WO2014072876A1 - Platelet-derived growth factor b specific antibodies and compositions and uses thereof - Google Patents
Platelet-derived growth factor b specific antibodies and compositions and uses thereof Download PDFInfo
- Publication number
- WO2014072876A1 WO2014072876A1 PCT/IB2013/059718 IB2013059718W WO2014072876A1 WO 2014072876 A1 WO2014072876 A1 WO 2014072876A1 IB 2013059718 W IB2013059718 W IB 2013059718W WO 2014072876 A1 WO2014072876 A1 WO 2014072876A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- cdr
- amino acid
- acid sequence
- antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- the present invention relates to antibodies, e.g., full length antibodies and antigen binding fragments thereof that specifically bind platelet-derived growth factor B (PDGF-B).
- the invention further relates to compositions comprising antibodies to PDGF-B, and methods of using the antibodies as a medicament.
- the PDGF-B antibodies are useful for treating and preventing diseases and disorders mediated by PDGF-B binding to PDGFR3 (both PDGFR33 and PDGFRa3 homo- and heterodimeric receptors, respectively).
- PDGFs are the primary mitogens for the cells of the mesenchymal and neuroectodermal origin.
- the PDGF family is composed of four different polypeptide chains, PDGF-A, B, C and D, which have been shown to form 5 distinct proteins by homo and heterodimerization, PDGF-AA, -AB, -BB, -CC and -DD.
- PDGFs exert their biological activities by activating two structurally related tyrosine kinase receptors, PDGF-Ra and ⁇ , which form homo- and heterodimers (e.g., PDGFRaa, PDGFRa3, PDGFR33).
- PDGF-A activates PDGFRaa
- PDGF-B can activate all three receptor dimers, i.e., PDGF-Raa, PDGF-Ra3, PDGF-R33.
- PDGF-AB and PDGF-C activate PDGF-Raa and PDGF-Ra3, whereas PDGF-D preferentially activates PDGF-R33 as reviewed by Trojanowska (2008, Rheumatology 47:v2-v4).
- PDGFs have been implicated in a wide variety of human diseases, including, but not limited to, atherosclerosis, restenosis, pulmonary hypertension, retinal vascular disease, organ fibrosis (e.g., cardiac, lung, renal and kidney), rheumatoid arthritis, osteoarthritis, tumorigenesis, and systemic sclerosis (SSc; scleroderma) (see, e.g., Trojanowska, 2008, Rheumatology 47:v2-v4; Andrae et al. 2008 Genes Dev. 22: 1276- 1312).
- SSc systemic sclerosis
- PDGF-B and PDGF-D appear to be especially important in human renal diseases.
- Mesangial cells produce PDGF-B in vitro, and various growth factors induce mesangial proliferation via induction of autocrine or paracrine PDGF-B-chain excretion (Silver et al., 1989, Proc. Natl. Acad. Sci. USA 86: 1056-1060; Floege et al., 1991 , Clin.
- PDGF-B-chain or ⁇ -receptor knock-out mice fail to develop a mesangium (Leveen et al., 1994, Genes Dev. 8:1875-1887; Soriano P., 1994, Genes Dev. 8:1888-1896).
- liver fibrosis is commonly observed after chronic liver injury.
- the major event in hepatic fibrogenesis is the proliferation of, and collagen production by hepatic stellate cells and myofibroblasts.
- PDGF is strongly mitogenic and causes hepatic stellate cell and myofibroblast chemotaxis (Czochra et al., 2006, J. Hepatol. 45:419-28).
- PDGF-BB and PDGFR3 protein expression is markedly enhanced in comparison with normal liver (Ikura et al., 1997, J Gastroenterol. 32:496-501 ).
- PDGF-B mRNA expression and PDGF-BB protein production has been observed to be increased in the bile duct segment, biliary epithelial cells, infiltrating macrophages and hepatic stellate cells (Kinnman et al., 2000, Lab. Invest. 80: 697-707; Grappone et al., 1999, J. Hepatol. 31 :100-109; Bonner, JC, 2004, Cytokine Growth Factor Rev. 15: 255-273).
- PDGF-BB-induced signaling via PDGFR3 strongly promotes hepatic stellate cell proliferation, migration and phenotypic change into myofibroblasts, followed by collagen deposition and fibrogenesis (Kinnman et al., 2001 , Lab. Invest. 81 :1709-1716; Kinnman et al., 2003, Lab. Invest. 83:163-173).
- fibrotic diseases and disorders mediated by PDGF-AB and/or PDGF-BB signaling via the interaction of these ligands comprising PDGF-B with the PDGFR3 exact a heavy toll on human mortality and morbidity. Therefore, there is a long-felt need for novel potential therapeutics to treat or ameliorate these diseases/disorders, and the present invention meets this need.
- the invention includes an isolated antibody, or antigen-binding fragment thereof, that specifically binds PDGF-B and comprises a heavy chain variable region (V H ) comprising a V H complementarity determining region one (CDR-H1 ), CDR-H2, and region (V L ) comprising a VL CDR1 (CDR-L1 ), CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ I D NO:4.
- V H heavy chain variable region
- CDR-H1 V H complementarity determining region one
- V L region
- the antibody comprises a V H comprising a CDR-H2, and CDR-H3 of the VH amino acid sequence of SEQ ID NO: 6; and a V L comprising a CDR-L1 , CDR- L2, and CDR-L3 of the V L amino acid sequence of SEQ ID NO:4.
- the antibody comprises a V H comprising the CDR-H1 amino acid sequence of SEQ ID NO:7, the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR- L1 amino acid sequence of SEQ ID NO:10, the CDR-L2 amino acid sequence of SEQ ID NO:1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:12.
- the antibody comprises a V H comprising the CDR-H2 amino acid sequence of SEQ I D NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9, and a V L comprising the CDR-L1 amino acid sequence of SEQ ID NO: 10, the CDR-L2 amino acid sequence of SEQ ID NO:1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:12.
- the antibody comprises a V H comprising a CDR-H1 , CDR- H2, and CDR-H3 of the V H amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VH (ATCC accession number PTA-13303), and a light chain variable region (V L ) comprising a CDR-L1 , CDR-L2, and CDR-L3 of the V L amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VL (ATCC accession number PTA-13302).
- V H comprising a CDR-H1 , CDR- H2, and CDR-H3 of the V H amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VL (ATCC accession number PTA-13302).
- the antibody comprises a V H comprising a CDR-H2 and CDR-H3 of a VH amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VH (ATCC accession number PTA-13303), and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VL (ATCC accession number PTA-13302).
- the antibody comprises a V H comprising the amino acid sequence of SEQ ID NO: 2 and a V L comprising the amino acid sequence of SEQ ID NO:1.
- the antibody comprises a V H comprising the amino acid sequence of SEQ ID NO: 6 and a V L comprising the amino acid sequence of SEQ ID NO: 1.
- the antibody comprises a V H comprising the amino acid sequence of SEQ ID NO: 2 and a V L comprising the amino acid sequence of SEQ ID NO:4.
- the antibody comprises a heavy chain comprising the sequence of SEQ ID NO: 14 and a light chain comprising the amino acid sequence of SEQ ID NO:16.
- the antibody comprises a V H comprising a CDR-H 1 , CDR-H2 and
- CDR-H3 encoded by the nucleic acid sequence of SEQ ID NO:5
- V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:3.
- the antibody comprises a V H comprising a CDR-H2 and CDR- l-13 encoded by the nucleic acid sequence of SEQ ID NO:5, and a V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:3.
- the antibody comprises a V H encoded by the nucleic acid sequence of SEQ ID NO:5, and a V L encoded by the nucleic acid sequence of SEQ ID NO:3.
- the antibody comprises a heavy chain encoded by the nucleic acid sequence of SEQ ID NO: 13, and a light chain encoded by the nucleic acid sequence of SEQ ID NO: 15.
- the antibody comprises a V H comprising a CDR-H 1 , CDR-H2, and CDR-H3 of the VH amino acid sequence of SEQ ID NO:44, and a VL comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:39.
- the antibody comprises a VH comprising a CDR-H2 and CDR- l-13 of the V H amino acid sequence of SEQ ID NO:44, and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:39.
- the antibody comprises V H comprising the CDR-H 1 amino acid sequence of SEQ ID NO:7, the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR- L1 amino acid sequence of SEQ ID NO: 1 0, the CDR-L2 amino acid sequence of SEQ ID NO:41 , and the CDR-L3 amino acid sequence of SEQ ID NO: 12.
- the antibody comprises V H comprising the CDR-H2 amino acid sequence of SEQ ID NO:8 and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V
- the antibody comprises a V H comprising the amino acid sequence of SEQ ID NO:44; and a V L comprising the amino acid sequence of SEQ ID NO:39.
- the antibody comprises a heavy chain comprising the sequence of SEQ ID NO:46, and a light chain comprising the amino acid sequence of SEQ ID NO:42.
- the antibody comprises a V H comprising a CDR-H1 , CDR-H2, and CDR-H3 of the V H amino acid sequence of SEQ ID NO:44; and a V L comprising a CDR- L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:34.
- the antibody comprises a V H comprising a CDR-H2 and CDR- H3 of the V H amino acid sequence of SEQ ID NO:44; and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:34.
- the antibody comprises a V H comprising the CDR-H1 amino acid sequence of SEQ ID NO:7, the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR- L1 amino acid sequence of SEQ ID NO:10, the CDR-L2 amino acid sequence of SEQ ID NO:1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:36.
- the antibody comprises a V H comprising the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR-L1 amino acid sequence of SEQ ID NO:10, the CDR-L2 amino acid sequence of SEQ ID NO:1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:36.
- the antibody comprises a V H comprising the amino acid sequence of SEQ ID NO:44; and a V L comprising the amino acid sequence of SEQ ID NO:34.
- the antibody comprises a heavy chain comprising the sequence of SEQ ID NO:46, and a light chain comprising the amino acid sequence of SEQ ID NO:37.
- the invention includes an isolated nucleic acid encoding an antibody, or antigen- binding fragment thereof, wherein the antibody comprises a heavy chain variable region (VH) comprising a V H complementarity determining region one (CDR-H1 ), CDR-H2, and CDR-H3 of the VH amino acid sequence of SEQ ID NO: 6; and a light chain variable region (V L ) comprising a VL CDR1 (CDR-L1 ), CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ I D NO:4.
- VH heavy chain variable region
- CDR-H1 V H complementarity determining region one
- CDR-H2 CDR-H2
- V L light chain variable region
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H2, and CDR-H3 of the V H amino acid sequence of SEQ ID NO: 6; and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the V L amino acid sequence of SEQ ID NO:4.
- the nucleic acid encodes an antibody comprising a V H comprising the CDR-H1 amino acid sequence of SEQ ID NO:7, the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR-L1 amino acid sequence of SEQ ID NO:10, the CDR-L2 amino acid sequence of SEQ ID NO:1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:12.
- the nucleic acid encodes an antibody comprising a V H comprising the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9, and a V L comprising the CDR-L1 amino acid sequence of SEQ ID NO: 10, the CDR-L2 amino acid sequence of SEQ ID NO:1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:12.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H1 , CDR-H2, and CDR-H3 of the VH amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VH (ATCC accession number PTA-13303), and a light chain variable region (VL) comprising a CDR-L1 , CDR-L2, and CDR-L3 of the V L amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VL (ATCC accession number PTA-13302).
- VL light chain variable region
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H2 and CDR-H3 of a V H amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457-GL-VH (ATCC accession number PTA- 13303), and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence encoded by the polynucleotide insert of the vector deposited as MOR8457- GL-VL (ATCC accession number PTA-13302).
- the nucleic acid encodes an antibody comprising a V H comprising the amino acid sequence of SEQ ID NO: 2 and a V L comprising the amino acid sequence of SEQ I D NO:1.
- the nucleic acid encodes an antibody comprising a V H comprising the amino acid sequence of SEQ ID NO: 6 and a V L comprising the amino acid sequence of SEQ I D NO:4.
- the nucleic acid encodes an antibody comprising a V H comprising the amino acid sequence of SEQ ID NO: 6 and a V L comprising the amino acid sequence of SEQ I D NO:1.
- the nucleic acid encodes an antibody comprising a V H comprising the amino acid sequence of SEQ ID NO: 2 and a V L comprising the amino acid sequence of SEQ I D NO:4.
- the nucleic acid encodes an antibody comprising a heavy chain comprising the sequence of SEQ ID NO: 14 and a light chain comprising the amino acid sequence of SEQ I D NO:16.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H1 , CDR-H2, and CDR-H3 of the V H amino acid sequence of SEQ ID NO:44, and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:39.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H2 and CDR-H3 of the V H amino acid sequence of SEQ ID NO:44, and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:39.
- the nucleic acid encodes an antibody comprising a V H comprising the CDR-H1 amino acid sequence of SEQ ID NO:7, the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR-L1 amino acid sequence of SEQ ID NO:10, the CDR-L2 amino acid sequence of SEQ ID NO:41 , and the CDR-L3 amino acid sequence of SEQ ID NO:12.
- the nucleic acid encodes an antibody comprising a V H comprising the CDR-H2 amino acid sequence of SEQ ID NO:8 and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR-L1 amino acid sequence of SEQ ID NO: 10, the CDR-L2 amino acid sequence of SEQ ID NO:41 , and the CDR-L3 amino acid sequence of SEQ ID NO: 12.
- the nucleic acid encodes an antibody comprising a V H comprising the amino acid sequence of SEQ ID NO:44; and a V L comprising the amino acid sequence of SEQ ID NO:39.
- the nucleic acid encodes an antibody comprising a heavy chain comprising the sequence of SEQ ID NO:46, and a light chain comprising the amino acid sequence of SEQ ID NO:42.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H 1 , CDR-H2, and CDR-H3 of the V H amino acid sequence of SEQ ID NO:44; and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:34.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H2 and CDR-H3 of the V H amino acid sequence of SEQ ID NO:44; and a V L comprising a CDR-L1 , CDR-L2, and CDR-L3 of the VL amino acid sequence of SEQ ID NO:34.
