WO2014160281A2 - Method of enhancing delivery of therapeutic compounds to the eye - Google Patents
Method of enhancing delivery of therapeutic compounds to the eye Download PDFInfo
- Publication number
- WO2014160281A2 WO2014160281A2 PCT/US2014/026224 US2014026224W WO2014160281A2 WO 2014160281 A2 WO2014160281 A2 WO 2014160281A2 US 2014026224 W US2014026224 W US 2014026224W WO 2014160281 A2 WO2014160281 A2 WO 2014160281A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- plasmin
- cell
- retinal
- eye
- therapeutic agent
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/02—Algae
- A61K36/05—Chlorophycota or chlorophyta (green algae), e.g. Chlorella
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/36—Blood coagulation or fibrinolysis factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/43—Enzymes; Proenzymes; Derivatives thereof
- A61K38/46—Hydrolases (3)
- A61K38/48—Hydrolases (3) acting on peptide bonds (3.4)
- A61K38/482—Serine endopeptidases (3.4.21)
- A61K38/484—Plasmin (3.4.21.7)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0075—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y304/00—Hydrolases acting on peptide bonds, i.e. peptidases (3.4)
- C12Y304/21—Serine endopeptidases (3.4.21)
- C12Y304/21007—Plasmin (3.4.21.7), i.e. fibrinolysin
Definitions
- This invention relates generally to methods of enhancing the delivery of therapeutic compounds to the eye.
- the eye is a complex optical system that detects light, converts the light to a set of electrical signals, and transmits thes signals to the brain, ultimately generating a
- Ocular diseases and disorders can cause diminished visual acuity, diminished light sensitivity, and blindness.
- the invention provides a solution for the long-felt need for methods to enhance or improve the delivery of therapeutic compounds to the eye.
- the present invention features a method of enhancing the delivery of a therapeutic agent to an eye of a subject by administering a plasmin or derivative thereof and the therapeutic agent to the eye.
- the present invention also features the use of a composition comprising a plasmin or derivative thereof for delivery to the eye of a subject for enhancing the delivery of a therapeutic agent.
- the plasmin or derivative thereof is a miniplasmin or a microplasmin (Ocriplasmin).
- the plasmin or derivative thereof encompassed in the present invention includes amino acid sequences SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9 or functional variants or fragments thereof.
- the therapeutic agent is selected from a small molecule, a nucleic acid, an antibody, or a peptide.
- the nucleic acid is a nucleic acid expression vector (i.e., a viral vector), a plasmid, or an siRNA.
- the viral vector is a AAV viral vector (i.e., recombinant AAV or rAAV) that encodes a transgene.
- the transgene encodes a gene product that increases or restores light sensitivity, increases light detection, increases photosensitivity, increases visual evoked potential, or restores vision to the blind. More preferably, the transgene is an opsin gene.
- opsin genes include, but are not limited to, channelrhodopsins (i.e., channelrhodopsin-1, channelrhodopsin-2, Volvox carteri channelrhodopsins 1 or 2), melanopsin, pineal opsin, photopsins, halorhodopsin, bacteriorhodopsin, proteorhodopsin, or any functional variants or fragments thereof.
- channelrhodopsins i.e., channelrhodopsin-1, channelrhodopsin-2, Volvox carteri channelrhodopsins 1 or 2
- melanopsin i.e., pineal opsin, photopsins, halorhodopsin, bacteriorhodopsin, proteorhodopsin, or any functional variants or fragments thereof.
- therapeutic agents include, but are not limited to ranibizumab antibody FAB (Lucentis), VEGF Trap fusion molecule (VEGF Trap-Eye), macugen pegylated polypeptide (Pegaptanib), and bevacimzumab (Avastin). Any of the therapeutic agents used in the present invention may be encapsulated in a nanoparticle, a polymer, or a liposome.
- the plasmin or derivative thereof and the therapeutic agent are delivered concurrently or sequentially.
- the present invention provides a method in which the therapeutic agent is delivered to a retinal cell.
- the retinal cell is a retinal ganglion cell, a retinal horizontal cell, a retinal bipolar cell, an amacrine cell, a photoreceptor cell, a Miiller glial cell, or a retinal pigment epithelial cell.
- the plasmin or derivative thereof and the therapeutic agent is administered to the vitreous of the eye.
- the present invention further provides a method of increasing or restoring light sensitivity in a subject comprising administering a plasmin or derivative thereof and a viral vector that encodes an opsin to the vitreous of the eye.
- the present invention also provides a method of improving or restoring vision in a subject comprising administering a plasmin or derivative thereof and a viral vector that encodes an opsin to the vitreous of the eye.
- compositions comprising a plasmin or derivative thereof for treating an ocular disease or disorder in a subject are also provided herein.
- the subject is suffering from an ocular disease or disorder.
- the ocular disease or disorder is associated with photoreceptor degeneration.
- Figure 1 is a series of representative GFP fluorescence images in retinal vertical sections after intravitreal injection of AAV2 vectors (6 x 10 12 vg/ml), AAV2/2-ChR2-GFP- WPRE-hGHpA, in control (A, B) or co-injection with plasmin (0.025IU/eye) (C, D).
- the vectors were co-injected along with plasmin into the vitreous space of adult C56BL/6J mice at age of approximately one month. Transduction efficiency was evaluated one month after virus injection by immuno staining and cell counting.
- FIG. 2 is a series of representative GFP fluorescence and DAPI staining images demonstrating the effects of plasmin on AAV-mediated transduction efficiency and the potential neurotoxicity in retinal ganglion cells.
- AAV2 vectors (2 x 10 12 vg/ml), AAV2/2- ChR2-GFP-WPRE-hGHpA, was injected in control (A, E), or was co-injected at (B, F) low (L: 0.005 IU), (C, G) middle (M: 0.025IU), and (D, H) high (H: 0.100IU plasmin /eye) concentrations.
- Retinal ganglion cells were stained by DAPI (A-D).
- FIG. 3 is two graphs showing the quantitative assessment of the effects of plasmin on (A) AAV-mediated transduction efficiency and (B) potential neurotoxicity of plasmin in retinal ganglion cells.
- Co-injection of plasmin at low (L: 0.005 IU), middle (M: 0.025IU), and high (H: 0.100IU plasmin /eye) concentrations significantly increased the AAV- mediated transduction efficiency in retinal ganglion cells (A).
- Co-injection of plasmin did not show any significant neurotoxicity to retinal ganglion cells.
- the ganglion cell counts were assessed from multiple unit areas of 223 ⁇ x 167 ⁇ . * p ⁇ 0.05; ** p ⁇ 0.005.
- Figure 4 is a series of representative fluorescence images of mCherry-expressing retinal bipolar cells in retinal whole-mounts.
- AAV2 vectors (2 x 10 12 vg/ml) with Y444F capsid mutation carrying mCherry under control of a mGluR6 promoter were co-injected along with plasmin of three doses (L: 0.005 IU, M: 0.025 IU, and H: 0.100 IU/eye) into the vitreous space of adult C56BL/6J mice at age of approximately one month. Transduction efficiency was evaluated one month after virus injection by immuno staining and cell counting.
