes NH after conjugation) and carboxyl (which becomes CO or COO after conjugation) groups.
  • a suitable linker is R ! -L-R 2 , wherein R 1 and R 2 are the same or different functional groups, one of which is connected to the antibody and the other is connected to urease.
  • L can be a straight or branched-hydrocarbon chain, such as an alkyl chain, wherein one or more of the carbons are optionally replaced with oxygen, nitrogen, amide, sulfur, sulfoxide, sulfone, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, etc.
  • the linker can be an amino acid residue or a peptide. In some circumstances, the linker is cleavable by an enzyme or change in pH at or approximate to the target site.
  • antibody refers to a complete or substantially complete mammalian antibody including those obtained from mice, llamas, pigs, rats, bovine, ovine, and the like.
  • a substantially complete antibody contains at least 90 percent homology to the complete antibody or is truncated to include the binding site of the antibody and at least 70% of the complete antibody.
  • Antibody fragments such as those containing less than 70% of the antibody are not within the definition of antibodies in this disclosure.
  • an “antibody fragment” refers to a portion of a complete antibody that is less than 70% of the antibody.
  • the antibody recognizes a diseased antigen such as a cancer antigen.
  • the antigen is not a prion antigen.
  • therapeutic agent refers to any agent which provides for a therapeutic or prophylactic result against a given disease or disease causing agent such as a microbe.
  • the therapeutic agent is an anti-cancer agent such as doxorubicin, daunomycin, epirubicin, vinblastine, vincristine, mitoxantrone, bleomycin, mitomycin, mechlorethamine and the like.
  • treat include alleviating, abating or ameliorating a disease or condition or one or more symptoms thereof, preventing additional symptoms, ameliorating or preventing the underlying metabolic causes of symptoms, inhibiting the disease or condition, e.g., arresting or suppressing the development of the disease or condition, relieving the disease or condition, causing regression of the disease or condition, relieving a condition caused by the disease or condition, or suppressing the symptoms of the disease or condition, and are intended to include prophylaxis.
  • the terms also include relieving the disease or conditions, e.g., causing the regression of clinical symptoms.
  • the terms further include achieving a therapeutic benefit and/or a prophylactic benefit.
  • compositions are administered to an individual at risk of developing a particular disease, or to an individual reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease has not been made.
  • the disclosure is directed to the conjugation of one to two or more antibodies with urease.
  • Such conjugation is contemplated to increase the binding affinity of the antibody-urease conjugate to the antigenic target as the antibody is approximately the same size as that of urease thereby reducing significantly any steric hinderance arising from the use of antibody fragments.
  • This increase in affinity permits the use of 1 or 2 antibodies per urease.
  • the antibody-urease conjugates of the disclosure can be bound directly to the one or two antibodies, optionally through a linker.
  • the increased size of the antibody as compared to antibody fragments permit the use of multiple sites of conjugation to stabilize the binding.
  • the conjugate includes from 1 to 8 conjugations sites between a single antibody and a single urease enzyme.
  • the number of conjugation sites is from 2 to 8.
  • the conjugate includes from 2, or 3, or 4 to 8 conjugation sites between a single antibody and a single urease enzyme.
  • the number of conjugation sites is at least 2, 3, or 4.
  • additional components such as but not limited to, therapeutic agents such as anti-cancer agents can also be bound to the antibodies to further enhance the therapeutic effect.
  • the antibody is not directed to aberrant prions.
  • the antibody is comparable in size to the urease which is atypical due to the large size of the urease.
  • whole antibodies which are generally about 150 kDa, necessitates the use of antibody fragments for conjugation to an enzyme so as to provide for suitable results.
  • the conjugate used is advantageously an antibody-urease conjugate which allows for higher binding affinities as well as enhanced stability especially when multiple conjugation sites are employed. This is possible due to the uniquely large and amorphous size of the urease enzyme, e.g., 545 kDa for Jack Bean urease (calculated mass from the amino acid sequence).
  • the size of an exemplary urease also allows for multiple points of conjugation between the antibodies and the enzyme which can further stabilize the binding between the antibodies and urease, providing a 1: 1, 2: 1 or possibly 3:1 binding ratio of antibody:urease.
  • the antibody-urease conjugates can be humanized as necessary to further reduce or inhibit immunological rejection.
  • jack bean urease As mentioned above, one exemplary plant urease is jack bean urease.
  • An exemplary amino acid sequence of jack bean urease is represented by SEQ ID NO: 1 below.
  • Other useful urease sequences may be identified in public databases, e.g., Entrez
  • the urease is jack bean urease having SEQ ID No.1 , as shown below:
  • an "antibody” or “antigen-binding polypeptide” refers to a polypeptide or a polypeptide complex that specifically recognizes and binds to an antigen.
  • An antibody can be a full antibody and any antigen binding fragment or a single chain thereof.
  • a “full antibody” refers to an antibody that includes, among others, two antigen-binding regions (Fab) and an Fc fragment.
  • Fab antigen-binding regions
  • Fc fragment fragment-binding region
  • a variety of antibodies may be employed in the practice of the disclosure. For example, both polyclonal and monoclonal antibodies may be employed. Monoclonal antibodies may be produced in accordance with conventional techniques, such as hybridoma synthesis, recombinant DNA techniques and protein synthesis.
  • the antibody is not directed to aberrant prions.
  • the antibody-urease conjugates of the disclosure can be prepared by any conventional means known in the art.
  • antibodies can be conjugated to a urease enzyme either directly or through a linker.
  • Means of chemically conjugating molecules are well known to those of skill in the art. Methods of conjugating an antibody to urease are disclosed, for example, in US Patent Nos. 7,211,250 and 7,264,800, the contents of which are incorporated herein by reference in their entirety.
  • Methods are also provided, in some embodiments, to stabilize urease enzymes by conjugating a urease enzyme with one or two or more antibodies for a urease enzyme-antibody conjugate as described in the present disclosure.
  • Such conjugation is contemplated to increase the binding affinity of the antibody-urease conjugate to the antigenic target as the antibody is approximately the same size as that of urease thereby reducing significantly any steric hinderance arising from the use of antibody fragments.
  • This increase in affinity permits the use of 1 or 2 antibodies per urease.
  • the antibody-urease conjugates of the disclosure can be bound directly to the one or two antibodies, optionally through a linker. The increased size of the antibody as compared to antibody fragments permit the use of multiple sites of conjugation to stabilize the binding.
  • the conjugate includes from 1 to 8 conjugations sites between a single antibody and a single urease enzyme. In another embodiment the number of conjugation sites is from 2 to 8. In one embodiment, the conjugate includes from 2, or 3, or 4 to 8 conjugation sites between a single antibody and a single urease enzyme. In another embodiment the number of conjugation sites is at least 2, 3, or 4.
  • the antibody and urease enzyme form at least a bond, such as a covalent or an ionic bond that prevents or decreases dissociation between the antibody and the urease.
  • the bond is labile, such that the bond will degrade at certain in vivo environment (e.g., near a tumor cell wherein the pH is different from normal tissue).
  • the bond is non-labile and stable at normal physiological conditions.
  • An antibody-urease conjugate is prepared by conjugating anti-ErbB2 monoclonal antibody 4D5 with urease using SIAB (succinimidyl-(4-iodoacetyl)aminobenzoate) as a linker.
  • SIAB succinimidyl-(4-iodoacetyl)aminobenzoate
  • SIAB is a mid-length crosslinker for amine-to-sulfhydryl conjugation via N-hydroxysuccinimide (NHS) ester and iodoacetyl reactive groups. It yields a spacer arm of about 10.6 Angstroms in length. It is available commercially from Thermo Scientific, and its use in conjugation is described for instance by Hermanson, Bioconjugate Techniques, 1996, San Diego, Academic Press pp. 542, 553, 568. The degree of conjugation can be increased by increasing the amount of linker used relative to the antibody. Furthermore, the antibody can be first treated with the linker by using multiple equivalents of linker, the combination of which can thereafter be combined with urease.
  • NHS N-hydroxysuccinimide