- the nucleic acid encodes an antibody comprising a V H comprising the CDR-H 1 amino acid sequence of SEQ ID NO:7, the CDR-H2 amino acid sequence of SEQ ID NO:8, and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a VL comprising the CDR-L1 amino acid sequence of SEQ ID NO: 10, the CDR-L2 amino acid sequence of SEQ ID NO: 1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:36.
- the nucleic acid encodes an antibody comprising a V H comprising the CDR-H2 amino acid sequence of SEQ ID NO:8 and the CDR-H3 amino acid sequence of SEQ ID NO: 9; and a V L comprising the CDR-L1 amino acid sequence of SEQ ID NO: 10, the CDR-L2 amino acid sequence of SEQ ID NO: 1 1 , and the CDR-L3 amino acid sequence of SEQ ID NO:36.
- the nucleic acid encodes an antibody comprising a V H comprising the amino acid sequence of SEQ ID NO:44; and a V L comprising the amino acid sequence of SEQ I D NO:34.
- the antibody comprises a heavy chain comprising the sequence of SEQ ID NO:46, and a light chain comprising the amino acid sequence of SEQ ID NO:37.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H1 , CDR-H2 and CDR-H3 encoded by the nucleic acid sequence of SEQ ID NO:5, and a V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:3.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H2 and CDR-H3 encoded by the nucleic acid sequence of SEQ ID NO:5, and a V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:3.
- the nucleic acid encodes an antibody comprising a V H encoded by the nucleic acid sequence of SEQ ID NO:5, and a V L encoded by the nucleic acid sequence of SEQ ID NO:3.
- the nucleic acid encodes an antibody comprising a heavy chain encoded by the nucleic acid sequence of SEQ ID NO:13, and a light chain encoded by the nucleic acid sequence of SEQ ID NO:15.
- the invention includes an isolated nucleic acid encoding an antibody, or antigen- binding fragment thereof, that specifically binds PDGF-B, wherein the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:3.
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO: 1
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:13.
- the nucleic acid comprises the nucleic acid sequence of
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:3 and the nucleic acid sequence of SEQ ID NO:5.
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:13 and the nucleic acid sequence of SEQ ID NO:15.
- nucleic acid comprises the nucleic acid sequence of the insert of the vector deposited as MOR8457-GL-VH having ATCC accession number PTA-13303. In another aspect, the nucleic acid comprises the nucleic acid sequence of the insert of the vector deposited as MOR8457-GL-VL having ATCC accession number PTA-13302.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H1 , CDR-H2 and CDR-H3 encoded by the nucleic acid sequence of SEQ ID NO:45, and a V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:35.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H2 and CDR-H3 encoded by the nucleic acid sequence of SEQ ID NO:45, and a V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:35.
- the nucleic acid encodes an antibody comprising a V H encoded by the nucleic acid sequence of SEQ ID NO:45, and a V L encoded by the nucleic acid sequence of SEQ ID NO:35.
- the nucleic acid encodes an antibody comprising a heavy chain encoded by the nucleic acid sequence of SEQ ID NO:47, and a light chain encoded by the nucleic acid sequence of SEQ ID NO:38.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H1 , CDR-H2 and CDR-H3 encoded by the nucleic acid sequence of SEQ ID NO:45, and a V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:40.
- the nucleic acid encodes an antibody comprising a V H comprising a CDR-H2 and CDR-H3 encoded by the nucleic acid sequence of SEQ ID NO:45, and a V L CDR-L1 , CDR-L2 and CDR-L3 encoded by the nucleic acid sequence of SEQ ID NO:40.
- the nucleic acid encodes an antibody comprising a V H encoded by the nucleic acid sequence of SEQ ID NO:45, and a V L encoded by the nucleic acid sequence of SEQ ID NO:40.
- the nucleic acid encodes an antibody comprising a heavy chain encoded by the nucleic acid sequence of SEQ ID NO:47, and a light chain encoded by the nucleic acid sequence of SEQ ID NO:43.
- nucleic acid comprises the nucleic acid sequence of SEQ ID NO:35. ln another aspect, the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:40.
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO: 1
- nucleic acid comprises the nucleic acid sequence of SEQ
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:43.
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:47.
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:35 and SEQ ID NO:45.
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:40 and SEQ ID NO:45.
- nucleic acid comprises the nucleic acid sequence of SEQ
- the nucleic acid comprises the nucleic acid sequence of SEQ ID NO:43 and SEQ ID NO:47.
- the invention includes a host cell comprising the nucleic acid. In one aspect, the invention includes a vector comprising the nucleic acid.
- the invention includes a host cell comprising the vector.
- the host cell is a bacterial cell or a mammalian cell.
- the invention includes a method of producing the antibody, or antigen-binding fragment thereof, that specifically binds PDGF-B, said method comprising culturing the host cell under conditions wherein the antibody is expressed, and further comprising isolating the antibody.
- the invention includes an isolated antibody, or antigen-binding fragment thereof, of claim 1 , wherein the V L comprises the amino acid sequence of SEQ ID NO:4 and further comprises at least one amino acid substitution in an amino acid not within a CDR.
- the antibody comprises a V H comprising the amino acid sequence of SEQ ID NO:6 and further comprises at least one amino acid substitution in an amino acid not within a CDR.
- the antibody comprises a V L comprising the amino acid sequence of SEQ ID NO:4 and further comprises at least one amino acid substitution in an amino acid not within a CDR, and a V H comprising the amino acid sequence of SEQ ID NO:6 and further comprises at least one amino acid substitution in an amino acid not within a CDR.
- the invention includes an isolated antibody, or antigen-binding fragment thereof, that specifically binds PDGF-B, wherein the antibody binds the same epitope as an antibody disclosed herein, or overlaps with the binding site on PDGFR33 for PDGF-B as an antibody disclosed herein, and wherein said antibody is not AbyD3263.
- the invention includes an isolated antibody, or antigen-binding fragment thereof, that specifically binds PDGF-B, wherein the antibody cross-competes with PDGFR33 for binding to PDGF-B and further wherein theantibody binds PDGF-B with a K D ranging from 2 pM to 100 pM.
- the antibody binds at least one epitope on PDGF-BB wherein the epitope is selected from group consisting of:
- the antibody comprises a paratope, wherein the paratope comprises at least one amino acid selected from the group consisting of: amino acid residues G28, S29, Y30, F31 , D49, D50, F90, T91 , H92, N93, S94 based on Kabat numbering with respect to the sequence of SEQ ID NO:1 and amino acid residues Y50, L57, Y59, Y60, D62, W102, Y103, G104, G105 based on Kabat numbering with respect to the sequence of SEQ ID NO:2.
- the paratope can further comprise the amino acid residue N65 based on Kabat numbering with respect to the sequence of SEQ ID NO:1 and/or residue W47 based on Kabat numbering with respect to the sequence of SEQ ID NO:2.
- the invention includes an isolated antibody, or antigen-binding fragment thereof, wherein the antibody specifically binds PDGF-B with a K D ranging from about 2 pM to 69 pM, cross-competes with PDGFR3 for binding to PDGF-B, and inhibits an activity mediated by PDGF-B binding to PDGF3.
- the activity mediated by PDGF-B binding to PDGF3 is at least one selected from the group consisting of phosphorylation of said PDGF3, induction of cell proliferation, induction of cell migration, and increase deposition of extracellular matrix.
- the invention includes an isolated antibody, or antigen-binding fragment thereof, that specifically binds human PDGF-BB with a K D of about 13 pM, wherein the antibody:
- epitopes are approximately 190 A apart on PDGF-BB;
- (c) comprises a paratope comprising amino acid residues G28, S29, Y30, F31 , D49, D50, F90, T91 , H92, N93, S94 based on Kabat numbering with respect to the sequence of SEQ ID NO:1 and amino acid residues Y50, L57, Y59, Y60, D62, W102, Y103, G104, G105 based on Kabat numbering with respect to the sequence of SEQ ID NO:2; and
- Trp 47 contacts Lys 82 of PDGF-B, Leu 57 contacts lie 77 of PDGF-B, Tyr 59 contacts lie 77, Arg 79, Lys 80, Lys 81 , and
- Trp 102 contacts Leu 8, Val 39, Trp 40, Asn 54, Arg 56, lie 75, and Phe 84 of PDGF-B
- Tyr 103 contacts Trp 40, Arg 73, lie 75, and Phe 84 of PDGF-B
- Gly 104 contacts Arg 73 and Phe 84 of PDGF-B
- Gly 105 contacts Phe 84 of PDGF-B, wherein the numbering of the light chain variable domain amino acids is based on Kabat numbering with respect to SEQ ID NO:1 ; and
- amino acid residue numbering of PDGF-B contact residues is with respect to the amino acid sequence of SEQ ID NO:33.
- the invention includes a pharmaceutical composition comprising an antibody, or antigen-binding fragment thereof, of the invention, and a pharmaceutically acceptable carrier or excipient.
- the invention includes a method for reducing deposition of extracellular matrix in a subject in need thereof.
- the method comprises administering to the subject an effective amount of the pharmaceutical composition, thereby inhibiting excessive deposition of extracellular matrix in the subject.
- the invention further includes the use of an antibody, or antigen binding fragment thereof, or a pharmaceutical composition of the invention in the manufacture of a medicament for use in reducing deposition of extracellular matrix in a subject in need thereof.
- the invention further provides an antibody, or antigen binding fragment thereof, or a pharmaceutical composition of the invention for use in reducing deposition of extracellular matrix in a subject in need thereof.
- the invention includes method for preventing or treating a disease, disorder or condition mediated by PDGF-B binding to PDGFR3.
- the method comprises administering to a subject in need thereof an effective amount of the pharmaceutical composition.
- the invention further provides the use of an antibody, or antigen binding fragment thereof, or a pharmaceutical composition of the invention in the manufacture of a medicament for preventing or treating a disease, disorder or condition mediated by PDGF-B binding to PDGFR3.
- the invention further provides an antibody, or antigen binding fragment thereof, or a pharmaceutical composition of the invention for preventing or treating a disease, disorder or condition mediated by PDGF-B binding to PDGFR3.
- the disease, disorder or condition is at least one selected from the group consisting of: atherosclerosis, restenosis, pulmonary hypertension, retinal vascular disease, cardiac fibrosis, lung fibrosis, liver fibrosis, kidney fibrosis, systemic sclerosis, rheumatoid arthritis, osteoarthritis, and tumorigenesis.
- Figure 1 depicts the sequence alignment of the MOR-8457 heavy chain variable region (Figure 1A) and light chain variable region (Figure 1 B) with the closest four respective germline V regions in the IMGT database. Identical residues are shown as (.), and the frameworks and CDR1 and CDR2 are indicated.
- Figure 1 C sets out the amino acid sequence of MOR8457-VL without germlining (SEQ ID NO:1 ), and the CDRs are underlined.
- Figure 1 D sets out the amino acid sequence of MOR8457-VH without germlining (SEQ ID NO:2), and the CDRs are underlined.
- Figure 1 E sets out the amino acid sequence of MOR8457-GL-VL after germlining (SEQ ID NO:4), and the CDRs are underlined.
- Figure 1 F sets out the amino acid sequence of MOR8457-GL-VH after germlining (SEQ ID NO:6), and the CDRs are underlined.
- Figure 1 G sets out the amino acid sequence of MOR8457-GL-LC (SEQ ID NO:16) full length light chain wherein the VL region has been germlined.
- Figure 1 H sets out the amino acid sequence of MOR8457-GL-hlgG1 -3m-HC (SEQ ID NO:14) full length heavy chain comprising a germlined VH region and human lgG1 comprising an effector null triple mutation (3m) wherein the wild type sequence "LLGL” has been mutated to "AAGA”.
- the sites of the leucine to alanine substitutions are underlined.
- Figure 1 1 sets out the amino acid sequence of the light chain variable domain of the engineered variant MOR8457-15-VL (SEQ ID NO:34), with the CDRs underlined.
- Figure 1J sets out the amino acid sequence of the heavy chain variable domain of the engineered variants MOR8457-15-VH and MOR8457-16-VH (SEQ ID NO:44), with the CDRs underlined Both engineered variants MOR8457-15 and MOR8457-16 share the same heavy chain sequence.
- Figure 1 K sets out the amino acid sequence of the light chain variable domain of the engineered variant MOR8457-16-VL (SEQ ID NO:39), with the CDRs underlined.
- Figure 1 L sets out the amino acid sequence of MOR8457-15 (SEQ ID NO:37) full length light chain wherein the VL region has been engineered for improved biophysical properties.
- Figure 1 M sets out the amino acid sequence of the full length heavy chain of MOR8457-15-HC and MOR8457-16-HC (SEQ ID NO:46) comprising an engineered VH region and human lgG1 comprising an effector null triple mutation (3m) wherein the VH region has been engineered for improved biophysical properties and the constant region wild type sequence "LLGL” has been mutated to "AAGA".
- the sites of the leucine to alanine substitutions are underlined.
- Figure 1 N sets out the amino acid sequence of MOR8457-16-LC (SEQ ID NO:42) full length light chain wherein the VL region has been engineered for improved biophysical properties.
- Figure 2 comprising panels A through K, depicts Biacore sensorgrams showing the binding kinetics of MOR8457 antibodies to different PDGFs.
- Anti-human (A-D, l-K) or anti-mouse (E-H) IgG antibodies were immobilized in flow cells of CM5 sensor chips.
- 1 g/mL of MOR8457-IKR-hlgG1-3m (A-D), MOR8457-mlgG1 (E-H) or MOR8457-GL- hlgG1 -3m (l-K) was injected independently over the respective anti-human or anti- mouse surface for 10 seconds resulting in a stable anti-PDGF surface between 50- 100RU.
- Figure 3 depicts a sensorgram and a drawing illustrating that MOR8457-IKR- hlgG1 -3m but not PDGFR3-hlGg1 bound human PDGF-BB when it was already bound to MOR8457-mlgG1.
- MOR8457-mlgG1 was captured via anti-mouse IgG immobilized onto a CM5 sensor chip, resulting in a stable surface of 200-400RU (inject 1 ).
- Human PDGF-BB at 1 nM was injected for 6 minutes to reach the surface saturation (inject 2), followed by injection of MOR8457-IKR-hlgG1-3m (Cyclel , inject-3, black line), or PDGFR3-hlGg1 (Cycle 2, inject 3, grey line), or buffer (Cycle 3, inject 3, dashed line).