- Figure 5 is three graphs showing quantitative data for the effects of plasmin on AAV-mediated transduction efficiency in retinal bipolar cells.
- the counts of mCherry expressing retinal bipolar cell were assessed from multiple unit areas of 223 ⁇ x 167 ⁇ . * /? ⁇ 0.05; ** /? ⁇ 0.01; *** /? ⁇ 0.001.
- the present invention provides methods for enhanced delivery of therapeutic compounds or agents to the eye of a subject by administering a plasmin or derivative thereof and the therapeutic agent to the eye.
- the plasmin or derivative thereof and the therapeutic agent may be delivered to the vitreous for enhanced delivery to the retina and retinal cells.
- the retinal cells include, for example, photoreceptor cells ⁇ e.g., rods, cones, and photosensitive retinal ganglion cells), horizontal cells, retinal bipolar cells, amacrine cells, retinal ganglion cells, Miiller glial cells, and retinal pigment epithelial cells.
- the plasmin or derivative thereof and the therapeutic agent may be delivered to, for example, the posterior segment, the anterior segment, the sclera, the choroid, the conjunctiva, the iris, the lens, or the cornea.
- the retina is a complex tissue in the back of the eye that contains specialized photoreceptor cells called rods and cones.
- the photoreceptors connect to a network of nerve cells for the local processing of visual information. This information is sent to the brain for decoding into a visual image.
- the retina is susceptible to a variety of diseases, including age-related macular degeneration (AMD), diabetic retinopathy (DR), retinitis pigmentosa (RP), glaucoma, and other inherited retinal degenerations, uveitis, retinal detachment, and eye cancers (ocular melanoma and retinoblastoma). Each of these can lead to visual loss or complete blindness.
- AMD age-related macular degeneration
- DR diabetic retinopathy
- RP retinitis pigmentosa
- glaucoma glaucoma
- eye cancers ocular melanoma and retinoblastoma
- Plasmin is a serine protease that is present in the blood that degrades fibrin blood clots and other blood plasma proteins. Specifically, plasmin cleaves fibrin, fibronectin, thrombospondin, laminin, proaccelerin, and Von Willebrand Factor (VWF) into soluble products. Plasmin exhibits preferential cleavage at the carboxyl side of Lysine and Arginine residues with higher selectivity than trypsin.
- VWF Von Willebrand Factor
- plasmin originates from a zymogen, or inactive precursor protein, called plasminogen (PLG).
- PLG plasminogen
- the amino acid sequence of plasminogen is known in the art, for example, Genbank Accession Number NP_000292, and listed below:
- nucleic acid of plasminogen is known in the art, for example, Genbank Accession Number NM_000301, and as listed below:
- the signal peptide sequence of plasminogen is 19 amino acids long.
- the plasminogen sequence without the signal peptide encompasses amino acids from positions 20-810 of the plasminogen sequence.
- the signal peptide sequence is as follows:
- the plasmin heavy chain A is 561 amino acids, comprising the amino acid sequence provided below:
- the short form of the plasmin heavy chain A is 483 amino acids.
- the amino acid sequence of the short form of the plasmin heavy chain A is as follows:
- amino acid sequence of the activation peptide comprises the following amino acid sequence:
- the plasmin light chain B is 230 amino acids.
- the amino acid sequence of the plasmin light chain B is as follows:
- the plasmin can be a miniplasmin or a
- Miniplasmin and microplasmin are produced upon the activation of miniplasminogen and microplasminogen by plasminogen activators such as, but not limited to, streptokinase, staphylokinase, tissue-type plasminogen activator or urokinase.
- plasminogen activators such as, but not limited to, streptokinase, staphylokinase, tissue-type plasminogen activator or urokinase.
- Miniplasminogen and microplasminogen are derived from plasminogen, which is a single chain glycoprotein that is an important component of mammalian blood.
- Human plasminogen is a multi-domain protein of 791 residues (SEQ ID NO: l), composed of an N- terminal pre- activation domain, five homologous kringle domains each of about 80 amino acids, a serine protease catalytic domain and inter-domain connecting sequences. Plasmin or plasminogen activators cleave the peptide bonds between Arg-68 and Met-69, or Lys-77 and Lys-78 or Lys-78 and Val-79 at the N-terminal of human plasminogen, resulting in shorter proenzymes called Lys-plasminogens (for example, proteins consisting of amino acids 69-791 or 78-791 or 79-791).
- Lys-plasminogens for example, proteins consisting of amino acids 69-791 or 78-791 or 79-79.
- microplasminogen typically amino acids 543-791.
- the kringles of plasminogen contain lysine-binding sites that mediate specific binding of plasminogen to substrates such as fibrin.
- the proenzyme forms of plasminogen are activated to their enzymatically active form by the cleavage of the peptide bond between Arg-561 and Val-562 to yield a disulfide bonded double chain form of the corresponding protein.
- the product of activation of a plasminogen protein is called a plasmin.
- Lys-plasminogen activation is called Lys-plasmin, while the products of activation of miniplasminogen and
- microplasminogen are referred to as miniplasmin and microplasmin, respectively. Like plasmin, miniplasmin and microplasmin possess catalytic activity. An advantage of miniplasmin and microplasmin over plasmin is their smaller size compared to plasmin. Thus, both microplasmin and miniplasmin are expected to have faster diffusion rates in the vitreous than plasmin.
- the plasmin of the present invention may comprise any one of the plasminogen- related sequences described herein, for example, any one of SEQ ID NOs: 1 and 3-7, or a functional fragment or variant thereof.
- the plasmin may also be ocriplasmin (JETREA®) or variants or derivatives thereof.
- Ocriplasmin is a recombinant truncated form of human plasmin produced by recombinant DNA technology in a Pichia pastoris expression system.
- Ocriplasm is a protein made up of 249 amino acids with a molecular weight of 27.2 kDa, and has two peptide chains. The amino acid sequence for the truncated heavy chain is as follows:
- amino acid sequence for the light chain is as follows:
- VVGGCVAHPHSWPWQVSLRTRFGMHFCGGTL I SPEWVLTAAHCLEKSPRPS SYKVI LGAH QEVNLEPHVQE IEVSRLFLEPTRKDIALLKLS SPAVI TDKVIPACLPSPNYWADRTECF I TGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDS GGPLVCFEKDKYI LQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN ( SEQ I D NO : 9 )
- the present invention further encompases variants and derivatives of ocriplasmin.
- the plasmin may be isolated from blood using known isolation techniques.
- plasminogen may be isolated from the blood using known isolation techniques, and then incubated with proteases that cleave plasminogen into active plasmin to produce purified or isolated plasmin suitable for use in the methods described herein.
- the plasmin may be synthesized chemically using commercially available peptide synthesizers to produce purified or isolated plasmin suitable for use in the methods described herein.