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)

Abstract

This disclosure provides antibody-urease conjugates having therapeutic and diagnostic utility. More specifically, the disclosure relates to diagnostic and/or therapeutic conjugates that are prepared by conjugating one or more whole antibodies to urease.

Description

USE OF ANTIBODY-UREASE CONJUGATES FOR DIAGNOSTIC AND
THERAPEUTIC PURPOSES
FIELD OF THE DISCLOSURE
[0001] This disclosure provides antibody-urease conjugates having therapeutic and diagnostic utility. More specifically, the disclosure relates to diagnostic and/or therapeutic conjugates that are prepared by conjugating one or more whole antibodies to urease.
BACKGROUND
[0002] Cancer accounts for one-fifth of the total mortality in the United States, and is the second leading cause of death. Cancer is typically characterized by the uncontrolled division of a population of cells. This uncontrolled division may involve blood cells, such as various types of lymphomas, or cells that aggregate in or are native to a particular tissue or organ, e.g., solid tumors, such as secondary or primary tumors of the breast, lung, liver, esophagus, stomach, intestines, brain, bone, or prostate.
[0003] A variety of treatment modalities have been proposed for cancer therapy. One such treatment modality relates to the use of particular enzymes to inhibit growth of cancer cells.
One such enzyme known in the art is urease, an enzyme that catalyzes the hydrolysis of urea into carbon dioxide and ammonia. More specifically, urease catalyzes the hydrolysis of urea to produce ammonia and carbamate, the carbamate produced is subsequently degraded by spontaneous hydrolysis to produce another ammonia and carbonic acid. In this regard, urease activity tends to increase the pH of the local environment in which it is as it produces
ammonia, as it is a basic molecule.
[0004] The concept of using antibodies to target tumor associated antigens in the treatment of cancer has been appreciated for some time (Herlyn et. al., (1980) Cancer Research 40, 717). However, as to urease, the toxic component is the alkaline environment produced by
enzymatic degradation of urine. In such a case, the antibody employed need only to have a high binding affinity to the corresponding antigen. Although therapeutic antibodies can be used with the urease, ongoing clinical trials employ only a high affinity antibody fragment.
This approach provides for several unique considerations including the fact that urease is an exceptionally large enzyme while the antibody fragments are significantly smaller. To address possible steric hinderence arising from the size of the urease, it is conventional to use multiple copies of the non-human antibody fragment.
[0005] As multiple copies of these fragments are used to ensure proper binding, limitations as to the inclusion of other components on the antibody. Moreover, as binding sites on the antibody fragment may be limited, binding of each antibody fragment to the urease is through a single tether. Still further, while immunogenicity of the antibody fragment appears to be minimal, a non-immunogenic approach would eliminate even the smallest likelihood of an adverse immune response or the need to co-administer an immunosuppressive agent.
SUMMARY
[0006] This disclosure is directed to an antibody-urease conjugate. The conjugate comprises one or two antibodies covalently bound to a urease enzyme to form an antibody-urease conjugate said conjugate optionally containing bound to either the urease or the antibody one or more therapeutic agents.
[0007] In one embodiment, provided is an antibody-urease conjugate comprising an antibody covalently bound to a urease enzyme to form an antibody-urease conjugate. In one aspect, the conjugate further comprises a therapeutic agent covalently bound to the antibody or the urease enzyme.
[0008] In one aspect, the antibody-urease conjugate comprises at least two antibodies covalently bound to the urease enzyme. In some aspects, at least one of the antibodies is covalently bound to the urease enzyme at two or more sites. In some aspects, at least one of the antibodies is covalently bound to the urease enzyme at three or more sites. In some aspects, each of the antibodies is covalently bound to the urease enzyme at two or more sites.
[0009] In some aspects, at least one of the antibodies is a full antibody. The full antibody, in some aspects, comprises at least two Fab fragments and an Fc fragment. In some aspects, the full antibody has a molecular weight that is at least 120 kDa, or 130 kDa, or 140 kDa or 150 kDa. In some aspects, the full antibody is covalently bound to the urease enzyme at two or more sites. [0010] In some aspects, the antibodies are not directed to aberrant prions. [0011] These and other aspects of the disclosure are further described below.
DETAILED DESCRIPTION OF THE DISCLOSURE
Definitions
[0012] It must be noted that as used herein and in the appended claims, the singular forms "a", "an", and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "a solvent" includes a plurality of such solvents.
[0013] As used herein, the term "comprising" or "comprises" is intended to mean that the compositions and methods include the recited elements, but not excluding others. "Consisting essentially of when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the stated purpose. Thus, a composition or process consisting essentially of the elements as defined herein would not exclude other materials or steps that do not materially affect the basic and novel characteristic(s) of the claimed disclosure. "Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps. Embodiments defined by each of these transition terms are within the scope of this disclosure.