- Figure 4 depicts a sensorgram and a diagram illustrating that MOR8457-IKR- hlgG1 -3m could not bind human PDGF-BB when PDGF-BB was bound to hPDGFRp- hlgG1.
- PDGFR3-hlgG1 was captured onto a CM5 sensor chip via an anti-human IgG antibody (inject-1 ).
- Human PDGF-BB was then injected at a concentration of 1 nM for 6 minutes to saturate the binding sites on PDGFR3-hlgG1 (inject-2), followed by injecting MOR8457-IKR-hlgG1-3m (Cycle 1 , inject-3, black line), or buffer (Cycle 2, inject-3, grey line).
- MOR8457-I KR-hlgG1 -3m did not bind to pre-assembled PDGFR3-hlgG1/PDGF- BB complex suggesting that MOR8457 and PDGFR compete for the same binding sites on PDGF-BB. Data shown are from one representative experiment of two independent experiments.
- Figure 5 shows that MOR8457 blocked human PDGF-BB binding to PDGFRp-hlgG1 in solution.
- Figure 5A shows a diagram illustrating the Biacore set up of the competition assay in solution. MOR8457-mlgG1 was serially diluted in PBS then mixed with 1 mM of human PDGF-BB and incubated for 20 hours at 2-8 °C to reach equilibrium as indicated by the [brackets]. Each MOR8457-mlgG1 and PDGF-BB dilution mixture was then injected over the surface of PDGFRp-hlgG1 captured by anti-human lgG1 on a CM5 chip.
- Figure 5B depicts a graph showing a concentration response curve demonstrating that MOR8457 inhibited binding of PDGF- BB to PDGFRp-hlgG1 . Data shown are from one representative experiment of two independent experiments.
- Figure 6 depicts a diagram illustrating the binding mode of MOR8457 to a PDGF- BB dimer.
- the drawing illustrates that binding epitopes 1 and 2 on the PDGF-BB molecule are approximately 190 A apart such that a single MOR8457 antibody cannot bind both epitopes 1 and 2 simultaneously.
- the model demonstrates that the 2:1 binding stoichiometry observed elsewhere herein is due to the geometric constraints of the two epitopes being too far apart.
- Figure 7 depicts a diagram of a model showing the binding of one MOR8457 to one binding epitope on one PDGF-B.
- the diagram further depicts that the VH and VL domains of MOR8457 bind (i.e., contact residues less than 4 A apart) the following amino acid residues of PDGF-B: Leu 38, Val, 39, Trp 40, Asn 54, Arg 56, Glu 71 , Arg 73, lie 75, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86.
- Figure 8 comprising panels A and B, depicts two graphs showing that MOR8457 potently inhibited PDGF-BB induced human mesangial cell proliferation.
- Figure 8A depicts a graph showing a concentration response curve of PDGF-BB induced human mesangial cell proliferation in the absence of MOR8457.
- Primary human mesangial cells were cultured and seeded in 96-well plates. Cells were growth-arrested for 24 hours with serum-free MCM media. After 24 hours, the cells were stimulated with serially diluted PDGF-BB for 4 hours at 37°C. DNA synthesis was determined during the last 16 hours using a BrdU incorporation assay.
- FIG. 8B depicts a graph showing a representative inhibition curve of MOR8457 in the same assay shown in Figure 8A. That is, MOR8457-IKR-lgG1-3m was half-log diluted from 100 nM down to 0.1 nM then mixed with 2.5 ng/ml of PDGF-BB in serum-free MCM media for 30 minutes before the mixture was added to the cells. The proliferation assay was performed as described in Figure 8A. The average IC50 determined from three independent experiments was 13.4 ⁇ 2.8 pM and maximum inhibition was 87.9 ⁇ 5.7%.
- Figure 9 depicts two graphs showing a Schild analysis for competitive inhibition of MOR8457.
- Figure 9A depicts a graph showing the concentration response curve of PDGF-BB in the absence and presence of 0.01 , 0.1 , 1 and 10 nM of MOR8457-IKR-lgG1-3m. Antibodies were mixed with PDGF-BB and incubated for 2.5 hours at 25°C before the mixture was added to the cells. The cell proliferation assay was performed as described in Figure 8.
- Figure 9A shows that the curves shifted to the right with the increased concentration of MOR8457-IKR-lgG1 -3m and the extent of the inhibition was surmountable at high concentration of PDGF-BB, suggesting the inhibition is competitive.
- Figure 9B depicts a graph showing a Schild regression analysis.
- Schild analysis was performed as described (Arunklakshana & Schild, 1959, Br. J. Pharmacol. 65:48-58).
- the EC50 of PDGF-BB measured in the absence and presence of antibodies was used to calculate the dose ratio (DR).
- a series of log (DR-1 ) values for a series of log [B] antibody concentrations was plotted on the graph.
- the pA 2 deduced from the graph was about 20 pM, which is consistent with the binding affinity as measured by Biacore (i.e., about 13 pM).
- Figure 10 depict graphs demonstrating the effect of MOR8457-mlgG1 on mesangial cell proliferation on anti-Thy1.1 nephritis kidney tissue samples day 9 post OX-7 induction in rats.
- Nephritis was initiated in male Wistar rats by i.v. injection of monoclonal antibody OX-7 (1 mg/kg).
- Figure 1 1 depicts a graph showing the viscosity of seven antibodies at 100 mg/ml concentration in low salt and pH6.0 plotted against the Predicted FAB charge at pH6.0.
- the predicted FAB charge is calculated using the Discovery Studio 3.5 pKa predictor.
- the viscosity of antibodies AAB-001 , RK35, IMA-638, MOR8457 and MOR8457-GL are measured as described in the methods.
- MAb1 and MAb2 viscosity measurements are described in Yadav 2012, supra.
- Figure 12 shows the viscosity of seven antibodies at 100 mg/ml concentration in low salt and pH6.0 plotted against the Predicted Fab Dipole Moment Magnitude at pH 6.0.
- the predicted FAB charges were calculated using the Discovery Studio 3.5 pKa predictor. The dipole moment was then calculated using these charges.
- the viscosity of AAB-001 , RK35, IMA-638, MOR8457 and MOR8457-GL were measured as described in the methods.
- MAb1 and MAb2 viscosity measurements are described in Yadav 2012, supra.
- Figure 13 depicts a graph showing the viscosity of seven antibodies at 100 mg/ml concentration in low salt and pH6.0 plotted against the net charge of the residues in the CDR region.
- the net charge is calculated by giving positive charged residues +1 , negative charged residues -1 , and His a +1/2 charge.
- the viscosity of AAB-001 , RK35, IMA-638, MOR8457 and MOR8457-GL are measured as described in the methods. MAb1 and MAb2 viscosity measurements are described in Yadav 2012, supra.
- Figure 14 comprising panels A through G, depicts the electrostatic potential energy surfaces highlighting the CDR regions of: (A) AAB-001 (B) RK35 (C) MAb2 (D) IMA-638 (E) MAb1 (F) MOR8457-GL (G) MOR8457.
- Surface charge is shown as a spectrum from black for positively charged patches to white for negatively charged patches as depicted by the bar at the bottom right hand of the figure . All molecules are shown oriented such that each CDR region is facing outward (out of the plane of the paper) with the heavy chain to the left and the light chain to the right.
- Figure 15 depicts a graph showing the viscosity measurements for MOR8457 and engineered variants thereof as a function of increasing concentration.
- the parental MOR8457 antibody is shown as a solid line.
- Germlined MOR8457-GL is shown as a dotted line with solid squares.
- Engineered variant MOR8457-15 is shown as a dotted line with solid circles.
- Engineered variant MORR8457-16 is shown as a dotted line with solid triangles. The data shown demonstrate that the viscosity of MOR8457-16 is reduced compared with the other three MOR8457 antibodies.
- Figure 16 comprising panels A and B, depicts a diagram showing the structural model of (A) MOR8457-15 and (B) MOR8457-16 in complex with a PDGF-BB dimer.
- the Fab is shown as gray ribbons and the PDGF-BB dimer is a light gray surface representation.
- the residues that are in direct contact with PDGF-BB are shown as gray sticks and those mutated residues relative to the parent antibody are shown as black sticks.
- the data shown demonstrate that for both engineered MOR8457, variants, none of the three mutations interact with PDGF-B dimer.
- Figure 17 depicts the electrostatic potential energy surface of (A) MOR8457-GL and (B) MOR8457-16.
- the charge surface scaling shown in this figures is the same as that shown in figure 14.
- Site L53 which is mutated from Asn in MOR8457-GL to Lys in MOR8457-16, is indicated with the arrow. This residue is immediately adjacent to the large negatively charged patch in the light chain CDR (white patch above the L53 site) and these data suggest this residue is responsible for the decrease in viscosity relative to the parent antibody.
- Figure 18 depicts a graph showing the Differential Scanning Calorimetry (DSC) profiles of MOR8457-GL (squares), MOR8457-15 (circles) and MOR8457-16 (triangles) in phosphate buffered saline.
- DSC Differential Scanning Calorimetry
- Figure 19 comprising panels A and B, depicts a graph showing the expression and the purification profile of MOR8457 and its engineered variants, respectively.
- Panel A shows a bar graph showing the expression level (shown in white bars as mg/mL) after transient expression in 293 culture and purification yield after Protein A capture (shown as gray bars as percent peak area of interest) for each antibody.
- Panel B depicts a graph showing the analytical size exclusion chromatograph for MOR8457-16 after protein A elution showing a single peak.
- Figure 20 depicts Biacore sensorgrams showing the binding kinetics of MOR8457-16 to different PDGF isoforms.
- MOR8457-16 was captured onto CM5 chips using an anti-human IgG antibody.
- the binding kinetics of each PDGF isoform was assessed by flowing different concentrations of each PDGF isoform over the captured MOR8457-16 surface.
- PDGF-AB B
- Rat-PDGF-BB D
- PDGF-AB B
- Rat-PDGF-BB D
- Table 8 The on- and off-rates and binding affinities shown in this figure are listed in Table 8.
- Figure 21 comprising panels A and B, show graphs depicting the inhibition curve of MOR8457-16 (A) and MOR8457-GL (B) in the mesangial cell proliferation assay.
- Cell proliferation was stimulated with 2.5 ng/ml of PDGF-BB.
- the assay was performed as described in Example 8.
- the IC50 of MOR8457-16 was 14 pM while the IC50 of parent
- MOR8457-GL was 20 pM.
- PDGF-B antibodies that specifically bind to PDGF-B and inhibit its binding to PDGFR3.
- Methods of making PDGF-B antibodies, compositions comprising these antibodies, and methods of using these antibodies are provided.
- PDGF-B antibodies can be used in the prevention and/or treatment of diseases, disorders or conditions caused by and/or associated with PDGF-B binding to PDGFR3.
- diseases, disorders or conditions include, but are not limited to, atherosclerosis, balloon injury-induced restenosis, pulmonary hypertension, organ fibrosis (e.g., cardiac, lung, renal and kidney), systemic sclerosis, rheumatoid arthritis, osteoarthritis, and tumorigenesis.
- Enzymatic reactions and purification techniques are performed according to manufacturer's specifications, as commonly accomplished in the art or as described herein.
- the nomenclatures used in connection with, and the laboratory procedures and techniques of, analytical chemistry, biochemistry, immunology, molecular biology, synthetic organic chemistry, and medicinal and pharmaceutical chemistry described herein are those well known and commonly used in the art. Standard techniques are used for chemical syntheses, chemical analyses, pharmaceutical preparation, formulation, and delivery, and treatment of patients. Definitions
- the term "isolated molecule" (where the molecule is, for example, a polypeptide, a polynucleotide, or an antibody) is a molecule that by virtue of its origin or source of derivation (1 ) is not associated with naturally associated components that accompany it in its native state, (2) is substantially free of other molecules from the same species (3) is expressed by a cell from a different species, or (4) does not occur in nature.
- a molecule that is chemically synthesized, or expressed in a cellular system different from the cell from which it naturally originates will be "isolated" from its naturally associated components.
- a molecule also may be rendered substantially free of naturally associated components by isolation, using purification techniques well known in the art.
- Molecule purity or homogeneity may be assayed by a number of means well known in the art.
- the purity of a polypeptide sample may be assayed using polyacrylamide gel electrophoresis and staining of the gel to visualize the polypeptide using techniques well known in the art.
- higher resolution may be provided by using HPLC or other means well known in the art for purification.
- substantially pure means an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition), and preferably a substantially purified fraction is a composition wherein the object species (e.g., a glycoprotein, including an antibody or receptor) comprises at least about 50 percent (on a molar basis) of all macromolecular species present.
- a substantially pure composition will comprise more than about 80 percent of all macromolecular species present in the composition, more preferably more than about 85%, 90%, 95%, and 99%.
- the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
- an “antibody” is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc.
- the term encompasses not only intact polyclonal or monoclonal antibodies, but also, unless otherwise specified, any antigen binding portion thereof that competes with the intact antibody for specific binding, fusion proteins comprising an antigen binding portion, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site.
- Antigen binding portions include, for example, Fab, Fab', F(ab')2, Fd, Fv, domain antibodies (dAbs, e.g., shark and camelid antibodies), fragments including complementarity determining regions (CDRs), single chain variable fragment antibodies (scFv), maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv, and polypeptides that contain at least a portion of an immunoglobulin that is sufficient to confer specific antigen binding to the polypeptide.
- An antibody includes an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG-i, lgG2, lgG3, lgG 4 , IgAi and lgA 2 .
- the heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- antigen-binding portion or "antigen-binding fragment” of an antibody (or simply “antibody portion”), as used interchangeably herein, refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., a PDGF). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- an antigen e.g., a PDGF
- binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains;
- Fvs dsFv
- anti-idiotypic antibodies and intrabodies dsFv
- VL and VH two domains of the Fv fragment
- VL and VH two domains of the Fv fragment
- scFv single chain Fv
- single chain antibodies are also intended to be encompassed within the term "antigen-binding portion" of an antibody.
- Other forms of single chain antibodies, such as diabodies are also encompassed.