- Chemical synthesis of peptides and proteins can be used for the incorporation of modified or unnatural amino acids, including D-amino acids and other small organic molecules.
- Replacement of one or more L-amino acids in a peptide or protein with the corresponding D-amino acid isoforms can be usd to increase resistance to enzymatic hydrolysis, and to enhance one or more properties of biological activity, i.e., functional potency or duration of action.
- Other modifications to the plasmin can be introduced, for example, cross-linking to change the conformation to alter the potency, selectivity or stability of the plasmin.
- the plasmin may be purchased from a commercial vendor, such as Sigma Aldrich, Catalog Number PI 867.
- the present invention also encompasses variants or derivatives of the plasmin supplied by Sigma Aldrich (Cat. No. P1867).
- the plasmin may be a recombinant plasmin obtained by methods well known in the art for recombinant protein expression and purification.
- a DNA molecule encoding a plasmin or a variant or analog thereof can be generated from known DNA sequences or by deducing the nucleic acid sequences from the amino acid sequence based on known codon usage.
- the DNA molecule encoding a plasmin can be cloned into a suitable vector, such as a cloning or expression vector, by any of the methodologies known in the art.
- the cloning or expression vectors contain all the components required for additional cloning of the plasmin DNA, such as restriction enzyme sites, or for the expression of the plasmin, such as a host-specific promoter, and optionally, enhancer sequences.
- the expression vector can be introduced and expressed in a host cell.
- a host cell can be any prokaryotic or eukaryotic cell.
- the plasmin can be expressed in bacterial cells (i.e., E. coli), yeast, insect cells (i.e., Sf9), or mammalian cells. Other suitable host cells are known to those skilled in the art.
- the host cell can be used to produce or overexpress the plasmin, variant or derivative thereof in culture. Then the biologically expressed plasmin, variant or derivative thereof may be purified using known purification techniques, such as affinity
- a variant, derivative or analog of a plasmin may be preferred.
- Variants, derivatives and analogs of plasmin can be identified or generated by one ordinarily skilled in the art.
- the plasmin variants, derivatives and analogs can be generated, for example, by using the recombinant methods or methods of synthesis described herein.
- Plasmin derivatives known in the art include miniplasmin and microplasmin are also suitable for use in the methods disclosed herein.
- the term "derivative” and “variant” may be used interchangeably and refers to a plasmin that differs from naturally occurring plasmin, but retains the essential properties thereof.
- the plasmin derivative may be a biologically active fragment of plasmin, for example, a truncated plasmin.
- the biologically active fragment contains the catalytic domain of plasmin and possesses serine protease catalytic activity.
- the plasmin derivative may be a mutated plasmin, wherein at least 1 amino acid, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 30, at least 40, or at least 50 amino acids are mutated from the wild-type plasmin.
- Mutated plasmin may have altered sequences by substitutions, additions, or deletions, that still result in functionally equivalent molecules.
- the plasmin derivative is about 99%, about 98%, about 97%, about 96%, about 95%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, or about 50% identity to wild-type plasmin.
- the mutation may increase the potency (protease activity), stability, or number of targets of the plasmin. In another aspect, the mutation may decrease the potency, stability, or number of targets of the plasmin.
- the mutation may be a conservative amino acid substitution. Alternatively, the mutation may be a non-conservative amino acid substitution.
- the plasmin derivative may be chemically modified, for example, by the addition of a chemical moiety that alters activity or stability.
- % identity in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection. For example, % identity is relative to the entire length of the coding regions of the sequences being compared.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. Percent identity is determined using search algorithms such as BLAST and PSI-BLAST (Altschul et al., 1990, J Mol Biol 215:3, 403-410; Altschul et al., 1997, Nucleic Acids Res 25: 17, 3389- 402).
- analog refers to compounds or peptides that retain the essential protease activity of the plasmin.
- the analog may bear some amino acid sequence similarity to or no sequence similarity to naturally occurring plasmin.
- plasmin analogs retain the functional capability of protease cleavage of any one of the targets of plasmin (i.e. , laminin, fibrin), and/or the preferential cleavage at the carboxyl side of Lysine and Arginine residues.
- Plasmin derivatives and analogs can be identified by one ordinarily skilled in the art by screening combinatorial libraries of mutants of plasmin or general therapeutic or pharmaceutical compounds.
- the present invention provides methods for enhancing the delivery of a therapeutic agent to the eye.
- the methods of the present invention include administering a plasmin and a therapeutic agent to the eye.
- the therapeutic agent may be delivered to the eye by any method known in the art. Routes of administration include, but are not limited to, intravitreal, intracameral, subconjunctival, subtenon, retrobulbar, posterior juxtascleral, or topical. Delivery methods include, for example, injection by a syringe and a drug delivery device, such as an implanted vitreal delivery device (i.e. , VITRASERT®).
- a drug delivery device such as an implanted vitreal delivery device (i.e. , VITRASERT®).
- the therapeutic agent is administered to the vitreous by intravitreal injection for delivery of therapeutic agents to the retina.
- the methods of the present invention provide enhanced delivery to cells of the retina.
- Exemplary retinal cells include, but are not limited to, photoreceptor cells (e.g. , rods, cones, and
- photosensitive retinal ganglion cells photosensitive retinal ganglion cells
- horizontal cells bipolar cells
- amacrine cells retinal ganglion cells
- Miiller glial cell retinal pigment epithelial cells.
- the plasmin or derivative thereof is administered concurrently or sequentially with the therapeutic agent.
- the plasmin or derivative thereof can be formulated with the therapeutic agent in a single composition suitable for delivery, for example, injection, by methods known in the art.
- the plasmin or derivative thereof can be injected in separate compositions, simultaneously or sequentially.
- the plasmin may be administered prior to administration of the therapeutic agent.
- Such formulations comprise a pharmaceutically and/or physiologically acceptable vehicle, diluent, carrier or excipient, such as buffered saline or other buffers, e.g., HEPES, to maintain physiologic pH.
- diluent such as buffered saline or other buffers, e.g., HEPES
- HEPES buffered saline or other buffers
- the dosage of plasmin or derivative thereof to be administered can be optimized by one of ordinary skill in the art. Delivery to certain target ocular tissues may require lower doses of plasmin or higher doses of plasmin, depending on the location of the target tissue, intervening ocular structures, and ability of the agent to penetrate the target tissue.
- the dose of plasmin administered is about 0.001 UI (enzyme units) per eye, 0.025 UI per eye, about 0.05 UI per eye, about 0.075 UI per eye, about 0.100 UI per eye, about 0.150 UI per eye, or about 0.200 UI per eye.
- the methods for enhanced delivery disclosed herein may provide increased efficacy of a therapeutic agent.
- Increased efficacy of the therapeutic agent can be determined by measuring the therapeutic effect of the therapeutic agent.
- Treatment is efficacious if the treatment leads to clinical benefit such as, alleviation of a symptom in the subject.