[0014] Unless otherwise indicated, all numbers expressing quantities of ingredients, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term "about." Accordingly, unless indicated to the contrary, the numerical parameters set forth in the following specification and attached claims are
approximations. Each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. The term "about" when used before a numerical designation, e.g., temperature, time, amount, and concentration, including range, indicates approximations which may vary by ( + ) or ( - ) 10 %, 5 % or 1 %.
[0015] The term "urease" refers to an enzyme having the enzymatic activity of a urea amidohydrolase (E.C. 3.5.1.5), either naturally occurring or obtained by, e.g., recombinant nucleic acid techniques and/or chemical synthesis. Urease also includes fusion proteins comprising the entire urease, subunits, or fragments thereof, and/or urease with amino acid substitutions, deletions or additions that preserve the urea amidohydrolase activity of the polypeptide.
[0016] A "conjugate" refers to two or more molecules that are covalently linked to form a larger construct. In some embodiments, the conjugate includes the urease enzyme bound to one or two antibodies which are covalently linked. In one aspect, the linkage is a direct linkage wherein a reactive functional group on the urease binds to a complementary reactive functional group on the antibody such as an amino functionality of lysine binding to a carboxyl functionality of aspartic or glutamic acid. It being understood, that such reactions may require conventional modification of the carboxyl group to render it more reactive.
[0017] In another aspect, the linkage is through a linker having two or more functionalities, such as carboxy or amino, that allow it to react with both the ureases and the antibody. Linkers are well known in the art and typically comprise from 1-20 atoms including carbon, nitrogen, hydrogen, oxygen, sulfur and the like. The reactive functionalities can be the same such as oxalic acid, succinic acid, and the like or can be orthogonal functionalities such as amino (which becomes NH after conjugation) and carboxyl (which becomes CO or COO after conjugation) groups.
[0018] In one aspect, a suitable linker is R!-L-R2, wherein R1 and R2 are the same or different functional groups, one of which is connected to the antibody and the other is connected to urease. R1 and R2 can be independently selected from -NH-, -CO-, -COO-, -0-, -S-, -NHNH-, -N=N-, =N-NH-, etc. L can be a straight or branched-hydrocarbon chain, such as an alkyl chain, wherein one or more of the carbons are optionally replaced with oxygen, nitrogen, amide, sulfur, sulfoxide, sulfone, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, etc. In another aspect, the linker can be an amino acid residue or a peptide. In some circumstances, the linker is cleavable by an enzyme or change in pH at or approximate to the target site. Certain linkers and procedures suitable for preparing conjugates are described in U.S. Pat. Nos. 4,414,148, 4,545,985, 4,569,789, 4,671,958, 4,659,839, 4,680,338, 4,699,784, 4,894,443, and 6,521,431. [0019] The term "antibody" refers to a complete or substantially complete mammalian antibody including those obtained from mice, llamas, pigs, rats, bovine, ovine, and the like. A substantially complete antibody contains at least 90 percent homology to the complete antibody or is truncated to include the binding site of the antibody and at least 70% of the complete antibody. Antibody fragments such as those containing less than 70% of the antibody are not within the definition of antibodies in this disclosure. As used herein, an "antibody fragment" refers to a portion of a complete antibody that is less than 70% of the antibody. Preferably, the antibody recognizes a diseased antigen such as a cancer antigen. However, preferably the antigen is not a prion antigen.
[0020] The term "therapeutic agent" refers to any agent which provides for a therapeutic or prophylactic result against a given disease or disease causing agent such as a microbe. Preferably, the therapeutic agent is an anti-cancer agent such as doxorubicin, daunomycin, epirubicin, vinblastine, vincristine, mitoxantrone, bleomycin, mitomycin, mechlorethamine and the like.
[0021] The terms "treat", "treating" or "treatment", as used herein, include alleviating, abating or ameliorating a disease or condition or one or more symptoms thereof, preventing additional symptoms, ameliorating or preventing the underlying metabolic causes of symptoms, inhibiting the disease or condition, e.g., arresting or suppressing the development of the disease or condition, relieving the disease or condition, causing regression of the disease or condition, relieving a condition caused by the disease or condition, or suppressing the symptoms of the disease or condition, and are intended to include prophylaxis. The terms also include relieving the disease or conditions, e.g., causing the regression of clinical symptoms. The terms further include achieving a therapeutic benefit and/or a prophylactic benefit. By therapeutic benefit is meant eradication or amelioration of the underlying disorder being treated. Also, a therapeutic benefit is achieved with the eradication or amelioration of one or more of the physiological symptoms associated with the underlying disorder such that an improvement is observed in the individual, notwithstanding that the individual is still be afflicted with the underlying disorder. For prophylactic benefit, the compositions are administered to an individual at risk of developing a particular disease, or to an individual reporting one or more of the physiological symptoms of a disease, even though a diagnosis of this disease has not been made.