- Diabodies are bivalent, bispecific antibodies in which VH and VL domains are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger et al. Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993); Poljak et al., 1994, Structure 2:1 121-1123).
- Antibodies may be derived from any mammal, including, but not limited to, humans, monkeys, pigs, horses, rabbits, dogs, cats, mice, etc., or other animals such as birds (e.g. chickens), fish (e.g., sharks) and camelids (e.g., llamas).
- a "variable region" of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
- the variable regions of the heavy and light chains each consist of four framework regions (FRs) connected by three complementarity determining regions (CDRs) also known as hypervariable regions, and contribute to the formation of the antigen binding site of antibodies.
- FRs framework regions
- CDRs complementarity determining regions
- variants of a subject variable region are desired, particularly with substitution in amino acid residues outside of a CDR region (i.e., in the framework region), appropriate amino acid substitution, preferably, conservative amino acid substitution, can be identified by comparing the subject variable region to the variable regions of other antibodies which contain CDR1 and CDR2 sequences in the same canonical class as the subject variable region (Chothia and Lesk, J. Mol. Biol. 196(4): 901-917, 1987).
- definitive delineation of a CDR and identification of residues comprising the binding site of an antibody is accomplished by solving the structure of the antibody and/or solving the structure of the antibody-ligand complex. In certain embodiments, that can be accomplished by any of a variety of techniques known to those skilled in the art, such as X-ray crystallography. In certain embodiments, various methods of analysis can be employed to identify or approximate the CDR regions. In certain embodiments, various methods of analysis can be employed to identify or approximate the CDR regions. Examples of such methods include, but are not limited to, the Kabat definition, the Chothia definition, the AbM definition, the contact definition, and the conformational definition.
- the Kabat definition is a standard for numbering the residues in an antibody and is typically used to identify CDR regions. See, e.g., Johnson & Wu, 2000, Nucleic Acids Res., 28: 214-8.
- the Chothia definition is similar to the Kabat definition, but the Chothia definition takes into account positions of certain structural loop regions. See, e.g., Chothia et al., 1986, J. Mol. Biol., 196: 901-17; Chothia et al., 1989, Nature, 342: 877- 83.
- the AbM definition uses an integrated suite of computer programs produced by Oxford Molecular Group that model antibody structure.
- the AbM definition models the tertiary structure of an antibody from primary sequence using a combination of knowledge databases and ab initio methods, such as those described by Samudrala et al., 1999, "Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach,” in PROTEINS, Structure, Function and Genetics Suppl., 3:194-198.
- the contact definition is based on an analysis of the available complex crystal structures.
- CDRs In another approach, referred to herein as the "conformational definition" of CDRs, the positions of the CDRs may be identified as the residues that make enthalpic contributions to antigen binding. See, e.g., Makabe et al., 2008, Journal of Biological Chemistry, 283:1 156-1 166. Still other CDR boundary definitions may not strictly follow one of the above approaches, but will nonetheless overlap with at least a portion of the Kabat CDRs, although they may be shortened or lengthened in light of prediction or experimental findings that particular residues or groups of residues do not significantly impact antigen binding.
- a CDR may refer to CDRs defined by any approach known in the art, including combinations of approaches.
- the methods used herein may utilize CDRs defined according to any of these approaches.
- the CDRs may be defined in accordance with any of Kabat, Chothia, extended, AbM, contact, and/or conformational definitions.
- Contact residue refers to an amino acid residue present on an antibody/antigen comprising at least one heavy atom (i.e., not hydrogen) that is within 4 A or less of a heavy atom of an amino acid residue present on the cognate antibody/antigen.
- a "constant region" of an antibody refers to the constant region of the antibody light chain or the constant region of the antibody heavy chain, either alone or in combination.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler and Milstein, 1975, Nature 256:495, or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567.
- the monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al., 1990, Nature 348:552-554, for example.
- "humanized" antibody refers to forms of non-human (e.g.
- humanized antibodies that are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) that contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
- the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance.
- a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen binding residues.
- chimeric antibody is intended to refer to antibodies in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody.
- antigen (Ag) refers to the molecular entity used for immunization of an immunocompetent vertebrate to produce the antibody (Ab) that recognizes the Ag or to screen an expression library (e.g., phage, yeast or ribosome display library, among others).
- an expression library e.g., phage, yeast or ribosome display library, among others.
- Ag is termed more broadly and is generally intended to include target molecules that are specifically recognized by the Ab, thus including fragments or mimics of the molecule used in an immunization process for raising the Ab or in library screening for selecting the Ab.
- full-length PDGF-B from mammalian species e.g., human, mouse and rat PDGF-B
- monomers and dimers thereof as well as truncated and other variants of PDGF-B
- antigen for antibodies of the invention binding to PDGF-B, full-length PDGF-B from mammalian species (e.g., human, mouse and rat PDGF-B), including both monomers and dimers thereof, as well as truncated and other variants of PDGF-B, are referred to as an antigen.
- epitope refers to the area or region of an antigen to which an antibody specifically binds, i.e., an area or region in physical contact with the antibody.
- epitope refers to that portion of a molecule capable of being recognized by and bound by an antibody at one or more of the antibody's antigen- binding regions.
- an epitope is defined in the context of a molecular interaction between an "antibody, or antigen-binding fragment thereof" (Ab), and its corresponding antigen.
- Epitopes often consist of a surface grouping of molecules such as amino acids or sugar side chains and have specific three-dimensional structural characteristics as well as specific charge characteristics.
- the epitope can be a protein epitope.
- Protein epitopes can be linear or conformational. In a linear epitope, all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearly along the primary amino acid sequence of the protein.
- a “nonlinear epitope” or “conformational epitope” comprises noncontiguous polypeptides (or amino acids) within the antigenic protein to which an antibody specific to the epitope binds.
- the term "antigenic epitope” as used herein, is defined as a portion of an antigen to which an antibody can specifically bind as determined by any method well known in the art, for example, by conventional immunoassays.
- a desired epitope on an antigen it is possible to generate antibodies to that epitope, e.g., using the techniques described in the present specification.
- the generation and characterization of antibodies may elucidate information about desirable epitopes. From this information, it is then possible to competitively screen antibodies for binding to the same epitope.
- An approach to achieve this is to conduct competition and cross-competition studies to find antibodies that compete or cross-compete with one another for binding to PDGF-B, e.g., the antibodies compete for binding to the antigen.
- wild-type amino acid refers to a sequence of amino or nucleic acids that occurs naturally within a certain population (e.g., human, mouse, rats, cell, etc.).
- positions of the antibody molecule can be altered.
- position as used herein is meant a location in the sequence of a protein. Positions may be numbered sequentially, or according to an established format, for example the EU index and Kabat index can be used to number amino acid residues of an antibody. For example, position 297 is a position in the human antibody lgG1. Corresponding positions are determined as outlined above, generally through alignment with other parent sequences.
- residue as used herein is meant a position in a protein and its associated amino acid identity.
- Asparagine 297 also referred to as Asn297, also referred to as N297
- Asn297 is a residue in the human antibody lgG1 .
- antagonist antibody refers to an antibody that binds to a target and prevents or reduces the biological effect of that target.
- the term can denote an antibody that prevents the target, e.g., PDGF-B, to which it is bound from performing a biological function, e.g., binding to its cognate receptors - , PDGFR- ⁇ , PDGFRa3, and PDGFR33.
- an "PDGF-B antagonist antibody” refers to an antibody that is able to inhibit PDGF-B biological activity, or the activity of a homo- or heterodimer comprising PDGF-B (e.g., PDGF-AB and PDGF-BB) and/or downstream event(s) mediated by PDGF-B, including, but not limited to, binding to its cognate tyrosine kinase receptors and mediating signaling thereby and thereby causing, among other things, cell proliferation, migration, and/or extracellular matrix deposition.
- PDGF-B e.g., PDGF-AB and PDGF-BB
- downstream event(s) mediated by PDGF-B including, but not limited to, binding to its cognate tyrosine kinase receptors and mediating signaling thereby and thereby causing, among other things, cell proliferation, migration, and/or extracellular matrix deposition.
- PDGF-B antagonist antibodies encompass antibodies that block, antagonize, suppress or reduce (to any degree, including significantly) PDGF-B biological activity, including downstream events mediated by PDGF-B, such as, PDGF receptor binding and downstream signaling, induction of cell proliferation and cell migration.
- PDGF-B antagonist antibody encompasses all the previously identified terms, titles, and functional states and characteristics whereby the PDGF-B itself, a PDGF-B biological activity (including but not limited to its ability to bind a receptor, and induce cell proliferation), or the consequences of the biological activity, are substantially nullified, decreased, or neutralized in any meaningful degree.
- a PDGF-B antibody binds PDGF-B and prevents its binding to PDGFR3.
- the antagonist ability is characterized and/or described via a cell growth assay.
- the antagonist ability is described in terms of an IC50 or EC50 value. Examples of PDGF- B antibodies are provided herein.
- PDGFR3 encompasses a receptor comprising at least one PDGFR3 polypeptide chain. That is, PDGFR3, as used herein, includes a single PDGFR3 polypeptide chain, as well as a PDGFR33 homodimer and a PDGFRa3 heterodimer.
- polypeptide oligopeptide
- peptide protein
- the terms “polypeptide”, “oligopeptide”, “peptide” and “protein” are used interchangeably herein to refer to chains of amino acids of any length.
- the chain may be linear or branched, it may comprise modified amino acids, and/or may be interrupted by non-amino acids.
- the terms also encompass an amino acid chain that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
- the polypeptides can occur as single chains or associated chains.
- polynucleotide or “nucleic acid,” as used interchangeably herein, refer to chains of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a chain by DNA or RNA polymerase.
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the chain.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after polymerization, such as by conjugation with a labeling component.
- Other types of modifications include, for example, "caps", substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, poly-L- lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g.,
- any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid supports.
- the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
- Other hydroxyls may also be derivatized to standard protecting groups.
- Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, alpha- or beta-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and abasic nucleoside analogs such as methyl riboside.
- One or more phosphodiester linkages may be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S("thioate”), P(S)S ("dithioate”), (0)NR 2 ("amidate”), P(0)R, P(0)OR', CO or CH 2 ("formacetal”), in which each R or R' is independently H or substituted or unsubstituted alkyl (1 -20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
- an antibody "interacts with" PDGF-B when the equilibrium dissociation constant is equal to or less than 100 pM, preferably less than about 69 pM, more preferably less than about 50 pM, most preferably less than about 30 pM, more preferably less than about 20 pM, yet more preferably less than about 15 pM, even more preferably less than about 10 pM, even more preferably less than about 4 pM, and more preferably less than about 2 pM, as measured by the methods disclosed herein in Examples 6 and 8.
- the antibody interacts with PDGF-B when the K D ranges from about 69 pM to about 2 pM. In one embodiment, the antibody interacts with PDGF-B with a K D of about 10 pM.
- An antibody that "preferentially binds” or “specifically binds” (used interchangeably herein) to an epitope is a term well understood in the art, and methods to determine such specific or preferential binding are also well known in the art.
- a molecule is said to exhibit “specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances.
- an antibody that specifically or preferentially binds to a PDGF-B epitope is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other PDGF-B epitopes or non- PDGF-B epitopes. It is also understood by reading this definition that, for example, an antibody (or moiety or epitope) which specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding.
- Specific binding or “preferential binding” includes a compound, e.g., a protein, a nucleic acid, an antibody, and the like, which recognizes and binds to a specific molecule, but does not substantially recognize or bind other molecules in a sample.
- an antibody or a peptide receptor which recognizes and binds to a cognate ligand or binding partner (e.g., an anti-human tumor antigen antibody that binds a tumor antigen) in a sample, but does not substantially recognize or bind other molecules in the sample, specifically binds to that cognate ligand or binding partner.
- the specified binding moiety e.g., an antibody or an antigen-binding portion thereof or a receptor or a ligand binding portion thereof
- a variety of assay formats may be used to select an antibody or peptide that specifically binds a molecule of interest.
- solid-phase ELISA immunoassay, immunoprecipitation, BIAcoreTM (GE Healthcare, Piscataway, NJ), fluorescence- activated cell sorting (FACS), OctetTM (ForteBio, Inc., Menlo Park, CA) and Western blot analysis are among many assays that may be used to identify an antibody that specifically reacts with an antigen or a receptor, or ligand binding portion thereof, that specifically binds with a cognate ligand or binding partner.
- a specific or selective reaction will be at least twice background signal or noise and more typically more than 10 times background, even more specifically, an antibody is said to "specifically bind" an antigen when the equilibrium dissociation constant (K D ) is ⁇ 1 ⁇ , preferably ⁇ 100 nM , more preferably ⁇ 10 nM, even more preferably, ⁇ 100 pM, yet more preferably, ⁇ 10 pM, and even more preferably, ⁇ 1 pM.
- K D equilibrium dissociation constant
- binding affinity is herein used as a measure of the strength of a non- covalent interaction between two molecules, e.g., and antibody, or fragment thereof, and an antigen.
- binding affinity is used to describe monovalent interactions (intrinsic activity).
- Binding affinity between two molecules, e.g. an antibody, or fragment thereof, and an antigen, through a monovalent interaction may be quantified by determination of the dissociation constant (K D ).
- K D can be determined by measurement of the kinetics of complex formation and dissociation, e.g., by the surface plasmon resonance (SPR) method (Biacore).
- SPR surface plasmon resonance
- the rate constants corresponding to the association and the dissociation of a monovalent complex are referred to as the association rate constants k a (or k on ) and dissociation rate constant k d (or k off ), respectively.
- binding affinities associated with different molecular interactions may be compared by comparison of the KD values for the individual antibody/antigen complexes.
- K D values for antibodies or other binding partners can be determined using methods well established in the art. One method for determining the K D is by using surface plasmon resonance, typically using a biosensor system such as a Biacore® system.
- substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), more preferably, at least 90% pure, more preferably, at least 95% pure, yet more preferably, at least 98% pure, and most preferably, at least 99% pure.
- a "host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
- Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
- a host cell includes cells transfected in vivo with a polynucleotide(s) of this invention.
- the term "Fc region” is used to define a C-terminal region of an immunoglobulin heavy chain.