- a degenerative retinal disease such as retinitis pigmentosa
- treatment is efficacious when light sensitivity or another aspect of vision is improved or restored.
- "efficacious" means that the treatment retards or prevents an ocular disease or disorder or prevents or alleviates a symptom of clinical symptom of an ocular disease or disorder. Efficaciousness is determined in association with any known method for diagnosing or treating the particular ocular disease or disorder.
- the therapeutic agent is a nucleic acid or a nucleic acid expression vector (i.e. a viral vector) encoding a therapeutic transgene or an siRNA species (i.e., short hairpin or microRNA).
- a nucleic acid expression vector i.e. a viral vector
- siRNA species i.e., short hairpin or microRNA.
- the therapeutic agents to be delivered to the eye by the methods described herein are any therapeutic agents known in the art for treating, alleviating, reducing, or preventing a symptom of an ocular disease, an ocular disorder, or an ocular condition.
- the therapeutic agent may be a small molecule, a nucleic acid, an antibody, or a peptide.
- small molecules suitable for use in the methods described herein include, but are not limited to, tyrosine kinase inhibitors, antibiotics, anti-inflammatory agents, glucocorticoids, opioid antagonists, and other enzyme inhibitors.
- nucleic acids suitable for use in the methods described herein include, but are not limited to, viral vectors encoding therapeutic transgenes ⁇ i.e., channelopsins, or halorhodopsin), RNA interference molecules ⁇ i.e., short hairpins, siRNA, or microRNAs).
- the therapeutic agents are viral vectors encoding transgenes for gene therapy.
- Particularly preferred viral vectors are rAAV vectors that encode channelopsins or halorhodopsins for expression in the retina to restore light sensitivity.
- antibodies suitable for use in the methods described herein include, but are not limited to, ranibizumab (Lucentis®), VEGF antibodies (Eylea®), bevacizumab (Avastin ®), infliximab, etanercept, and adalimumab.
- proteins or peptides suitable for use in the methods described herein include, but are no limited to, microplasmin (Ocriplasmin, Jetrea ®), macugen pagylated polypeptide (Pegaptanib), and integrin peptides.
- the peptide therapeutic is a collection of peptides, containing two or more peptides.
- any of the therapeutic agents described herein may be optionally encapsulated in a carrier, such as a nanoparticle, a polymer, or a liposome.
- a carrier such as a nanoparticle, a polymer, or a liposome.
- these carrier agents may serve to further enhance the delivery of the therapeutic agent to the eye.
- the carrier agents may alter the properties of the therapeutic agents, such as increasing the stability (half-life) or providing sustained-release properties to the therapeutic agents.
- the carrier may protect the therapeutic agent from the proteolytic activities of plasmin if formulated in the same composition for delivery.
- the present invention provides methods for increased efficiency of delivery of transgenes to the eye for treating an ocular disease or disorder, or for restoring or improving vision.
- Transgenes of particular interest for restoration of photosensitivity or vision include photosensitive proteins, such as opsin genes or rhodopsin genes. As used herein,
- transgene refers to a polynucleotide encoding a polypeptide of interest, wherein the polynucleotide is present in a nucleic acid expression vector suitable for gene therapy (e.g., a viral vector such as AAV).
- a nucleic acid expression vector suitable for gene therapy e.g., a viral vector such as AAV.
- the present invention provides a solution to this problem by using plasmin or derivatives thereof to dissolve the components the ILM, such as laminin and fibronectin.
- therapeutic agents will have greater accessibility to the retina, specifically the cells of the inner retina such as the retinal bipolar cells, retinal ganglion cells, Miiller glial cells, and retinal pigment epithelial cells.
- the methods described herein provide enhanced delivery of therapeutic compounds, such as therapeutic viral vectors.
- the enhanced delivery of viral vectors is demonstrated by increased transduction efficiency, increased expression of the therapeutic transgene (i.e., Chop2), and increased efficacy of the therapeutic compound (i.e., increased light sensitivity or restoration of vision).
- nucleic acid expression vectors suitable for use in gene therapy are known in the art.
- the nucleic acid expression vector is a viral vector.
- the viral vectors can be retroviral vectors, adenoviral vectors, adeno-associated vectors (AAV), or lentiviral vectors, or any engineered or recombinant viral vector known in the art.
- Particularly preferred viral vectors are adeno-associated vectors, for example, AAV-1, AAV-2, AAV-3, AAV-4, AAV- 5, AAV-6, AAV-7, AAV-8, AAV-9, AAV- 10, AAV-11, AAV-12 or any engineered or recombinant AAV known in the art.
- the vector is recombinant AAV-2 (rAAV2).
- a recombinant adeno-assoeiated viral (rAAV) vector comprises a capsid protein with a mutated tyrosine residue which enables to the vector to have improved transduction efficiency of a target cell, e.g., a retinal bipolar cell (e.g. ON or OFF retinal bipolar cells; rod and cone bipolar ceils).
- a target cell e.g., a retinal bipolar cell (e.g. ON or OFF retinal bipolar cells; rod and cone bipolar ceils).
- the rAA V further comprises a promoter (e.g., mGluR6, or fragment thereof) capable of driving the expression of a protein of interest in the target cell.
- a mutation may be made in any one or more of tyrosine residues of the capsid protein of AAV 1-12 or hybrid AAVs. In specific embodiments these are surface exposed tyrosine residues. In a related embodiment the tyrosine residues are part of the VPI, VP2, or VP3 capsid protein. In exemplary embodiments, the mutation may be made at one or more of the following amino acid residues of an AAV-VP3 capsid protein: Tyr252, Tyr272, Tyr444, TyrSOO, Tyr700, Tyr704, Tyr730; Tyr275, Tyr28 I, Tyr508, Tyr576, Tyr612, Tyr673 or Tyr720.
- Exemplary mutations are tyrosine-to-phenylalanine mutations including, but not limited to, Y252F, Y272F, Y444F, Y500F, Y700F, Y704F, Y730F, Y275F, Y281F, Y508F, Y576F, Y612G, Y673F and Y720F. In a specific embodiment these mutations are made in the AAV2 serotype.
- an AAV2 serotype comprises a Y444F mutation and/or an AAVS serotype comprises a Y733F mutation, wherein 444 and 733 indicate the location of a point tyrosine mutation of the viral capsid
- such mutated AAV2 and AAVS serotypes encode a light- sensitive protein and also comprise a modified mGluR6 promoter to drive expression of such light-sensitive protein.
- Such AAV vectors are described in, for example, Petrs-Silva et a!., Mol Then, 201 1 19:293-301).
- the expression of the therapeutic transgene is driven by a constitutive promoter, i.e., CAG promoter, CMV promoter, LTR.
- the promoter is an inducible or a cell- specific promoter.
- Cell type- specific promoters that enable transgene expression in specific subpopulations of cells, i.e., retinal neuron cells or degenerating cells, may be preferred.