Antibody-Urease Con jugates
[0022] The disclosure is directed to the conjugation of one to two or more antibodies with urease. Such conjugation is contemplated to increase the binding affinity of the antibody-urease conjugate to the antigenic target as the antibody is approximately the same size as that of urease thereby reducing significantly any steric hinderance arising from the use of antibody fragments. This increase in affinity permits the use of 1 or 2 antibodies per urease. Furthermore, the antibody-urease conjugates of the disclosure can be bound directly to the one or two antibodies, optionally through a linker. The increased size of the antibody as compared to antibody fragments permit the use of multiple sites of conjugation to stabilize the binding. In one embodiment, the conjugate includes from 1 to 8 conjugations sites between a single antibody and a single urease enzyme. In another embodiment the number of conjugation sites is from 2 to 8. In one embodiment, the conjugate includes from 2, or 3, or 4 to 8 conjugation sites between a single antibody and a single urease enzyme. In another embodiment the number of conjugation sites is at least 2, 3, or 4.
[0023] Even further, additional components, such as but not limited to, therapeutic agents such as anti-cancer agents can also be bound to the antibodies to further enhance the therapeutic effect. In one preferred embodiment, the antibody is not directed to aberrant prions.
[0024] Typically, the antibody is comparable in size to the urease which is atypical due to the large size of the urease. Heretofore, whole antibodies, which are generally about 150 kDa, necessitates the use of antibody fragments for conjugation to an enzyme so as to provide for suitable results. In this context, the inventors have discovered that due to the comparable size of the urease to the antibody, the conjugate used is advantageously an antibody-urease conjugate which allows for higher binding affinities as well as enhanced stability especially when multiple conjugation sites are employed. This is possible due to the uniquely large and amorphous size of the urease enzyme, e.g., 545 kDa for Jack Bean urease (calculated mass from the amino acid sequence). Additionally, the size of an exemplary urease also allows for multiple points of conjugation between the antibodies and the enzyme which can further stabilize the binding between the antibodies and urease, providing a 1: 1, 2: 1 or possibly 3:1 binding ratio of antibody:urease.
[0025] In another embodiment, the antibody-urease conjugates can be humanized as necessary to further reduce or inhibit immunological rejection. Urease
[0026] A number of studies have provided detailed information about the genetics of ureases from a variety of evolutionarily diverse bacteria, plants, fungi and viruses (Mobley, H. L. T. et al. (1995) Microbiol. Rev. 59: 451-480; Eur J. Biochem., 175, 151-165 (1988); Labigne, A. (1990) International publication No. WO 90/04030; Clayton, C. L. et al. (1990) Nucleic Acid Res. 18, 362; and U.S. Pat. Nos. 6,248,330 and 5,298,399, each of which is incorporated herein by reference). Of particular interest is urease that is found in plants (Sirko, A. and Brodzik, R. (2000) Acta Biochim Pol 47(4): 1189-95). As mentioned above, one exemplary plant urease is jack bean urease. An exemplary amino acid sequence of jack bean urease is represented by SEQ ID NO: 1 below. Other useful urease sequences may be identified in public databases, e.g., Entrez
(ncbi.nlm.nih.gov/Entrez).
[0027] In embodiments of the disclosure, the urease is jack bean urease having SEQ ID No.1 , as shown below:
MKLSPREVEKLGLHNAGYLAQKRLARGVRLNYTEAVALIASQIM EYARDGEKTVAQLMCLGQHLLGRRQVLPAVPHLLNAVQVEATFP DGTKLVTVHDPISRENGELQEALFGSLLPVPSLDKFAETKEDNR IPGEILCEDECLTLNIGRKAVILKVTSKGDRPIQVGSHYHFIEV NPYLTFDRRKAYGMRLNIAAGTAVRFEPGDCKSVTLVSIEGNKV IRGGNAIADGPVNETNLEAAMHAVRSKGFGHEEEKDASEGFTKE DPNCPFNTFIHRKEYANKYGPTTGDKIRLGDTNLLAEIEKDYAL YGDECVFGGGKVIRDGMGQSCGHPPAI SLDTVITNAVIIDYTGI IKADIGIKDGLIASIGKAGNPDIMNGVFSNMIIGANTEVIAGEG LIVTAGAIDCHVHYICPQLVYEAISSGITTLVGGGTGPAAGTRA TTCTPSPTQMRLMLQSTDDLPLNFGFTGKGSSSKPDELHEI IKA GAMGLKLHEDWGSTPAAIDNCLTIAEHHDIQINIHTDTLNEAGF VEHSIAAFKGRTIHTYHSEGAGGGHAPDIIKVCGIKNVLPSSTN PTRPLTSNTIDEHLDMLMVCHHLDREIPEDLAFAHSRIRKKTIA AEDVLNDIGAISIISSDSQAMGRVGEVISRTWQTADKMKAQTGP LKCDSSDNDNFRIRRYIAKYTI PAlANGFSQYVGSVEVGKLAD
LVMWKPSFFGTKPEMVIKGGMVAWADIGDPNASIPTPEPVKMRP MYGTLGKAGGALSIAFVSKAALDQRVNVLYGLNKRVEAVSNVRK LTKLDMKLNDALPEITVDPESYTVKADGKLLCVSEATTVPLSRN
YFLF ( SEQ I D No . l )
Antibodies
[0028] As used herein, an "antibody" or "antigen-binding polypeptide" refers to a polypeptide or a polypeptide complex that specifically recognizes and binds to an antigen. An antibody can be a full antibody and any antigen binding fragment or a single chain thereof.
[0029] A "full antibody" refers to an antibody that includes, among others, two antigen-binding regions (Fab) and an Fc fragment. In some embodiments, a full antibody includes two light chains and two heavy chains.
[0030] A variety of antibodies may be employed in the practice of the disclosure. For example, both polyclonal and monoclonal antibodies may be employed. Monoclonal antibodies may be produced in accordance with conventional techniques, such as hybridoma synthesis, recombinant DNA techniques and protein synthesis.
[0031] In a preferred embodiment, the antibody is not directed to aberrant prions. Conjugation