- the "Fc region” may be a native sequence Fc region or a variant Fc region.
- the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl- terminus thereof.
- the numbering of the residues in the Fc region is that of the EU index as in Kabat. Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991 .
- the Fc region of an immunoglobulin generally comprises two constant domains, CH2 and CH3. As is known in the art, an Fc region can be present in dimer or monomeric form.
- Fc receptor and “FcR” describe a receptor that binds to the
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FcyRII receptors include FcyRIIA (an “activating receptor") and FcyRI IB (an "inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof. FcRs are reviewed in Ravetch and Kinet, 1991 , Ann. Rev.
- FcR also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., 1976, J. Immunol., 1 17:587; and Kim et al., 1994, J. Immunol., 24:249).
- Compet means that a first antibody, or an antigen-binding portion thereof, binds to an epitope in a manner sufficiently similar to the binding of a second antibody, or an antigen-binding portion thereof, such that the result of binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
- the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
- each antibody detectably inhibits the binding of the other antibody with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to "cross- compete" with each other for binding of their respective epitope(s).
- Both competing and cross-competing antibodies are encompassed by the present invention. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods disclosed herein.
- a “functional Fc region” possesses at least one effector function of a native sequence Fc region.
- exemplary “effector functions” include C1 q binding; complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity; phagocytosis; down-regulation of cell surface receptors (e.g. B cell receptor), etc.
- Such effector functions generally require the Fc region to be combined with a binding domain (e.g. an antibody variable domain) and can be assessed using various assays known in the art for evaluating such antibody effector functions.
- a “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
- a “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification, yet retains at least one effector function of the native sequence Fc region.
- the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g. from about one to about ten amino acid substitutions, and preferably, from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide.
- the variant Fc region herein will preferably possess at least about 80% sequence identity with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably, at least about 90% sequence identity therewith, more preferably, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% sequence identity therewith.
- treatment is an approach for obtaining beneficial or desired clinical results.
- beneficial or desired clinical results include, but are not limited to, one or more of the following: improved survival rate (reduced mortality), reduction in inflammatory response to the disease, reduction in the amount of tissue fibrosis, improvement in the appearance of the disease lesions, limitation of the pathological lesions to focal sites, decreased extent of damage from the disease, decreased duration of the disease, and/or reduction in the number, extent, or duration of symptoms related to the disease.
- the term includes the administration of the compounds or agents of the present invention to prevent or delay the onset of the symptoms, complications, or biochemical indicia of a disease, alleviating the symptoms or arresting or inhibiting further development of the disease, condition, or disorder. Treatment may be prophylactic (to prevent or delay the onset of the disease, or to prevent the manifestation of clinical or subclinical symptoms thereof) or therapeutic suppression or alleviation of symptoms after the manifestation of the disease.
- “Ameliorating” means a lessening or improvement of one or more symptoms as compared to not administering a PDGF-B antibody. “Ameliorating” also includes shortening or reduction in duration of a symptom.
- an "effective dosage” or “effective amount” of drug, compound, or pharmaceutical composition is an amount sufficient to affect any one or more beneficial or desired results.
- an effective amount prevents, alleviates or ameliorates symptoms of disease or infection, and/or prolongs the survival of the subject being treated.
- beneficial or desired results include eliminating or reducing the risk, lessening the severity, or delaying the outset of the disease, including biochemical, histological and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease.
- beneficial or desired results include clinical results such as reducing one or more symptoms of a PDGF-B mediated disease, disorder or condition, decreasing the dose of other medications required to treat the disease, enhancing the effect of another medication, and/or delaying the progression of the disease of patients.
- An effective dosage can be administered in one or more administrations.
- an effective dosage of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
- an effective dosage of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
- an "effective dosage" may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
- an “individual” or a “subject” is a mammal, more preferably, a human. Mammals also include, but are not limited to, farm animals (e.g., cows, pigs, horses, chickens, etc.), sport animals, pets, primates, horses, dogs, cats, mice and rats. In some embodiments, the individual is considered to be at risk for a disease, disorder or condition mediated by or associated with PDGF-B binding to its receptor and signaling mediated thereby.
- farm animals e.g., cows, pigs, horses, chickens, etc.
- sport animals e.g., pets, primates, horses, dogs, cats, mice and rats.
- the individual is considered to be at risk for a disease, disorder or condition mediated by or associated with PDGF-B binding to its receptor and signaling mediated thereby.
- vector means a construct, which is capable of delivering, and, preferably, expressing, one or more gene(s) or sequence(s) of interest in a host cell.
- vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
- expression control sequence means a nucleic acid sequence that directs transcription of a nucleic acid.
- An expression control sequence can be a promoter, such as a constitutive or an inducible promoter, or an enhancer.
- the expression control sequence is operably linked to the nucleic acid sequence to be transcribed.
- pharmaceutically acceptable carrier or “pharmaceutical acceptable excipient” includes any material which, when combined with an active ingredient, allows the ingredient to retain biological activity and is non-reactive with the subject's immune system.
- examples include, but are not limited to, any of the standard pharmaceutical carriers such as a phosphate buffered saline solution, water, emulsions such as oil/water emulsion, and various types of wetting agents.
- Preferred diluents for aerosol or parenteral administration are phosphate buffered saline (PBS) or normal (0.9%) saline.
- Compositions comprising such carriers are formulated by well known conventional methods (see, for example, Remington's Pharmaceutical Sciences, 18th edition, A.
- the present invention encompasses not only the entire group listed as a whole, but each member of the group individually and all possible subgroups of the main group, but also the main group absent one or more of the group members.
- the present invention also envisages the explicit exclusion of one or more of any of the group members in the claimed invention.
- the present invention relates to antibodies that bind to monomeric and/or dimeric PDGF-B.
- the antibodies preferably specifically bind to PDGF-B, i.e., they bind to PDGF-B but they do not detectably bind, or bind at a lower affinity, to other molecules.
- the invention relates to antibodies that bind to PDGF-B and that modulate its activity.
- an antibody of the invention may have the ability to decrease or inhibit binding of PDGF-B to a cognate PDGFR3 receptor (PDGFRa3, PDGFR33, and PDGFR3-lgG1 ) and thereby to reduce or inhibit receptor signaling.
- the invention also relates to compositions comprising such antibodies as well as uses for such antibodies, including therapeutic and pharmaceutical uses.
- PDGF-B any naturally occurring form of PDGF-B, whether monomeric or dimeric, which may be derived from any suitable organism.
- the term encompasses any dimer comprising PDGF-B, i.e., PDGF-AB and PDGF-BB.
- PDGF-B refers to a mammalian PDGF-B, such as human, rat or mouse, as well as non-human primate, bovine, ovine, or porcine PDGF-B.
- the PDGF-B is human.
- the term "PDGF-B” also encompasses fragments, variants, isoforms, and other homologs of such PDGF-B molecules.
- Variant PDGF-B molecules will generally be characterized by having the same type of activity as naturally occurring PDGF-B, such as the ability to bind PDGFR3, the ability to induce phosphorylation of the receptor, the ability to mediate signaling by such receptor, the ability to induce cell migration or proliferation, and the ability to induce or increase deposition of extracellular matrix.
- the antibody of the invention specifically binds PDGF-B (i.e., PDGF-B, PDGF-AB and PDGF-BB) and inhibits its interaction with PDGFR3, e.g., PDGFR33 and PDGFRa3, thereby inhibiting PDGF-B activity.
- PDGF-B i.e., PDGF-B, PDGF-AB and PDGF-BB
- PDGFR3 e.g., PDGFR33 and PDGFRa3
- PDGF-B mediated activity By the terms “PDGF-B mediated activity,” “PDGF-B mediated effect,” “PDGF-B activity,” “PDGF-B biological activity” or “PDGF-B function,” as used interchangeably herein, is meant any activity mediated by PDGF-B interaction with a cognate receptor including, but not limited to, PDGF-B binding to PDGFR3, phosphorylation of PDGFR3, increase in cell migration, increase in cell proliferation, increase in extracellular matrix deposition, and any other activity of PDGF-B either known in the art or to be elucidated in the future.
- the methods of the invention use the antibody of the invention that blocks, suppresses or reduces (including significantly reduces) PDGF-B activity, including downstream events mediated by PDGF-B.
- a PDGF-B antibody of the invention should exhibit any one or more of the following characteristics: (a) specifically bind to PDGF-B; (b) block PDGF-B interaction with a cell surface receptor and downstream signaling events; (c) block phosphorylation of the PDGFR3; (d) block PDGF-B mediated induction of cell proliferation; (e) block induction of cell migration; and (f) block or reduce PDGF-B mediated deposition of extracellular matrix.
- the antibody preferably reacts with PDGF-B in a manner that blocks PDGF-B interaction with a cell surface receptor, e.g., PDGFRa3 and PDGFR33.
- a cell surface receptor e.g., PDGFRa3 and PDGFR33.
- the antibodies useful in the present invention can encompass monoclonal antibodies, polyclonal antibodies, antibody fragments (e.g., Fab, Fab', F(ab')2, Fv, Fc, etc.), chimeric antibodies, bispecific antibodies, heteroconjugate antibodies, single chain (ScFv), mutants thereof, fusion proteins comprising an antibody portion (e.g., a domain antibody), humanized antibodies, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- the antibodies may be murine, rat, human, or any other origin (including chimeric or humanized antibodies).
- the PDGF-B antibody is a monoclonal antibody.
- the antibody is a human or humanized antibody.
- the PDGF-B antibodies of the invention may be made by any method known in the art. General techniques for production of human and mouse antibodies are known in the art and/or are described herein.
- PDGF-B antibodies can be identified or characterized using methods known in the art, whereby reduction, amelioration, or neutralization of PDGF-B activity is detected and/or measured.
- a PDGF-B antibody is identified by incubating a candidate agent (e.g., PDGFR33 or PDGFR3-lgG1 ) with PDGF-B and monitoring binding and/or attendant reduction or inhibition of a biological activity of PDGF-B.
- the binding assay may be performed with, e.g., purified PDGF-B polypeptide(s), or with cells naturally expressing various receptors, or transfected to express, PDGF-B receptors.
- the binding assay is a competitive binding assay, where the ability of a candidate antibody to compete with a known PDGF-B antibody for PDGF-B binding is evaluated.
- the assay may be performed in various formats, including the ELISA format.
- a PDGF-B antibody is identified by incubating a candidate antibody with PDGF-B and monitoring binding.
- a PDGF-B is identified by incubating a candidate antibody (e.g.
- a human anti-PDGF-B antibody with PDGF-B and monitoring the binding of a second PDGF-B antibody (e.g., a PDGF-B antibody comprising a non-human constant region) to PDGF-B to assess whether one antibody competes for binding of PDGF-B with the second antibody.
- a second PDGF-B antibody e.g., a PDGF-B antibody comprising a non-human constant region
- a candidate PDGF-B antibody can be further confirmed and refined by bioassays, known to test the targeted biological activities.
- an in vitro cell assay is used to further characterize a candidate PDGF-B antibody.
- a candidate antibody is incubated with PDGF-B and a second PDGF-B antibody or soluble PDGFR3 comprising the ectodomain of the receptor (e.g., PDGFR3-lgG1 ) is added, and the binding of PDGF-B by the second antibody or soluble receptor is monitored.
- bioassays can be used to screen candidates directly.
- the PDGF-B antibodies of the invention exhibit one or more of the following characteristics: (a) specifically bind to PDGF-B; (b) block PDGF-B interaction with a cell surface receptor and downstream signaling events; (c) block PDGF-B mediated induction of cell proliferation or migration; and (d) block or reduce PDGF-B mediated deposition of extracellular matrix.
- PDGF-B antibodies of the invention have two or more of these features. More preferably, the antibodies have three or more of the features. More preferably, the antibodies have all four characteristics.
- PDGF-B antibodies may be characterized using methods well known in the art. For example, one method is to identify the epitope to which it binds, or "epitope mapping.” There are many methods known in the art for mapping and characterizing the location of epitopes on proteins, including solving the crystal structure of an antibody- antigen complex, competition assays, gene fragment expression assays, and synthetic peptide-based assays, as described, for example, in Chapter 1 1 of Harlow and Lane, Using Antibodies, a Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1999. In an additional example, epitope mapping can be used to determine the sequence to which PDGF-B antibody binds.
- Epitope mapping is commercially available from various sources, for example, Pepscan Systems (Edelhertweg 15, 8219 PH Lelystad, The Netherlands).
- the epitope can be a linear epitope, i.e., contained in a single stretch of amino acids, or a conformational epitope formed by a three-dimensional interaction of amino acids that may not necessarily be contained in a single stretch.
- Peptides of varying lengths e.g., at least 4-6 amino acids long
- the epitope to which the PDGF-B antibody binds can be determined in a systematic screening by using overlapping peptides derived from the PDGF-B sequence and determining binding by the antibody.
- the open reading frame encoding PDGF-B can be fragmented either randomly or by specific genetic constructions and the reactivity of the expressed fragments of PDGF-B with the antibody to be tested is determined.
- the gene fragments may, for example, be produced by PCR and then transcribed and translated into protein in vitro, in the presence of radioactive amino acids. The binding of the antibody to the radioactively labeled PDGF-B fragments is then determined by immunoprecipitation and gel electrophoresis.
- Certain epitopes can also be identified by using large libraries of random peptide sequences displayed on the surface of phage particles (phage libraries) or yeast (yeast display). Alternatively, a defined library of overlapping peptide fragments can be tested for binding to the test antibody in simple binding assays.
- mutagenesis of an antigen, domain swapping experiments and alanine scanning mutagenesis can be performed to identify residues required, sufficient, and/or necessary for epitope binding.
- alanine scanning mutagenesis experiments can be performed using a mutant PDGF-B in which various residues of the PDGF-B polypeptide have been replaced with alanine. By assessing binding of the antibody to the mutant PDGF-B, the importance of the particular PDGF-B residues to antibody binding can be assessed.
- Yet another method which can be used to characterize a PDGF-B antibody is to use competition assays with other antibodies known to bind to the same antigen, i.e., various fragments on PDGF-B, to determine if the PDGF-B antibody binds to the same epitope as other antibodies.