- These cells may include, but are not limited to, a retinal ganglion cell, a photoreceptor cell, a bipolar cell, a rod bipolar cell, an ON-type cone bipolar cell, a retinal ganglion cell, a photosensitive retinal ganglion cell, a horizontal cell, an amacrine cell, an All amacrine cell, or a retinal pigment epithelial cell.
- Cell type- specific promoters are well known in the art. Particularly preferred cell type- specific promoters include, but are not limited to mGluR6, NK-3, and Pcp2(L7).
- Cell type-specific promoters modified using recombinant DNA techniques known in the art to increase efficiency of expression and selective targeting are also encompassed in the present invention.
- a modified mGluR6 promoter contains a combination of regulatory elements from the mGluR6 gene, as described in U.S. Provisional Application No.
- the therapeutic transgene can be any light-sensitive opsin.
- the opsin family of genes includes vertebrate (animal) and invertebrate opsins.
- Animal opsins are G-protein coupled receptors (GPCRs) with 7- transmembrane helices which regulate the activity of ion channels.
- GPCRs G-protein coupled receptors
- Invetertebrate rhodopsins are usually not GPCRs but are light-sensitive or light- activated ion pumps or ion channels.
- an opsin gene or light-sensitive protein includes, but is not limited to, channelrhodopsins, or channelopsins, (i.e., ChRl, ChR2, vChRl from Volvox carteri, vChR2, and other variants identified from any vertebrate, invertebrate, or microbe), halorhodopsins (NpHR), melanopsins, pineal opsins, photopsins, bacteriorhodopsins, proteorhodopsins and functional variants or chimeras thereof.
- a light-sensitive protein of this invention can occur naturally in plant, animal, archaebacterial, algal, or bacterial cells, or can alternatively be created through laboratory techniques. Examples of opsin genes are discussed in further detail below.
- Channelopsins are a seven transmembrane domain proteins that become photo-switchable (light sensitive) when bound to the chromophore all- iraws-retinal.
- Channelopsins when linked to a retinal molecule via Schiff base linkage forms a light-gated, nonspecific, inwardly rectifying, cation channel, called a
- NpHR Halorhodopsin
- GenBank accession number EF474018 is from the haloalkaliphilic archaeon Natronomonas pharaonis.
- variants of NpHR can be created.
- single or multiple point mutations to the NpHR protein can result in NpHR variants.
- a mammalian codon optimized version of NpHR can be utilized.
- NpHR variants are utilized.
- eNpHR enhanced NpHR
- Melanopsin (GenBank accession number 6693702) is a photopigment found in specialized photosensitive ganglion cells of the retina that are involved in the regulation of circadian rhythms, pupillary light reflex, and other non- visual responses to light.
- melanopsin is an opsin, a retinylidene protein variety of G-protein-coupled receptor.
- Melanopsin resembles invertebrate opsins in many respects, including its amino acid sequence and downstream signaling cascade. Like invertebrate opsins, melanopsin appears to be a bistable photopigment, with intrinsic photoisomerase activity.
- variants of melanopsin can be created.
- single or multiple point mutations to the melanopsin protein can result in melanopsin variants.
- Light-sensitive proteins may also include proteins that are at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99% identical to any of the light-sensitive proteins described herein ⁇ i.e., ChRl, ChR2, vChRl, vChR2, NpHR and melanopsin).
- the light-sensitive proteins of the present invention may also include proteins that have at least one mutation. The mutation may be a point mutation.
- light-sensitive proteins can modulate signaling within neural circuits and bidirectionally control behavior of ionic conductance at the level of a single neuron.
- the neuron is a retinal neuron, a retinal bipolar cell (e.g. ON or OFF retinal bipolar cells; rod and cone bipolar cells), a retinal ganglion cell, a photoreceptor cell, or a retinal amacrine cell.
- a polyA tail can be inserted downstream of the transgene in an expression cassette or nucleic acid expression vector of the present invention.
- Suitable polyA tails are known in the art, and include, for example, human growth hormone poly A tail (hGHpA), bovine growth hormone polyA tail (bGHpA), bovine polyA, SV40 polyA, and AV40pA.
- rhodopsin proteins Upon illumination by the preferred dose of light radiation, rhodopsin proteins opens the pore of the channel, through which H + , Na + , K + , and/or Ca 2+ ions flow into the cell from the extracellular space. Activation of the rhodopsin channel typically causes a
- Depolarized cells produce graded potentials and or action potentials to carry information from the rhodopsin-expressing cell to other cells of the retina or brain, to increase light sensitivity or restore vision.
- Methods of improving vision or light sensitivity by administration of a vector encoding a channelopsin (or variant thereof) are described in PCT/US2007/068263, the contents of which are herein incorporated in its entirety.
- a dual rhodopsin system can be used to recapitulate the ON and OFF pathways integral to visual processing and acuity.
- a Chop2 protein of the present invention can be specifically targeted to ON type retinal neurons (i.e., ON type ganglion cells and/or ON type bipolar cells), while a hypopolarizing light sensor (i.e., halorhodopsin or other chloride pump known in the art) can be targeted to OFF type retinal neurons (i.e. OFF type ganglion cells and/or OFF type bipolar cells) to create ON and OFF pathways.
- the specific targeting to preferred cell subpopulations can be achieved through the use of different cell type-specific promoters.
- Chop2 expression may be driven by the mGluR6 promoter for targeted expression in ON-type retinal neurons (i.e., ON type ganglion cells and/or ON type bipolar cells) while a hypopolarizing channel, such as halorhodopsin, expression is driven by the NK-3 promoter for targeted expression in OFF- type retinal neurons (i.e., OFF type ganglion cells and/or OFF type bipolar cells).
- ON-type retinal neurons i.e., ON type ganglion cells and/or ON type bipolar cells
- a hypopolarizing channel such as halorhodopsin
- An effective amount of rAAV virions carrying a nucleic acid sequence encoding the rhodopsin DNA under the control of the promoter of choice is preferably in the range of between about 10 10 to about 10 13 rAAV infectious units in a volume of between about 25 and about 800 ⁇ per injection.
- the rAAV infectious units can be measured according to McLaughlin, SK et ah, 1988, J Virol (52: 1963. More preferably, the effective amount is between about 10 10 and about 10 12 rAAV infectious units and the injection volume is preferably between about 50 and about 150 ⁇ .
- dosages and volumes may be selected by the treating professional, taking into account the physical state of the subject (preferably a human), who is being treated, including, age, weight, general health, and the nature and severity of the particular ocular disorder.
- nucleic acid(s) or rAAV compositions may also be desirable to administer additional doses (“boosters") of the present nucleic acid(s) or rAAV compositions.
- additional doses for example, depending upon the duration of the transgene expression within the ocular target cell, a second treatment may be administered after 6 months or yearly, and may be similarly repeated.
- Neutralizing antibodies to AAV are not expected to be generated in view of the routes and doses used, thereby permitting repeat treatment rounds.
- the need for such additional doses can be monitored by the treating professional using, for example, well-known electrophysiological and other retinal and visual function tests and visual behavior tests.