[0032] The antibody-urease conjugates of the disclosure can be prepared by any conventional means known in the art. For example, antibodies can be conjugated to a urease enzyme either directly or through a linker. Means of chemically conjugating molecules are well known to those of skill in the art. Methods of conjugating an antibody to urease are disclosed, for example, in US Patent Nos. 7,211,250 and 7,264,800, the contents of which are incorporated herein by reference in their entirety.
Stabilizing Ureases
[0033] Methods are also provided, in some embodiments, to stabilize urease enzymes by conjugating a urease enzyme with one or two or more antibodies for a urease enzyme-antibody conjugate as described in the present disclosure. Such conjugation is contemplated to increase the binding affinity of the antibody-urease conjugate to the antigenic target as the antibody is approximately the same size as that of urease thereby reducing significantly any steric hinderance arising from the use of antibody fragments. This increase in affinity permits the use of 1 or 2 antibodies per urease. Furthermore, the antibody-urease conjugates of the disclosure can be bound directly to the one or two antibodies, optionally through a linker. The increased size of the antibody as compared to antibody fragments permit the use of multiple sites of conjugation to stabilize the binding. In one embodiment, the conjugate includes from 1 to 8 conjugations sites between a single antibody and a single urease enzyme. In another embodiment the number of conjugation sites is from 2 to 8. In one embodiment, the conjugate includes from 2, or 3, or 4 to 8 conjugation sites between a single antibody and a single urease enzyme. In another embodiment the number of conjugation sites is at least 2, 3, or 4.
[0034] In some embodiments, the antibody and urease enzyme form at least a bond, such as a covalent or an ionic bond that prevents or decreases dissociation between the antibody and the urease. In one aspect, the bond is labile, such that the bond will degrade at certain in vivo environment (e.g., near a tumor cell wherein the pH is different from normal tissue). In another aspect, the bond is non-labile and stable at normal physiological conditions.
EXAMPLES
[0035] The following examples are given for the purpose of illustrating various embodiments of the disclosure. They are not meant to limit the disclosure in any fashion. One skilled in the art will appreciate that the disclosure is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well any objects, ends and advantages inherent herein. The present examples (along with the methods described herein) are presently representative of preferred embodiments. They are exemplary, and are not intended as limitations on the scope of the disclosure. Variations and other uses which are encompassed within the spirit of the disclosure as defined by the scope of the claims will occur to those skilled in the art.
EXAMPLE 1
[0036] An antibody-urease conjugate is prepared by conjugating anti-ErbB2 monoclonal antibody 4D5 with urease using SIAB (succinimidyl-(4-iodoacetyl)aminobenzoate) as a linker.
SIAB is a mid-length crosslinker for amine-to-sulfhydryl conjugation via N-hydroxysuccinimide (NHS) ester and iodoacetyl reactive groups. It yields a spacer arm of about 10.6 Angstroms in length. It is available commercially from Thermo Scientific, and its use in conjugation is described for instance by Hermanson, Bioconjugate Techniques, 1996, San Diego, Academic Press pp. 542, 553, 568. The degree of conjugation can be increased by increasing the amount of linker used relative to the antibody. Furthermore, the antibody can be first treated with the linker by using multiple equivalents of linker, the combination of which can thereafter be combined with urease.
[0037] First, anti-ErbB2 monoclonal antibody 4D5 was activated with SIAB (molar ratio SIABTgG = 3.8: 1) at the pH of the original buffer matrix, for 70 minutes. The reaction was then quenched for ten minutes at room temperature with addition of Tris-HCl buffer, to a final concentration of 5 mM. The resulting solution was chilled with ice/water, and chilled high purity urease (5mg/ml, ~OC, GMP grade jack bean urease) was added while vortexing. Protein molar ratios were l:2/IgG:HPU. Tris-HCl (200 mM, pH 8.45) was added at 1/10 volume to adjust the pH to 8.0-8.3, over a period of 90 minutes. For stability, hydrolyzed SIAB was added to coup most of the surface hydrosulfite of urease. The molar ratio was 1:7 (urease:hydro-SIAB), room
temperature, 30 minutes. The reaction was then quenched by adding cysteine solution (100 mM in 200 mM Tris-HCl buffer, pH 8.45) to a final concentration of 5 mM, room temperature, 10 minutes. The resulting mixture was subjected to SEC separation with a GE healthcare Superose 6 10/300 column, and the fractions were collected. Fractions F10-13 minutes were pooled and dialyzed (MWCO 12-14 kD) against 20 mM arginine buffer containing 1% sucrose and 0.2 mM EDTA, pH 7.0. Collected samples were then analyzed by SDS-PAGE, by protein assay with BCA protocol, by urease-enzyme activity assay with the tube protocol, and by ELISA binding assay to reveal the conjugate is active.
[0038] From the foregoing it will be appreciated that, although specific embodiments of the disclosure have been described herein for purposes of illustration, various modifications may be made without deviating from the spirit and scope of the disclosure.
[0039] Throughout the description of this disclosure, reference is made to various patent applications and publications, each of which are herein incorporated by reference in their entirety.