- Competition assays are well known to those of skill in the art.
- the epitope for a given antibody/antigen binding pair can be defined and characterized at different levels of detail using a variety of experimental and computational epitope mapping methods.
- the experimental methods include mutagenesis, X-ray crystallography, Nuclear Magnetic Resonance (NMR) spectroscopy, Hydroged deuterium exchange Mass Spectrometry (HX-MS) and various competition binding methods.
- NMR Nuclear Magnetic Resonance
- HX-MS Hydroged deuterium exchange Mass Spectrometry
- the description of an epitope is intimately linked to the method by which it has been determined.
- Ab can be defined by the spatial coordinates defining the atomic contacts present in the Ag-Ab interaction, as well as information about their relative contributions to the binding thermodynamics.
- the epitope can be characterized by the spatial coordinates defining the atomic contacts between the Ag and Ab.
- the epitope can be characterized by the amino acid residues that it comprises as defined by a specific criterium, e.g. distance between atoms in the Ab and the Ag.
- the epitope can be characterized through function, e.g. by competition binding with other Abs.
- the epitope can also be defined more generically as comprising amino acid residues for which substitution by another amino acid will alter the characteristics of the interaction between the Ab and Ag (e.g. alanine scanning).
- epitope In the context of an X-ray derived crystal structure defined by spatial coordinates of a complex between an Ab, e.g., a Fab fragment, and its Ag, the term epitope is herein, unless otherwise specified or contradicted by context, specifically defined as PDGF-B residues characterized by having a heavy atom (i.e. a non-hydrogen atom) within a distance of 4 A from a heavy atom in the Ab.
- a heavy atom i.e. a non-hydrogen atom
- Epitopes described on the amino acid level are said to be identical if they contain the same set of amino acid residues.
- Epitopes are said to overlap if at least one amino acid is shared by the epitopes.
- Epitopes are said to be separate (unique) if no amino acid residue is shared by the epitopes.
- Epitopes characterized by competition binding are said to be overlapping if the binding of the corresponding antibodies are mutually exclusive, i.e., binding of one antibody excludes simultaneous or consecutive binding of the other antibody.
- the epitopes are said to be separate (unique) if the antigen is able to accommodate binding of both corresponding antibodies simultaneously.
- paratope is derived from the above definition of “epitope” by reversing the perspective.
- the term “paratope” refers to the area or region on the antibody to which an antigen specifically binds, i.e., to which it makes physical contact to the antigen (PDGF-B).
- paratope In the context of an X-ray derived crystal structure defined by spatial coordinates of a complex between an antibody, e.g., a Fab fragment or two Fab fragments, and its antigen, the term paratope is herein, unless otherwise specified or contradicted by context, specifically defined as antigen residues characterized by having a heavy atom (i.e., a non-hydrogen atom) within a distance of 4 A from a heavy atom in PDGF-B.
- a heavy atom i.e., a non-hydrogen atom
- the epitope and paratope for a given antibody/antigen pair may be identified by routine methods. For example, the general location of an epitope may be determined by assessing the ability of an antibody to bind to different fragments or variant PDGF-B polypeptides as more fully described previously elsewhere herein.
- the specific amino acids within PDGF-B that make contact with an antibody (epitope) and the specific amino acids in an antibody that make contact with PDGF-B (paratope) may also be determined using routine methods, such as those described in the examples.
- the antibody and target molecule may be combined and the antibody/antigen complex may be crystallized. The crystal structure of the complex may be determined and used to identify specific sites of interaction between the antibody and its target.
- the paratope of an antibody according to the current invention may be defined as follows: the light chain variable domain of said antibody comprises residues G28, S29, Y30, F31 , D49, D50, F90, T91 , H92, N93, S94 based on Kabat numbering with respect to the sequence of SEQ ID NO:1 , and the heavy chain variable domain of said antibody comprises residues Y50, L57, Y59, Y60, D62, W102, Y103, G104, G105 based on Kabat numbering with respect to the sequence of SEQ ID NO:2.
- the paratope of an antibody of the invention can further comprise residue N65 of the light chain variable domain with respect to the sequence of SEQ I D NO:1 , and residue W47 of the heavy chain variable domain with respect to the sequence of SEQ ID NO:2.
- the light chain variable domain of the antibody according to the current invention may thus comprise amino acid residues:
- the heavy chain variable domain of said antibody may comprise amino acid residues:
- the light chain of an antibody according to the current invention may further comprise an N in the position corresponding to position 65 of the sequence of SEQ ID NO:1 ; 5 and the heavy chain variable domain may further comprise an W, in the position corresponding to position 47 of SEQ ID NO:2.
- the epitope was found to be composed of amino acids Leu 38,
- the epitope bound by the antibody of the invention encompasses at least one amino acid residue, more preferably, at least two amino acid residues, even more preferably, at least three amino acid residues, yet more preferably, at least four amino acid residues, more preferably, at least five amino acid residues, yet more preferably, at least six amino acid residues, even more preferably, at least seven amino acid residues, yet more preferably, at least eight amino acid residues, more preferably, at least nine amino acid residues, even more preferably, at least ten amino acid residues, more preferably, at least eleven amino acid residues, even more preferably, at least twelve amino acid residues, yet more preferably, at least thirteen amino acid residues, more preferably, at least fourteen amino acid residues, yet more preferably, at least fifteen amino acid residues, even more preferably, at least sixteen amino acid residues, and even more preferably, all seventeen amino acid residues selected from the amino acid residues consisting of Leu 38, Val, 39 and Trp 40, Asn 54
- the antibody comprises a paratope encompassing the light chain variable domain residues G28, S29, Y30, F31 , D49, D50, F90, T91 , H92, N93, S94 based on Kabat numbering with respect to the sequence of SEQ ID NO:1 , and the heavy chain variable domain residues Y50, L57, Y59, Y60, D62, W102, Y103, G104, G105 based on Kabat numbering with respect to the sequence of SEQ ID NO:2, wherein the antibody binds an epitope on PDGF-B comprising the following amino acid residues of PDGF-B (epitope) Leu 38, Val, 39 and Trp 40, Asn 54, Arg 56, Glu 71 , Arg 73, lie 75, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86 numbered with respect to the sequence of PD
- the antibody of the invention comprises a paratope wherein the amino acid residues of the paratope contact (less than or equal to 4 A) the corresponding amino acid residues of PDGF-B (epitope) as shown on Table 4 of Example 7.
- Trp 47 contacts Lys 82 of PDGF-B
- the antibody of the invention can bind either of two epitopes formed by the homodimerization of two PDGF-B polypeptide chains.
- the invention encompasses an antibody that binds one epitope of PDGF-BB where the epitope is selected from epitope 1 comprising amino acids Leu 38, Val, 39 and Trp 40, Asn 54, Arg 56, Glu 71 , Arg 73, lie 75, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86 with respect to the sequence of PDGF-B as set forth in SEQ ID NO:33 and epitope 2 comprising amino acids Trp 40, Asn 54, Glu 71 , Arg 73, lie 75, Glue 76, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86 with respect to the sequence of PD
- the antibody of the invention encompasses antibodies that cannot bind both epitopes simultaneously.
- the antibody encompasses an antibody that can bind both epitope 1 and epitope 2, but not at the same time since these epitopes are located approximately 190 A apart from each other on the PDGF-BB homodimer molecule.
- An antibody according to the current invention may bind to the same epitope or domain of PDGF-B as the antibodies of the invention that are specifically disclosed herein.
- other yet unidentified antibodies of the invention may be identified by comparing their binding to PDGF-B with that of the monoclonal antibody MOR8457, and germlined variants thereof; or by comparing the function of yet unidentified antibodies with that of MOR8457.
- Analyses and assays that may be used for the purpose of such identification include assays assessing the completion for binding of PDGF-B between the antibody of interest and PDGFR3 and between various anti- PDGF-B antibodies such as the assays described in Example 6, analysis of the crystal structure of the antibody with PDGF-B such as the analysis described in Example 7, assays described in Example 8 for inhibition of human mensangial cell proliferation, and the in vivo model described in Example 9 to assess the effect of the antibody in a rat model of nephritis.
- an antibody of the invention may bind to the same epitope or region as the MOR8457 antibodies described herein. The binding of these antibodies to PDGF-B is described in more detail elsewhere herein.
- An antibody of the invention may be an antibody that binds to the same epitope in PDGF-B as the MOR5457 antibodies. This may include it being in contact with the particular amino acids of PDGF-B as described above.
- an antibody of the invention may bind to PDGF-B in such a way that it is in contact with amino acids Leu 38, Val, 39 and Trp 40, Asn 54, Arg 56, Glu 71 , Arg 73, lie 75, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86 with respect to the sequence of PDGF-B as set forth in SEQ ID NO:33, or with amino acids Trp 40, Asn 54, Glu 71 , Arg 73, lie 75, Glu 76, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86 with respect to the sequence of PDGF-B as set forth in SEQ ID NO:33.
- An antibody of the invention may be capable of binding an epitope comprising one or more residues selected from the group consisting of Leu 38, Val, 39 and Trp 40, Asn 54, Arg 56, Glu 71 , Arg 73, lie 75, Glue 76, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86 with respect to the sequence of SEQ ID NO:33.
- An antibody of the invention may be capable of binding an epitope comprising residues Leu 38, Val, 39 and Trp 40, Asn 54, Arg 56, Glu 71 , Arg 73, lie 75, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86, or an epitope comprising residues Trp 40, Asn 54, Glu 71 , Arg 73, lie 75, Glu 76, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86, all with respect to the sequence of PDGF-B as set forth in SEQ ID NO:33.
- An antibody of the invention may have the ability to compete with another antibody of the invention for binding to PDGF-B as described herein.
- an antibody of the invention may cross-compete with MOR8457 antibodies described herein for binding to PDGF-B, or to a suitable fragment or variant of PDGF-B that is bound by the MOR8457 antibodies.
- Such cross-competing antibodies can be identified based on their ability to cross-compete with a known antibody of the invention in standard binding assays. For example, SPR e.g. by using a BiacoreTM system, ELISA assays or flow cytometry may be used to demonstrate cross-competition.
- Such cross- competition may suggest that the two antibodies bind to identical, overlapping or similar epitopes.
- the antibody of the invention encompasses antibodies capable of binding PDGF- B with a higher affinity than AbyD3263 described in Ogawa et al., 2010, Hepatol. Res. 40:1 128-1 141.
- An antibody of the invention may therefore be identified by a method that comprises a binding assay which assesses whether or not a test antibody is able to compete with a known antibody of the invention for a binding site on the target molecule.
- Methods for carrying out competitive binding assays are disclosed herein and/or are well known in the art. For example they may involve binding a known antibody of the invention to a target molecule using conditions under which the antibody can bind to the target molecule. The antibody/target complex may then be exposed to a test antibody and the extent to which the test antibody is able to displace the antibody of the invention from antibody/target complexes may be assessed.
- An alternative method may involve contacting a test antibody with a target molecule under conditions that allow for antibody binding, then adding an antibody of the invention that is capable of binding that target molecule and assessing the extent to which the antibody of the invention is able to displace the test antibody from antibody/target complexes.
- test antibody to inhibit the binding of an antibody of the invention to the target demonstrates that the test antibody can compete with an antibody of the invention for binding to the target and thus that the test antibody binds to the same epitope or region on the PDGF-B protein as the known antibody of the invention.
- a test antibody that is identified as competing with a known antibody of the invention in such a method is also a potential antibody according to the present invention.
- the fact that the test antibody can bind PDGF-B in the same region as a known antibody of the invention and can compete with the known antibody of the invention suggests that the test antibody may act as a ligand at the same binding site as the known antibody and that the test antibody may therefore mimic the action of the known antibody. This can be confirmed by assessing the activity of PDGF-B in the presence of the test compound as described herein.
- the known antibody of the invention may be an antibody as described herein, such as MOR8457, or any variant or fragment thereof as described herein that retains the ability to bind to -PDGF-B, such as germlined antibodies, one of which is herein disclosed comprising a germlined VH (MOR8457-GL-VH; SEQ ID NO:6) and a germlined VL (MOR8457-LG-VL; SEQ ID NO:4), or variants such as MOR8457-15, comprising a modified VH (MOR8457-15-VH; SEQ ID NO:44) and modified VL (MOR8457-15-VL; SEQ ID NO:34), and MOR8457-16, comprising the same modified VH as MOR8457-15 (also identified as MOR8457-16-VH or MORE8457-15/16-VH); SEQ ID NO:44) and a modified VL (MOR8457-16-VL; SEQ ID NO:39).
- An antibody of the invention may bind to the
- An antibody of the invention may bind an epitope that is identical to, overlaps, or is similar to the MOR8457 epitope that is further described in the examples.
- an antibody of the invention may bind to five or more, six or more, seven or more, eight or more or ten or twelve, or fourteen, or sixteen or more of the amino acid residues set out above for binding of MOR8457.
- an antibody of the invention may bind to the polypeptide and make contact with amino acids Leu 38, Val, 39 and Trp 40, Asn 54, Arg 56, Glu 71 , Arg 73, lie 75, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86, or with amino acids Trp 40, Asn 54, Glu 71 , Arg 73, lie 75, Glu 76, lie 77, Arg 79, Lys 80, Lys 81 , Pro 82, lie 83, Phe 84, Lys 85 and Lys 86, or a subset of those amino acids, such as at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 1 1 , at least 12, at least 13, at least 14, at least 15, at least 16, or at least 17 of those amino acids.
- specific binding may be assessed with reference to binding of the antibody to a molecule that is not the target.
- This comparison may be made by comparing the ability of an antibody to bind to the target and to another molecule. This comparison may be made as described above in an assessment of K D or Kj.
- the other molecule used in such a comparison may be any molecule that is not the target molecule.
- the other molecule is not identical to the target molecule.
- the target molecule is not a fragment of the target molecule.
- the KD of an antibody of the current invention may be less than 69 pM, such as less than 50 pM, such as less than 30 pM, such as less than 25 pM, such as less than 15 pM, such as less than 1 3 pM, such as less than 12 pM, such as less than 1 0 pM, such as less than 4 pM, such as less than 2 pM, such as less than 2 pM, such as between 15 pM and 2 pM.