- the treating professional will be able to select the appropriate tests applying routine skill in the art. It may be desirable to inject larger volumes of the composition in either single or multiple doses to further improve the relevant outcome parameters.
- the ocular disorders for which the methods of the present invention are intended and may be used to improve one or more parameters of vision include, but are not limited to, developmental abnormalities that affect both anterior and posterior segments of the eye.
- Anterior segment disorders include glaucoma, cataracts, corneal dystrophy, keratoconus.
- Posterior segment disorders include blinding disorders caused by photoreceptor malfunction and/or death caused by retinal dystrophies and degenerations.
- Retinal disorders include congenital stationary night blindness, age-related macular degeneration, congenital cone dystrophies, and a large group of retinitis-pigmentosa (RP)-related disorders.
- RP retinitis-pigmentosa
- disorders include genetically pre-disposed death of photoreceptor cells, rods and cones in the retina, occurring at various ages.
- severe retinopathies such as subtypes of RP itself that progresses with age and causes blindness in childhood and early adulthood
- RP-associated diseases such as genetic subtypes of LCA, which frequently results in loss of vision during childhood, as early as the first year of life.
- LCA RP-associated diseases
- ocular diseases that may benefit from the methods described herein include, but are not limited to, retinoblastoma, ocular melanoma, diabetic retinopathy, hypertensive retinopathy, any inflammation of the ocular tissues (i.e., chorioretinal inflammation, scleritis, keratitis, uveitis, etc.), or infection (i.e., bacterial or viral).
- the viral-mediated delivery of rhodopsins using the methods of the present invention useful for the treatment and/or restoration of at least partial vision to subjects that have lost vision due to ocular disorders, such as RPE-associated retinopathies, which are characterized by a long-term preservation of ocular tissue structure despite loss of function and by the association between function loss and the defect or absence of a normal gene in the ocular cells of the subject.
- ocular disorders such as childhood onset blinding diseases, retinitis pigmentosa, macular degeneration, and diabetic retinopathy, as well as ocular blinding diseases known in the art.
- the particular ocular disorder treated by the present invention may include the above-mentioned disorders and a number of diseases which have yet to be so characterized.
- vision may be used in subjects of normal and/or impaired vision.
- the enhanced delivery of a therapeutic compound, as described herein, may preserve, improve, or restore vision.
- vision as used herein is defined as the ability of an organism to usefully detect light as a stimulus for differentiation or action. Vision is intended to encompass the following:
- Light detection or perception the ability to discern whether or not light is present
- Light projection the ability to discern the direction from which a light stimulus is coming
- vision includes the ability to simply detect the presence of light.
- the methods of the present invention can be used to improve or restore vision, wherein the improvement or restoration in vision includes, for example, increases in light detection or perception, increase in light sensitivity or photosensitivity in response to a light stimulus, increase in the ability to discern the direction from which a light stimulus is coming, increase in the ability to detect differing brightness levels, increase in the ability to recognize the shape of a visual target, and increases in visual evoked potential or transmission from the retina to the cortex.
- improvement or restoration of vision may or may not include full restoration of sight, i.e., wherein the vision of the patient treated with the present invention is restored to the degree to the vision of a non-affected individual.
- the visual recovery described in the animal studies described below may, in human terms, place the person on the low end of vision function by increasing one aspect of vision (i.e., light sensitivity, or visual evoked potential) without restoring full sight. Nevertheless, placement at such a level would be a significant benefit because these individuals could be trained in mobility and potentially in low order resolution tasks which would provide them with a greatly improved level of visual independence compared to total blindness. Even basic light perception can be used by visually impaired individuals, whose vision is improved using the present compositions and methods, to accomplish specific daily tasks and improve general mobility, capability, and quality of life.
- the degree of restoration of vision can be determined through the measurement of vision before, and preferably after, administering a vector comprising, for example, DNA encoding a therapeutic transfene such as Chop2 or halorhodopsin or both.
- Vision can be measured using any of a number of methods well-known in the art or methods not yet established. Vision, as improved or restored by the present invention, can be measured by any of the following visual responses:
- VEP visual evoked potential
- improvement or restoration of vision can include, but is not limited to: increases in amplitude or kinetics of photocurents or electrical response in response to light stimulus in the retinal cells, increases in light sensitivity (i.e., lowering the threshold light intensity required for intiating a photocurrent or electrical response in response to light stimulus, thereby requiring less or lower light to evoke a photocurrent) of the retinal cells, increases in number or amplitude of light-evoked spiking or spike firings, increases in light responses to the visual cortex, which includes increasing in visual evoked potential transmitted from the retina or retinal cells to the visual cortex or the brain.
- the present invention may also be used in combination with other forms of vision therapy known in the art to improve or restore vision.
- visual prostheses which include retinal implants, cortical implants, lateral geniculate nucleus implants, or optic nerve implants.
- the subject being treated may be provided with a visual prosthesis before, at the same time as, or after the molecular method is employed.
- the effectiveness of visual prosthetics can be improved with training of the individual, thus enhancing the potential impact of the Chop2 transformation of patient cells as contemplated herein.
- Training methods such as habituation training characterized by training the subject to recognize recognize (i) varying levels of light and/or pattern stimulation, and/or (ii) environmental stimulation from a common light source or object as would be understood by one skilled in the art; and orientation and mobility training characterized by training the subject to detect visually local objects and move among said objects more effectively than without the training.
- habituation training characterized by training the subject to recognize recognize (i) varying levels of light and/or pattern stimulation, and/or (ii) environmental stimulation from a common light source or object as would be understood by one skilled in the art
- orientation and mobility training characterized by training the subject to detect visually local objects and move among said objects more effectively than without the training.
- any visual stimulation techniques that are typically used in the field of low vision rehabilitation are applicable here.
- a “subject” is meant an individual.
- the "subject” can include domesticated animals ⁇ e.g., cats, dogs, etc.), livestock ⁇ e.g., cattle, horses, pigs, sheep, goats, etc.), laboratory animals ⁇ e.g., mouse, rabbit, rat, guinea pig, etc.), and birds.
- “Subject” can also include a mammal, such as a primate or a human.
- the subject is a human.
- a "subject in need thereof is a subject suffering from or at risk of developing or suffering from an ocular disease or disorder.
- a subject at risk of developing or suffering from an ocular disease or disorder can be diagnosed by a physician or ocular specialist using routine methods in the art.