Claims

CLAIMS What is claimed is:
1. An antibody-urease conjugate comprising one or two antibodies covalently bound to a urease enzyme to form an antibody-urease conjugate said conjugate optionally containing bound to either the urease or the antibody one or more therapeutic agents.
2. An antibody-urease conjugate comprising an antibody covalently bound to a urease enzyme to form an antibody-urease conjugate.
3. The antibody-urease conjugate of claim 2, further comprising a therapeutic agent covalently bound to the antibody or the urease enzyme.
4. The antibody-urease conjugate of any one of claims 1-3, comprising at least two antibodies covalently bound to the urease enzyme.
5. The antibody-urease conjugate of any one of claims 1-4, wherein at least one of the antibodies is covalently bound to the urease enzyme at two or more sites.
6. The antibody-urease conjugate of any one of claims 1-5, wherein at least one of the antibodies is covalently bound to the urease enzyme at three or more sites.
7. The antibody-urease conjugate of any one of claims 1-6, wherein each of the antibodies is covalently bound to the urease enzyme at two or more sites.
8. The antibody-urease conjugate of any one of claims 1-7, wherein at least one of the antibodies is a full antibody.
9. The antibody-urease conjugate of claim 8, wherein the full antibody comprises at least two Fab fragments and an Fc fragment.
10. The antibody-urease conjugate of claim 8, wherein the full antibody has a molecular weight that is at least 120 kDa.
11. The antibody-urease conjugate of claim 8, wherein the full antibody is covalently bound to the urease enzyme at two or more sites.
12. The antibody-urease conjugate of claim 11, wherein the antibodies are not directed to aberrant prions.
13. A method for stabilizing a urease enzyme, comprising conjugating the urease enzyme with at least an antibody at one or more sites to form an antibody-urease conjugate.
14. The method of claim 13, wherein the urease enzyme is conjugated to the antibody at one to eight sites.
PCT/CA2014/050334 2013-04-08 2014-04-03 Use of antibody-urease conjugates for diagnostic and therapeutic purposes Ceased WO2014165985A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
US14/783,153 US10316311B2 (en) 2013-04-08 2014-04-03 Antibody-urease conjugates
CN201480025121.XA CN105247047A (en) 2013-04-08 2014-04-03 Application of Antibody-Urease Conjugate in Diagnosis and Therapy
EP14782795.0A EP2984170B1 (en) 2013-04-08 2014-04-03 USE OF ANTIBODIES AND UREASE CONJUGATES FOR DIAGNOSTIC AND THERAPEUTIC PURPOSES
CA2908475A CA2908475C (en) 2013-04-08 2014-04-03 Use of antibody-urease conjugates for diagnostic and therapeutic purposes
JP2016505666A JP2016524459A (en) 2013-04-08 2014-04-03 Use of antibody-urease conjugates for diagnostic and therapeutic purposes
HK16104650.5A HK1216903A1 (en) 2013-04-08 2014-04-03 Use of antibody-urease conjugates for diagnostic and therapeutic purposes
AU2014252666A AU2014252666B2 (en) 2013-04-08 2014-04-03 Use of antibody-urease conjugates for diagnostic and therapeutic purposes