- the other molecule used to determine specific binding may be unrelated in structure or function to the target.
- the other molecule may be an unrelated material or accompanying material in the environment.
- the other molecule used to determine specific binding may be another molecule involved in the same in vivo pathway as the target molecule, i.e., PDGF-B.
- the other molecule used for comparison may be a protein that forms part of the PDGF-B/PDGFR3 signaling cascade.
- the antibody of the invention may retain the ability to bind to some molecules that are related to the target molecule.
- a full-length mature human PDGF- B may be used as the target, but the antibody may also be able to bind to, e.g. propeptide forms of human PDGF-B, fragments or truncated forms of human PDGF-B, PDGF-B that is bound to lipoprotein or to a cell or PDGF-B from other species, such as other mammalian PDGF-B.
- the antibody of the invention may have specificity for a particular target molecule. For example, it may bind to one target molecule as described herein, but may not bind, or may bind with significantly reduced affinity to a different target molecule as described herein.
- a full length mature human PDGF-B may be used as the target, but the antibody that binds to that target may be unable to bind to or may bind with lesser affinity to, e.g. other PDGFs (PDGF-A or PDGF-C, or PDGF-D) or PDGF-B from other species, such as other mammalian PDGF-B.
- binding affinity is used herein as a measure of the strength of a non- covalent interaction between two molecules, e.g., an antibody, or an antigen-binding fragment thereof, and an antigen.
- binding affinity is used to describe monovalent (intrinsic activity).
- binding affinities associated with different molecular interactions e.g., comparison of the binding affinity of different antibodies for a given antigen, may be compared by comparison of the K D values for the individual antibody/antigen complexes.
- the specificity of an interaction may be assessed by determination and comparison of the K D value for the interaction of interest, e.g., a specific interaction between an antibody and an antigen, with the K D value of an interaction not of interest, e.g., a control antibody known not to bind PDGF-B.
- the K D for the antibody with respect to PDGF-B will be 2-fold, preferably 5-fold, more preferably 10-fold less than K D with respect to the other, non-PDGF-B molecule such as unrelated material or accompanying material in the environment. More preferably, the K D will be 50-fold less, such as 100-fold less, or 200-fold less; even more preferably 500-fold less, such as 1 , 000-fold less, or 10,000-fold less.
- the value of the dissociation constant can be determined directly by well-known methods, and can be computed even for complex mixtures by methods such as those, for example, set forth in Caceci et al. (1984, Byte 9: 340-362).
- the K D may be established using a double-filter nitrocellulose filter binding assay such as that disclosed by Wong & Lohman (1993, Proc. Natl. Acad. Sci. USA 90: 5428-5432).
- Other standard assays to evaluate the binding ability of ligands such as antibodies towards target antigens are known in the art, including for example, ELISAs, Western blots, RIAs, and flow cytometry analysis, and other assays exemplified elsewhere herein.
- the binding kinetics and binding affinity of the antibody also can be assessed by standard assays known in the art, such as Surface Plasmon Resonance (SPR), e.g. by using a BiacoreTM system.
- SPR Surface Plasmon Reson
- a competitive binding assay can be conducted in which the binding of the antibody to the antigen is compared to the binding of the target by another ligand of that target, such as another antibody or a soluble receptor that otherwise binds the target (e.g., PDGFR3-lgG1 ).
- the concentration at which 50% inhibition occurs is known as the Kj.
- the K is equivalent to K D .
- the «i value will never be less than the K D , so measurement of K, can conveniently be substituted to provide an upper limit for K D .
- An antibody of the invention may have a K D for PDGF-B of 1 x 10 "7 M or less, 1 x 10 "8 M or less, or 1 x 10 "9 M or less, or 1 x 10 "10 M or less, 1 x 10 "11 M or less, or 1 x 10 "12 M or less, or 1 x 10 "13 M or less, 1 x 10 "14 M or less, or 1 x 10 "15 M or less.
- An antibody that specifically binds its target may bind its target with a high affinity, that is, exhibiting a low K D as discussed above, and may bind to other, non-target molecules with a lower affinity.
- the antibody may bind to non-target molecules with a K D of 1 x 10 "6 M or more, more preferably 1 x 10 "5 M or more, more preferably 1 x 10 "4 M or more, more preferably 1 x 10 "3 M or more, even more preferably 1 x 10 "2 M or more.
- An antibody of the invention is preferably capable of binding to its target with an affinity that is at least two-fold, 10-fold, 50-fold, 100-fold 200-fold, 500- fold, 1 , 000-fold or 10,000-fold or greater than its affinity for binding to another non- PDGF-B molecule.
- the binding affinity (K D ) of PDGF-B antibody to PDGF-B can be about 0.001 to about 250 nM.
- the binding affinity is any of about 200 nM, about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, about 60 pM, about 50 pM, about 20 pM, about 15 pM, about 10 pM, about 5 pM, about 2 pM, or about 1 pM.
- the binding affinity is less than any of about 250 nM, about 200 nM, about 100 nM, about 50 nM, about 10 nM, about 1 nM, about 500 pM, about 100 pM, about 50 pM, about 20 pM, about 10 pM, about 5 pM, or about 2 pM.
- the K D of a PDGF-B antibody ranges from about 70 pM to about 1 pM. In some embodiments, the KD of a PDGF-B antibody for human PDGF-B ranges from about 30 pM to about 2 pM.
- the binding affinity of a PDGD-B antibody of the invention is about 69 pM, about 28 pM, about 25 pM, about 15 pM, about 13 pM, about 10 pM, about 4 pM, and about 2 pM.
- the antibody of the invention is not antibody AbyD3263 as described in Ogawa et al., 2010, Hepatology Res. 40:1 128-1 141.
- the antibody of the invention binds human PDGF-BB with a binding affinity (K D ) lower than the K D of AbyD3263, i.e., 13 nM.
- K D binding affinity
- the invention provides any of the following, or compositions (including pharmaceutical compositions) comprising, an antibody having a light chain sequence, or a portion thereof, and a heavy chain, or a portion thereof, derived from MOR8457.
- Polypeptide or antibody "fragments" or “portions” according to the invention may be made by truncation, e.g. by removal of one or more amino acids from the N and/or C- terminal ends of a polypeptide. Up to 10, up to 20, up to 30, up to 40 or more amino acids may be removed from the N and/or C terminal in this way. Fragments may also be generated by one or more internal deletions.
- An antibody of the invention may be, or may comprise, a fragment of the MOR8457 antibody or a variant thereof.
- the antibody of the invention may be or may comprise an antigen binding portion of this antibody or a variant thereof.
- the antibody of the invention may be a Fab fragment of this antibody or a variant thereof or may be a single chain antibody derived from this antibody or a variant thereof.
- the amino acid sequences of the light (MOR8457-VL) and heavy (MOR8457-VH) chain variable domains of the MOR8457 antibody are provided in SEQ ID NOs: 1 and 2, respectively.
- the amino acid sequences for the VL and VH variable domains of the germlined MOR8457 antibody are given in SEQ ID NOs: 4 (MOR8457-GL-VL) and 6 (MOR8457-GL-VH), respectively.
- the amino acid sequence of the full-length germlined light chain (MOR8457-GL-LC) is provided in SEQ ID NO:16, and the amino acid sequence of the full-length germlined heavy chain further comprising an effector function triple mutation in the constant domain (MOR8457-GL-hlgG1-3m-HC) is provided in SEQ ID NO:14.
- amino acid sequences of variant antibodies MOR8457-15 and MOR8457-16 are provided.
- the amino acid sequences of the VL and VH of MOR8457- 15 are given in SEQ ID NOs:34 (MOR8457-15-VL) and 44 (MOR8457-15-VH), respectively.
- the amino acid sequence of the full-length MOR8457-15 light chain (MOR8457-15-LC) is provided in SEQ ID NO:37, and the amino acid sequence of the full-length MOR8457-15 heavy chain further comprising an effector function triple mutation in the constant domain (MOR8457-15-HC) is provided in SEQ ID NO:46.
- the amino acid sequences of the VL and VH of MOR8457-16 are given in SEQ ID NOs:39 (MOR8457-16-VL) and 44 (MOR8457-16-VH), respectively.
- MOR8457-16-LC The amino acid sequence of the full-length MOR8457-16 light chain (MOR8457-16-LC) is provided in SEQ ID NO:42, and the amino acid sequence of the full-length MOR8457-16 heavy chain further comprising an effector function triple mutation in the constant domain (MOR8457-16- HC) is provided in SEQ ID NO:46.
- MOR8457-15 and MOR8457-16 share the same VH amino acid sequence which is set forth in SEQ ID NO:44.
- An antibody of the invention may comprise the VL amino acid sequence of SEQ ID No: 1 or SEQ ID NO:4, or a fragment or variant thereof.
- An antibody of the invention may comprise the VH amino acid sequence of SEQ ID No: 2 or SEQ ID NO:6, or a fragment or variant thereof.
- An antibody of the invention may comprise both (a) the VL amino acid sequence of SEQ ID No: 1 , or a fragment or variant thereof and the VH amino acid sequence of SEQ ID No: 2 or a fragment or variant thereof, or (b) the VL amino acid sequence of SEQ ID No: 1 , or a fragment or variant thereof, and amino acid sequence the VH of SEQ ID No: 6 or a fragment or variant thereof, or (c) the VL amino acid sequence of SEQ ID No: 4, or a fragment or variant thereof, and amino acid sequence the VH of SEQ ID No: 2 or a fragment or variant thereof, or (d) the VL amino acid sequence of SEQ ID No: 4, or a fragment or variant thereof, and amino acid sequence the VH of SEQ ID No: 6 or a fragment or variant thereof.
- An antibody of the invention may also comprise the VL amino acid sequence of SEQ ID NO;34 or SEQ ID NO:39, or a fragment or variant thereof.
- An antibody of the invention may comprise the VH amino acid sequence of SEQ I D NO: 44, or a fragment or variant thereof.
- An antibody of the invention may comprise both (a) the VL amino acid sequence of SEQ ID No: 34, or a fragment or variant thereof and the VH amino acid sequence of SEQ ID No: 44 or a fragment or variant thereof, or (b) the VL amino acid sequence of SEQ ID No: 39, or a fragment or variant thereof, and amino acid sequence the VH of SEQ ID No: 44 or a fragment or variant thereof.
- the antibody comprises a VL comprising the sequence of SEQ ID NO:1 , SEQ ID NO:4, SEQ ID NO:34, or SEQ ID NO:39. In another aspect, the antibody comprises a VH comprising the amino acid sequence of SEQ ID NO:2, SEQ ID NO:6, or SEQ ID NO:44.
- the antibody comprises a variant of sequence of SEQ ID NO:1 , SEQ ID NO:2, SEQ ID NO:4, SEQ I D NO:6, SEQ ID NO:34, SEQ ID NO:39, and SEQ ID NO:44, wherein such variants can include both conservative and non-conservative substitutions, deletions, and/or additions, and typically include peptides that share at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 87%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the specific sequences disclosed herein.
- the disclosure provides an isolated antibody or antigen-binding portion thereof that comprises a VH chain amino acid sequence as set forth in SEQ ID NO:2, SEQ ID NO:6 or SEQ ID NO:44, or a variant thereof.
- said antibody variant comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 additions and/or deletions to SEQ ID NO:2, SEQ ID NO:6, or SEQ ID NO:44.
- said variant shares at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO:2, SEQ ID NO:6, or SEQ ID NO:44, and wherein said antibody or antigen-binding portion specifically binds PDGF-B.
- the disclosure provides an isolated antibody or antigen- binding portion thereof that comprises a V L chain amino acid sequence as set forth in SEQ ID NO:1 , SEQ ID NO:4, SEQ ID NO:34, or SEQ ID NO:39 or a variant thereof.
- said antibody variant comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 additions and/or deletions to SEQ ID NO:1 , SEQ ID NO:4, SEQ ID NO:34, or SEQ ID NO:39.
- said variant shares at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO:1 , SEQ ID NO:4, SEQ ID NO:34, or SEQ ID NO:39, and wherein said antibody or antigen-binding portion specifically binds PDGF-B.
- An antibody of the invention may comprise a heavy chain comprising a VH comprising the amino acid sequence of SEQ ID NO:2, SEQ ID NO:6 or SEQ ID NO:44, wherein the antibody further comprises a heavy chain constant domain.
- the antibody heavy chain constant domain can be selected from an IgG-i, lgG 2 , lgG 3 , lgG 4 , IgA, IgE, IgM or IgD constant region, but most preferably is an IgGi or lgG 2 constant region.
- the IgG constant region sequence can be any of the various alleles or allotypes known to occur among different individuals, such as Gm(1 ), Gm(2), Gm(3), and Gm(17).
- the VH-encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH 1 constant region.
- the CH 1 heavy chain constant region may be derived from any of the heavy chain genes.
- the antibody may comprise a heavy chain comprising a VH selected from a VH comprising the amino acid sequence of SEQ I D NO:2, SEQ ID NO:6 or SEQ I D NO:44 and further comprising a human wild type lgG1 constant domain comprising the amino acid sequence of SEQ I D NO: 19.
- the lgG1 constant domain comprises a triple mutation decreasing or abolishing Fc effector function (hlgG1 -3m; SEQ I D NO:21 ).
- the antibody of the invention may comprise a heavy chain comprising a germlined VH comprising the sequence of SEQ I D NO:6 and further comprising a human lgG1 -3m constant domain such that the full- length heavy chain amino acid sequence comprises SEQ I D NO: 14 (MOR8457-GL- hlgG1 -3m-HC).
- the antibody of the invention may comprise a heavy chain comprising the sequence of SEQ I D NO:44 and further comprising a human lgG1 - 3m constant domain such that the full-length heavy chain amino acid sequence comprises SEQ ID NO:46 (MOR8457-15-HC or MOR8457-16-HC).
- the disclosure provides an isolated antibody or antigen- binding portion thereof that comprises a full-length heavy chain comprising the amino acid sequence as set forth in SEQ I D NO: 14, or a variant thereof.
- said antibody variant comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 additions and/or deletions to SEQ I D NO: 14.