- Example 1 Plasmin increases delivery of AAV2- vector encoding Chop2 to the retina
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Natural Medicines & Medicinal Plants (AREA)
- Ophthalmology & Optometry (AREA)
- Genetics & Genomics (AREA)
- Zoology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- Medical Informatics (AREA)
- Microbiology (AREA)
- Botany (AREA)
- Alternative & Traditional Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2016502078A JP6483083B2 (ja) | 2013-03-14 | 2014-03-13 | 治療用化合物の眼への送達を増強する方法 |
| HK16108714.0A HK1220625B (en) | 2013-03-14 | 2014-03-13 | A plasmin for use in enhancing delivery of therapeutic compounds to the eyes or for improving vision |
| AU2014243925A AU2014243925B2 (en) | 2013-03-14 | 2014-03-13 | Method of enhancing delivery of therapeutic compounds to the eye |
| US14/777,420 US9730888B2 (en) | 2013-03-14 | 2014-03-13 | Method of enhancing delivery of therapeutic compounds to the eye |
| CA2903545A CA2903545C (en) | 2013-03-14 | 2014-03-13 | Method of enhancing delivery of therapeutic compounds to the eye |
| EP14723170.8A EP2968476B1 (en) | 2013-03-14 | 2014-03-13 | A plasmin for use in enhancing delivery of therapeutic compounds to the eyes or for improving vision |
| US15/676,268 US20180064640A1 (en) | 2013-03-14 | 2017-08-14 | Method of Enhancing Delivery of Therapeutic Compounds to the Eye |
| AU2019201474A AU2019201474A1 (en) | 2013-03-14 | 2019-03-04 | Method of enhancing delivery of therapeutic compounds to the eye |
| US16/593,302 US20200268647A1 (en) | 2013-03-14 | 2019-10-04 | Method of enhancing delivery of therapeutic compounds to the eye |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201361785015P | 2013-03-14 | 2013-03-14 | |
| US61/785,015 | 2013-03-14 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US14/777,420 A-371-Of-International US9730888B2 (en) | 2013-03-14 | 2014-03-13 | Method of enhancing delivery of therapeutic compounds to the eye |
| US15/676,268 Continuation US20180064640A1 (en) | 2013-03-14 | 2017-08-14 | Method of Enhancing Delivery of Therapeutic Compounds to the Eye |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2014160281A2 true WO2014160281A2 (en) | 2014-10-02 |
| WO2014160281A3 WO2014160281A3 (en) | 2015-04-09 |
Family
ID=50687629
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2014/026224 Ceased WO2014160281A2 (en) | 2013-03-14 | 2014-03-13 | Method of enhancing delivery of therapeutic compounds to the eye |
Country Status (6)
| Country | Link |
|---|---|
| US (3) | US9730888B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP2968476B1 (cg-RX-API-DMAC7.html) |
| JP (3) | JP6483083B2 (cg-RX-API-DMAC7.html) |
| AU (2) | AU2014243925B2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA2903545C (cg-RX-API-DMAC7.html) |
| WO (1) | WO2014160281A2 (cg-RX-API-DMAC7.html) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20190075906A (ko) * | 2016-08-29 | 2019-07-01 | 웨인 스테이트 유니버시티 | 개선된 광 민감성을 갖는 채널옵신 변이체에서의 돌연변이의 확인 및 이의 용도 |
| US10912845B2 (en) | 2014-02-25 | 2021-02-09 | The University Of Manchester | Treatment of retinal degeneration using gene therapy |
| US11771741B2 (en) | 2019-09-13 | 2023-10-03 | Restore Vision Inc. | Nucleic acid construct that encodes chimeric rhodopsin |
| US11932679B2 (en) | 2016-09-02 | 2024-03-19 | Keio University | Agent for restoring visual function or agent for preventing deterioration in visual function |
| WO2024088156A1 (zh) * | 2022-10-24 | 2024-05-02 | 景泽生物医药(合肥)有限公司 | 重组人奥克纤溶酶在制备治疗脉络膜血管疾病药物中的用途 |
| US12606606B2 (en) | 2019-09-13 | 2026-04-21 | Restore Vision Inc. | Nucleic acid construct that encodes chimeric rhodopsin |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11261236B2 (en) | 2017-01-06 | 2022-03-01 | Kyungpook National University Industry-Academic Cooperation Foundation | Fusion peptide comprising thrombus-targeting peptide, ferritin fragment and thrombolytic peptide, and use thereof |
| WO2018181071A1 (ja) * | 2017-03-28 | 2018-10-04 | 森永乳業株式会社 | 非コラーゲン性糖タンパク質分解用組成物 |
| US20220233655A1 (en) * | 2019-05-17 | 2022-07-28 | Research Institute At Nationwide Children's Hospital | Improved delivery of gene therapy vectors to retinal cells using a glycoside hydrolase enzyme |
| GB202002073D0 (en) * | 2020-02-14 | 2020-04-01 | Ucl Business Ltd | Horizontal cells |
| CA3195696A1 (en) * | 2020-09-17 | 2022-03-24 | Restore Vision Inc. | Composition for treating or preventing diseases, disorders, or conditions associated with endoplasmic reticulum stress or all-trans-retinal, protecting retinal thickness, or suppressing reduction in retinal thickness or progress of reduction in retinal thickness |
| JP2022184212A (ja) * | 2021-05-31 | 2022-12-13 | ユニ・チャーム株式会社 | 月経血を吸収するための吸収性物品 |
| CN113355309B (zh) * | 2021-08-10 | 2021-11-05 | 迈威(上海)生物科技股份有限公司 | 重组截短型人纤维蛋白溶酶制备工艺 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000015822A1 (en) | 1998-09-17 | 2000-03-23 | University Of Florida | Methods for treatment of degenerative retinal diseases |
| US8470790B2 (en) | 2006-05-04 | 2013-06-25 | Wayne State University | Restoration of visual responses by in vivo delivery of rhodopsin nucleic acids |
| WO2013134295A1 (en) | 2012-03-05 | 2013-09-12 | Wayne State University | Identification of channelrhodopsin-2 (chop2) mutations and methods of use |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB0228409D0 (en) * | 2002-12-06 | 2003-01-08 | Thromb X Nv | Pharmacological vitreolysis |
| WO2007005856A1 (en) * | 2005-06-30 | 2007-01-11 | Ista Pharmaceuticals, Inc. | Use of hyaluronidase in combination with plasmin for the induction of posterior vitreous detachment |
| US20070196350A1 (en) * | 2006-02-22 | 2007-08-23 | Bartels Stephen P | Compositions and Methods for Effecting Controlled Posterior Vitreous Detachment |
| WO2009067407A2 (en) * | 2007-11-19 | 2009-05-28 | Bausch & Lomb Incorporated | Compositions of matrix metalloproteinase activating endopeptidases for reducing intraocular pressure, and methods of use thereof |