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201361809842P 2013-04-08 2013-04-08
US61/809,842 2013-04-08

Publications (1)

Publication Number Publication Date
WO2014165985A1 true WO2014165985A1 (en) 2014-10-16

Family

ID=51688787

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2014/050334 Ceased WO2014165985A1 (en) 2013-04-08 2014-04-03 Use of antibody-urease conjugates for diagnostic and therapeutic purposes

Country Status (8)

Country Link
US (1) US10316311B2 (en)
EP (1) EP2984170B1 (en)
JP (1) JP2016524459A (en)
CN (2) CN109248311A (en)
AU (1) AU2014252666B2 (en)
CA (1) CA2908475C (en)
HK (1) HK1216903A1 (en)
WO (1) WO2014165985A1 (en)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016116907A1 (en) 2015-01-23 2016-07-28 Helix Biopharma Corporation Antibody-urease conjugates for therapeutic purposes
WO2018053639A1 (en) 2016-09-24 2018-03-29 Helix Biopharma Corp. Restoring function of tumour acidified t cells
WO2018126315A1 (en) * 2017-01-05 2018-07-12 Helix Biopharma Corporation Anti-vegfr-2 urease conjugates

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2492472A1 (en) * 2002-07-18 2004-01-29 Helix Biopharma Corp. Use of urease for inhibiting cancer cell growth

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4218539A (en) * 1978-03-24 1980-08-19 Weltman Joel K Enzyme conjugates and method of preparation and use
US4360592A (en) * 1979-11-13 1982-11-23 Weltman Joel K Process for the detection of antibodies
FR2504010B1 (en) 1981-04-15 1985-10-25 Sanofi Sa ANTI-CANCER MEDICINAL PRODUCTS CONTAINING THE RICIN-ASSOCIATED CHAIN ASSOCIATED WITH ANTIMELANOMA ANTIBODY AND PROCESS FOR THEIR PREPARATION
US4671958A (en) 1982-03-09 1987-06-09 Cytogen Corporation Antibody conjugates for the delivery of compounds to target sites
US4545985A (en) 1984-01-26 1985-10-08 The United States Of America As Represented By The Secretary, Dept. Of Health And Human Services Pseudomonas exotoxin conjugate immunotoxins
US4894443A (en) 1984-02-08 1990-01-16 Cetus Corporation Toxin conjugates
US4542225A (en) 1984-08-29 1985-09-17 Dana-Farber Cancer Institute, Inc. Acid-cleavable compound
US4657853A (en) * 1984-09-14 1987-04-14 E. I. Du Pont De Nemours And Company Immunoassays utilizing covalent conjugates of polymerized enzyme and antibody
US4659839A (en) 1984-10-10 1987-04-21 Mallinckrodt, Inc. Coupling agents for radiolabeled antibody fragments
US4680338A (en) 1985-10-17 1987-07-14 Immunomedics, Inc. Bifunctional linker
US4699784A (en) 1986-02-25 1987-10-13 Center For Molecular Medicine & Immunology Tumoricidal methotrexate-antibody conjugate
FR2637612B1 (en) 1988-10-06 1993-09-10 Pasteur Institut NUCLEOTIDE SEQUENCES ENCODING A PROTEIN WITH UREASIC ACTIVITY
US5298399A (en) 1990-08-10 1994-03-29 Sapporo Breweries Limited Gene and process for producing a thermostable urease
FI941572L (en) * 1991-10-07 1994-05-27 Oncologix Inc Combination and method of use of anti-erbB-2 monoclonal antibodies
WO1995014093A1 (en) 1993-05-19 1995-05-26 Institut Pasteur Immunogenic compositions against helicobacter infection, polypeptides for use in the compositions and nucleic acid sequences encoding said polypeptides
US6521431B1 (en) 1999-06-22 2003-02-18 Access Pharmaceuticals, Inc. Biodegradable cross-linkers having a polyacid connected to reactive groups for cross-linking polymer filaments
US7264800B2 (en) 2002-07-18 2007-09-04 Helix Biopharma Corporation Method and composition for inhibiting cancer cell growth
US7723099B2 (en) * 2003-09-10 2010-05-25 Abbott Point Of Care Inc. Immunoassay device with immuno-reference electrode
JP6430373B2 (en) * 2012-06-12 2018-11-28 プロミス、ニューロサイエンシズ、インコーポレイテッドPromis Neurosciences Inc. Antibodies and conjugates that target misfolded prion protein

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2492472A1 (en) * 2002-07-18 2004-01-29 Helix Biopharma Corp. Use of urease for inhibiting cancer cell growth
EP1530482B1 (en) * 2002-07-18 2013-10-23 Helix Biopharma Corp. Use of urease for inhibiting cancer cell growth

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
CHANDLER, H. ET AL.: "An investigation of the use of urease-antibody conjugates in enzyme immunoassays.", JOURNAL OF IMMUNOLOGICAL METHODS, vol. 53, no. 2, 17 September 1982 (1982-09-17), pages 187, XP023900599 *
CHAO, H. ET AL.: "Development of an alkalizing antibody-enzyme conjugate for NSCLC treatment that is in Phase I clinical testing.", L-DOS47 PRESENTATION AT AACR 2013 ANNUAL MEETING, 5 April 2013 (2013-04-05), XP055285609, Retrieved from the Internet <URL:http://www.helixbiopharma.com/american-association-of-cancer-research-presentation> *
See also references of EP2984170A1 *
WINSTON, S. ET AL.: "Current Protocols in Molecular Biology", JOHN WILEY & SONS, INC., article WINSTON, S. ET AL.: "Immunoassays: Conjugation of enzymes to antibodies (Chapter 11, Units 11.1 to 11.1.7)", XP002720456 *
WONG, W-Y. ET AL.: "Urease-induced alkalinization of extracellular pH and its antitumor activity in human breast and lung cancers.", JOURNAL OF EXPERIMENTAL THERAPEUTICS AND ONCOLOGY, vol. 5, no. 2, 2005, pages 93 - 99, XP009147420 *

Cited By (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016116907A1 (en) 2015-01-23 2016-07-28 Helix Biopharma Corporation Antibody-urease conjugates for therapeutic purposes
KR20170131365A (en) * 2015-01-23 2017-11-29 헬릭스 바이오파마 코포레이션 Antibody-urease conjugates for therapeutic purposes
JP2018506581A (en) * 2015-01-23 2018-03-08 へリックス バイオファーマ コーポレーション Antibody-urease conjugates for therapeutic purposes
EP3261678A4 (en) * 2015-01-23 2018-12-05 Helix Biopharma Corp. Antibody-urease conjugates for therapeutic purposes
KR102318994B1 (en) 2015-01-23 2021-10-29 헬릭스 바이오파마 코포레이션 Antibody-urease conjugates for therapeutic purposes
US11931422B2 (en) 2015-01-23 2024-03-19 Helix Biopharma Corporation Antibody-urease conjugates for therapeutic purposes
WO2018053639A1 (en) 2016-09-24 2018-03-29 Helix Biopharma Corp. Restoring function of tumour acidified t cells
US10640806B2 (en) 2016-09-24 2020-05-05 Helix Biopharma Corp. Restoring function of tumour acidified T cells
US12104198B2 (en) 2016-09-24 2024-10-01 Helix Biopharma Corp. Restoring function of tumour acidified T cells
WO2018126315A1 (en) * 2017-01-05 2018-07-12 Helix Biopharma Corporation Anti-vegfr-2 urease conjugates
EP3580242A4 (en) * 2017-01-05 2021-01-13 Helix Biopharma Corp. ANTI-VEGFR-2-UREASE ANTIBODY CONJUGATES

Also Published As

Publication number Publication date
US20160138002A1 (en) 2016-05-19
CN109248311A (en) 2019-01-22
EP2984170A1 (en) 2016-02-17
AU2014252666B2 (en) 2017-02-02
CA2908475C (en) 2020-09-08
EP2984170B1 (en) 2026-05-20
EP2984170A4 (en) 2016-11-30
AU2014252666A1 (en) 2015-11-12
JP2016524459A (en) 2016-08-18
CA2908475A1 (en) 2014-10-16
US10316311B2 (en) 2019-06-11
CN105247047A (en) 2016-01-13
HK1216903A1 (en) 2016-12-09

Similar Documents

Publication Publication Date Title
JP6955042B2 (en) Uniform antibody drug conjugate by enzymatic method
JP7474820B2 (en) 6-Amino-7,9-dihydro-8H-purin-8-one derivatives as immune stimulator toll-like receptor 7 (TLR7) agonists - Patents.com
US11753669B2 (en) Lysine conjugated immunoglobulins
CA3072754A1 (en) 6-amino-7,9-dihydro-8h-purin-8-one derivatives as immunostimulant toll-like receptor 7 (tlr7) agonists
JP2020531469A (en) Toll-like receptor 7 (TLR7) agonists with tricyclic groups, their conjugates, and their methods and uses
CN106856656A (en) A novel stable antibody-drug conjugate and its preparation method and use
JP6876618B2 (en) Antibodies for therapeutic purposes-urease conjugates
CN116761824B (en) Engineered anti-TROP 2 antibodies and antibody-drug conjugates thereof
AU2014252666B2 (en) Use of antibody-urease conjugates for diagnostic and therapeutic purposes
WO2023051712A1 (en) Anti-cd39 antibody-drug conjugate and use thereof
TW202547884A (en) Muc16/napi-2b antibodies and methods of use
HK1238557A1 (en) Antibody-urease conjugates for therapeutic purposes

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 14782795

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
ENP Entry into the national phase

Ref document number: 2908475

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2016505666

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14783153

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 2014782795

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2014252666

Country of ref document: AU

Date of ref document: 20140403

Kind code of ref document: A