| KR20120050442A (ko) * | 2009-07-10 | 2012-05-18 | 쓰롬보제닉스 엔.브이. | 플라스미노겐 및 플라스민의 변이체 |
| US20120189609A1 (en) * | 2009-08-28 | 2012-07-26 | Thrombogenics Nv | Improvement to trabeculectomy |
-
2014
- 2014-03-13 EP EP14723170.8A patent/EP2968476B1/en active Active
- 2014-03-13 WO PCT/US2014/026224 patent/WO2014160281A2/en not_active Ceased
- 2014-03-13 JP JP2016502078A patent/JP6483083B2/ja active Active
- 2014-03-13 AU AU2014243925A patent/AU2014243925B2/en not_active Ceased
- 2014-03-13 CA CA2903545A patent/CA2903545C/en active Active
- 2014-03-13 US US14/777,420 patent/US9730888B2/en active Active
-
2017
- 2017-08-14 US US15/676,268 patent/US20180064640A1/en not_active Abandoned
-
2018
- 2018-12-05 JP JP2018228150A patent/JP2019055980A/ja active Pending
-
2019
- 2019-03-04 AU AU2019201474A patent/AU2019201474A1/en not_active Abandoned
- 2019-10-04 US US16/593,302 patent/US20200268647A1/en not_active Abandoned
-
2020
- 2020-11-12 JP JP2020188684A patent/JP2021038240A/ja active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000015822A1 (en) | 1998-09-17 | 2000-03-23 | University Of Florida | Methods for treatment of degenerative retinal diseases |
| US8470790B2 (en) | 2006-05-04 | 2013-06-25 | Wayne State University | Restoration of visual responses by in vivo delivery of rhodopsin nucleic acids |
| WO2013134295A1 (en) | 2012-03-05 | 2013-09-12 | Wayne State University | Identification of channelrhodopsin-2 (chop2) mutations and methods of use |
Non-Patent Citations (8)
| Title |
|---|
| ALTSCHUL ET AL., J MOL BIOL, vol. 215, no. 3, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES, vol. 25, no. 17, 1997, pages 3389 - 402 |
| BALKEMA GW ET AL., INVEST OPHTHALMOL VIS SCI., vol. 25, 1984, pages 795 - 800 |
| GENNARO, AE.: "Remington: The Science and Practice of Pharmacy", 2003, LIPPINCOTT WILLIAMS & WILKINS PUBLISHERS |
| HAYES, JM ET AL., BEHAV GENET, vol. 23, 1993, pages 395 - 403 |
| MCLAUGHLIN, SK ET AL., J VIROL, vol. 62, 1988, pages 1963 |
| MITCHINER JC ET AL., VISION RES., vol. 16, 1976, pages 1169 - 71 |
| PETRS-SILVA ET AL., MOL THER., vol. 19, 2011, pages 293 - 301 |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10912845B2 (en) | 2014-02-25 | 2021-02-09 | The University Of Manchester | Treatment of retinal degeneration using gene therapy |
| KR20190075906A (ko) * | 2016-08-29 | 2019-07-01 | 웨인 스테이트 유니버시티 | 개선된 광 민감성을 갖는 채널옵신 변이체에서의 돌연변이의 확인 및 이의 용도 |
| KR102609571B1 (ko) * | 2016-08-29 | 2023-12-01 | 웨인 스테이트 유니버시티 | 개선된 광 민감성을 갖는 채널옵신 변이체에서의 돌연변이의 확인 및 이의 용도 |
| KR20230169427A (ko) * | 2016-08-29 | 2023-12-15 | 웨인 스테이트 유니버시티 | 개선된 광 민감성을 갖는 채널옵신 변이체에서의 돌연변이의 확인 및 이의 용도 |
| US12234267B2 (en) | 2016-08-29 | 2025-02-25 | Wayne State University | Identification of mutations in channelopsin variants having improved light sensitivity and methods of use thereof |
| KR102877327B1 (ko) * | 2016-08-29 | 2025-10-27 | 웨인 스테이트 유니버시티 | 개선된 광 민감성을 갖는 채널옵신 변이체에서의 돌연변이의 확인 및 이의 용도 |
| US11932679B2 (en) | 2016-09-02 | 2024-03-19 | Keio University | Agent for restoring visual function or agent for preventing deterioration in visual function |
| US11771741B2 (en) | 2019-09-13 | 2023-10-03 | Restore Vision Inc. | Nucleic acid construct that encodes chimeric rhodopsin |
| US12606606B2 (en) | 2019-09-13 | 2026-04-21 | Restore Vision Inc. | Nucleic acid construct that encodes chimeric rhodopsin |
| WO2024088156A1 (zh) * | 2022-10-24 | 2024-05-02 | 景泽生物医药(合肥)有限公司 | 重组人奥克纤溶酶在制备治疗脉络膜血管疾病药物中的用途 |
Also Published As
| Publication number | Publication date |
|---|---|
| US20200268647A1 (en) | 2020-08-27 |
| US20180064640A1 (en) | 2018-03-08 |
| HK1220625A1 (zh) | 2017-05-12 |
| AU2014243925A1 (en) | 2015-10-08 |
| JP6483083B2 (ja) | 2019-03-13 |
| CA2903545C (en) | 2022-09-06 |
| AU2014243925B2 (en) | 2018-12-06 |
| WO2014160281A3 (en) | 2015-04-09 |
| EP2968476B1 (en) | 2021-05-05 |
| JP2019055980A (ja) | 2019-04-11 |
| JP2021038240A (ja) | 2021-03-11 |
| AU2019201474A1 (en) | 2019-03-28 |
| US9730888B2 (en) | 2017-08-15 |
| JP2016519063A (ja) | 2016-06-30 |
| US20160038409A1 (en) | 2016-02-11 |
| EP2968476A2 (en) | 2016-01-20 |
| CA2903545A1 (en) | 2014-10-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20200268647A1 (en) | Method of enhancing delivery of therapeutic compounds to the eye | |
| US11883463B2 (en) | Restoration of visual responses by in vivo delivery of rhodopsin nucleic acids | |
| US9968689B2 (en) | AAV-mediated subcellular targeting of heterologous rhodopsins in retinal ganglion cells | |
| EP3029063B1 (en) | Light-sensitive chimeric gpcr protein | |
| US20230159609A1 (en) | G-protein-gated-k+ channel-mediated enhancements in light sensitivity in rod-cone dystrophy (rcd) | |
| EP3892738A1 (en) | G-protein-gated-k+ channel-mediated enhancements in light sensitivity in rod-cone dystrophy (rcd) | |
| US10047130B2 (en) | Methods and compositions for red-shifted chromophore substitution for optogenetic applications | |
| HK1220625B (en) | A plasmin for use in enhancing delivery of therapeutic compounds to the eyes or for improving vision | |
| US20230338581A1 (en) | G-protein-gated-k+ channel-mediated enhancements in light sensitivity in rod-cone dystrophy (rcd) | |
| US20260048089A1 (en) | G-protein-gated-k+ channel-mediated enhancements in light sensitivity in rod-cone dystrophy (rcd) | |
| HK40004342A (en) | Restoration of visual responses by in vivo delivery of rhodopsin nucleic acids | |
| HK1205744A1 (en) | Identification of channelrhodopsin-2 (chop2) mutations and methods of use | |
| HK1205744B (en) | Identification of channelrhodopsin-2 (chop2) mutations and methods of use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 14723170 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2903545 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2016502078 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2014723170 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14777420 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2014243925 Country of ref document: AU Date of ref document: 20140313 Kind code of ref document: A |