- said variant shares at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ I D NO: 14, and wherein said antibody or antigen-binding portion specifically binds PDGF-B.
- An antibody of the invention may comprise a light chain comprising a VL comprising the amino acid sequence of SEQ I D NO:1 , SEQ I D NO:4, SEQ ID NO:34, or SEQ I D NO:39, wherein the antibody further comprises a light chain constant domain.
- the antibody light chain constant domain can be selected from a CK or CA constant region, preferably, a CA constant region.
- the antibody may comprise a light chain comprising a VL selected from a VL comprising the amino acid sequence of SEQ I D NO: 1 , SEQ I D NO:4, SEQ I D NO:34, or SEQ I D NO:39and further comprising a human wild type CA constant domain comprising the amino acid sequence of SEQ I D NO:23.
- the antibody may comprise an original VL sequence (SEQ ID NO:1 ) and further comprise a human CA constant domain comprising an inadvertent triple mutation substituting the sequence TVL with IKR (SEQ ID NO:17; MOR8457-IKR-LC).
- the antibody of the invention may comprise a light chain comprising a germlined VL comprising the sequence of SEQ ID NO:4 and further comprising a human wild type CA constant domain (SEQ ID NO:23) such that the full-length light chain amino acid sequence comprises SEQ ID NO:16 (MOR8457-GL-LC).
- the antibody of the invention may comprise a light chain comprising a variant VL comprising the sequence of SEQ ID NO:34 or SEQ ID NO:39, such that the full length light chain amino acid sequence comprises SEQ ID NO:37 (MOR8457-15-LC) or SEQ ID NO:42 (MOR8457- 16-LC).
- the disclosure provides an isolated antibody or antigen- binding portion thereof that comprises a full-length light chain comprising the amino acid sequence as set forth in SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:37, or SEQ ID NO:42, or a variant thereof.
- said antibody variant comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 additions and/or deletions to SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:37, or SEQ ID NO:42.
- said variant shares at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:37, or SEQ ID NO:42, and wherein said antibody or antigen-binding portion specifically binds PDGF-B.
- the invention encompasses an antibody, or antigen-binding fragment thereof, comprising the three CDRs of the heavy chain variable domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC on
- the antibody, or antigen-binding fragment thereof, of the invention comprises the V H domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC as MOR8457-GL-VH (ATCC Acc. No. PTA-13303).
- the invention encompasses an antibody, or antigen-binding fragment thereof, comprising two CDRs, CDR-H2 and CDR-H3, of the heavy chain variable domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC on November 6, 2012, as MOR8457-GL-VH (ATCC Acc. No. PTA-13303).
- the antibody, or antigen-binding fragment thereof, of the invention comprises the V H domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC as MOR8457-GL-VH (ATCC Acc. No. PTA-13303), wherein CDR-H1 need not be present.
- the invention encompasses an antibody, or antigen-binding fragment thereof, comprising the three CDRs of the light chain variable domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC on
- the antibody, or antigen-binding fragment thereof, of the invention comprises the VL domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC as MOR8457-GL-VL (ATCC Acc. No. PTA-13302).
- the invention encompasses an antibody, or antigen-binding fragment thereof, comprising the three CDRs of the light chain variable domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC on
- the invention encompasses an antibody, or antigen-binding fragment thereof, comprising the three CDRs of the light chain variable domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC on
- the invention encompasses an antibody, or antigen-binding fragment thereof, comprising the light chain variable domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC on November 6, 2012, as MOR8457-GL-VL (ATCC Acc. No. PTA-13302), and the heavy chain variable domain amino acid sequence encoded by the polynucleotide insert of the vector deposited with the ATCC as MOR8457-GL-VH (ATCC Acc. No. PTA-13303).
- the isolated DNA encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL.
- the sequences of human light chain constant region genes are known in the art (see e.g., Kabat, E. A., et al., 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the light chain constant region can be a kappa or lambda constant region.
- the kappa constant region may be any of the various alleles known to occur among different individuals, such as lnv(1 ), lnv(2), and lnv(3).
- the lambda constant region may be derived from any of the three lambda genes.
- An antibody of the invention may comprise a fragment of one of the VL or VH amino acid sequences shown in Figure 1.
- an antibody of the invention may comprise a fragment of at least 7, at least 8, at least 9, at least 10, at least 12, at least 15, at least 18, at least 20 or at least 25 consecutive amino acids from SEQ ID NOS: 4, 6, 34, 40, or 44.
- Such a fragment will preferably retain one or more of the functions discussed above, such as the ability to bind to PDGF-B.
- a suitable fragment or variant of any of these VH or VL sequences will retain the ability to bind to PDGF-B. It will preferably retain the ability to specifically bind to PDGF- B. It will preferably retain the ability to specifically bind to the same or similar epitope or region of the PDGF-B molecule as the antibody (MOR8457) from which it is derived. It will preferably retain one or more additional functions of the antibody from which it is derived, such as the ability to inhibit PDGF-B binding to its receptor, the activity or the ability to inhibit PDGFR signaling, the ability to inhibit PDGF-B induction of cell proliferation, among others.
- a suitable fragment or variant VL sequence will preferably retain the amino acids at positions G28, S29, Y30, F31 , D49, D50, F90, T91 , H92, N93, S94 based on the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:4.
- a suitable fragment or variant VH sequence will preferably retain the amino acids at positions Y50, L57, Y59, Y60, D62, W102, Y103, G104, G105 with respect to the sequence of SEQ ID NO:2 or SEQ ID NO:6.
- An antibody of the invention may comprise a CDR region from the specific antibody identified herein such as a CDR region from within SEQ ID NO: 1 , 2, 4, 6, 34, 39, or 44. Such an antibody will preferably retain the ability to bind to PDGF-B as described herein.
- the CDR sequences within the light chain of MOR8457 may be identified as amino acids SGDSLGSYFVH (MOR8457 CDR-L1 ; SEQ ID NO:10), DDSNRPS (MOR8457 CDR-L2; SEQ ID NO:1 1 , or SAFTHNSDV (MOR8457 CDR-L3; SEQ ID NO:12).
- CDR sequences within the light chain of variant antibody MOR8457-15 may be identified as amino acids SGDSLGSYFVH (MOR8457 CDR-L1 ; SEQ ID NO:10), DDSNRPS (MOR8457 CDR-L2; SEQ ID NO: 1 1 , or SAFTHNSNV (MOR8457-15 CDR- L3; SEQ ID NO:36).
- CDR sequences within the light chain of variant antibody MOR8457-16 may be identified as amino acids SGDSLGSYFVH (MOR8457 CDR-L1 ; SEQ ID NO:10), DDSKRPS (MOR8457-16 CDR-L2; SEQ ID NO:41 , or SAFTHNSDV (MOR8457 CDR-L3; SEQ ID NO:12).
- the CDR sequences within the heavy chain of MOR8457 may be identified as amino acids GFTFSSYAMS (MOR8457 CDR-H1 ; SEQ ID NO:7), YISDDGSLKYYADSVKG (MOR8457 CDR-H2; SEQ ID NO:8) or HPYWYGGQLDL (MOR8457 CDR-H3; SEQ ID NO:9).
- An antibody of the invention may comprise one or more of the CDR sequences shown in Figure 1 C-F and 11-K.
- an antibody of the invention may comprise one, two or three of the amino acid sequences set forth in SEQ I D NO:7, 8 and 9.
- An antibody of the invention may alternatively or additionally comprise one, two or three of the amino acid sequences set forth in SEQ ID NO:10, 1 1 , 12, 36, and 41 .
- An antibody of the invention may comprise all six amino acid sequences set forth in SEQ ID NOs:7-12, or SEQ ID NOs; 7, 8, 9, 10, 12, 41 , or SEQ ID NOs: 7, 8, 9, 10, 1 1 , 36.
- the disclosure provides an isolated antibody or antigen-binding portion thereof that comprises six CDRs comprising the sequences of SEQ ID NOs:7- 12, SEQ ID NOs; 7, 8, 9, 10, 12, 41 , or SEQ ID NOs: 7, 8, 9, 10, 1 1 , 36, or a variant thereof.
- said antibody variant comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 additions and/or deletions to the CDRs comprising the sequences of SEQ ID NOs:7-12, SEQ ID NOs; 7, 8, 9, 10, 12, 41 , or SEQ ID NOs: 7, 8, 9, 10, 1 1 , 36.
- said variant shares at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequences of SEQ I D NOs:7-12, SEQ ID NOs; 7, 8, 9, 10, 12, 41 , or SEQ ID NOs: 7, 8, 9, 10, 1 1 , 36 and wherein said antibody or antigen- binding portion specifically binds PDGF-B.
- An antibody of the invention may alternatively or additionally comprise five of the
- an antibody of the invention may comprise, for example, the following combinations of five CDR domains: CDR-H2 (SEQ ID NO:8), CDR-H3 (SEQ ID NO:9), CDR-L1 (SEQ ID NO:10), CDR-L2 (SEQ ID NO:1 1 ) and CDR-L3 (SEQ ID NO:12); or CDR-H2 (SEQ ID NO:8), CDR-H3 (SEQ ID NO:9), CDR-L1 (SEQ ID NO:10), CDR-L2 (SEQ ID NO:1 1 ) and CDR-L3 (SEQ ID NO:36); or CDR-H2 (SEQ ID NO:8), CDR-H3 (SEQ ID NO:9), CDR-L1 (SEQ ID NO:10), CDR-L2 (SEQ ID NO:41 ) and CDR-L3 (SEQ ID NO:12).
- the disclosure provides an isolated antibody or antigen-binding portion thereof that comprises five CDRs comprising the sequences of SEQ ID NOs:8- 12, SEQ ID NOS: 8, 9, 10, 1 1 and 36, SEQ I D NOS: 8, 9, 10, 41 , and 12, or a variant thereof.
- said antibody variant comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 conservative or non-conservative substitutions, and/or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 additions and/or deletions to the CDRs comprising the sequences of SEQ ID NOs:8-12, 36, and 41 .
- said variant shares at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequences of SEQ ID NOs:8-12, and wherein said antibody or antigen-binding portion specifically binds PDGF-B.
- An antibody of the invention may comprise a CDR sequence where the amino acid residues that are not contact residues may be substituted. That is, where the antibody comprises any of the following CDRs, the amino acid residues that are not underlined, may be substituted or deleted as they do not contact the epitopes (1 or 2) on PDGF-B:
- the heavy chain of an antibody according to the invention may comprise a CDR- H1 amino acid sequence of GFTFSSYAMS (SEQ ID NO:7) wherein at least one of these amino acids may be substituted by a different amino acid. Preferably, all of these amino acids may be substituted.
- the heavy chain of an antibody according to the invention may comprise a CDR-
- H2 amino acid sequence of YISDDGS LKYYADSVKG (SEQ ID NO:8) wherein at least one residue not underlined (where the underlined residues are Y50, L57, Y59, Y60, D62) may be substituted by a different amino acid.
- the heavy chain of an antibody according to the invention may comprise a CDR- H3 amino acid sequence HPYWYGGQLDL (SEQ ID NO:9) wherein at least one residue not underlined (where the underlined residues are W102, Y103, G104, G105) may be substituted by a different amino acid.
- the light chain of an antibody according to the invention may comprise a CDR-L1 amino acid sequence of SGDSLGSYFVH (SEQ ID NO:10) wherein at least one residue not underlined (where the underlined residues are G28, S29, Y30, F31 ) may be substituted by a different amino acid.
- the light chain of an antibody according to the invention may comprise a CDR-L2 amino acid sequence of DDSNRPS (SEQ ID NO:1 1 ) wherein at least one of residue not underlined (wherein the underlined residues are D49, D50) may be substituted by a different amino acid.
- the light chain of an antibody according to the invention may comprise a CDR-L3 amino acid sequence of SAFTHNSDV (SEQ ID NO: 12) wherein at least one residue not underlined (wherein the underlined residues are F90, T91 , H92, N93, S94) may be substituted by a different amino acid.
- a variant antibody may comprise 1 , 2, 3, 4, 5, up to 10, up to 20, up to 30 or more amino acid substitutions and/or deletions and/or insertions from the specific sequences and fragments discussed above.
- “Deletion” variants may comprise the deletion of individual amino acids, deletion of small groups of amino acids such as 2, 3, 4 or 5 amino acids, or deletion of larger amino acid regions, such as the deletion of specific amino acid domains or other features.
- “Insertion” variants may comprise the insertion of individual amino acids, insertion of small groups of amino acids such as 2, 3, 4 or 5 amino acids, or insertion of larger amino acid regions, such as the insertion of specific amino acid domains or other features.
- substitution variants preferably involve the replacement of one or more amino acids with the same number of amino acids and making conservative amino acid substitutions.
- an amino acid may be substituted with an alternative amino acid having similar properties, for example, another basic amino acid, another acidic amino acid, another neutral amino acid, another charged amino acid, another hydrophilic amino acid, another hydrophobic amino acid, another polar amino acid, another aromatic amino acid or another aliphatic amino acid.
- Substitution variants have at least one amino acid residue in the antibody molecule removed and a different residue inserted in its place.
- the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but framework alterations are also contemplated.
- Conservative substitutions are shown in Table 3 under the heading of "conservative substitutions.” If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" shown below, or as further described below in reference to amino acid classes, may be introduced and the products screened.
- Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a ⁇ -sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring residues are divided into groups based on common side-chain properties:
- Non-conservative substitutions are made by exchanging a member of one of these classes for another class.
- substitution for example, that may be made is to change one or more cysteines in the antibody, which may be chemically reactive, to another residue, such as, without limitation, alanine or serine.
- cysteines in the antibody which may be chemically reactive
- the substitution can be made in a CDR or framework region of a variable domain or in the constant region of an antibody.
- the cysteine is canonical.
- Any cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant cross-linking.
- cysteine bond(s) may be added to the antibody to improve its stability, particularly where the antibody is an antibody fragment such as an Fv fragment.
- the invention also provides methods of generating, selecting, and making PDGF- B antibodies.
- the antibodies of this invention can be made by procedures known in the art. In some embodiments, antibodies may be made recombinantly and expressed using any method known in the art.
- antibodies may be prepared and selected by phage display technology. See, for example, U.S. Patent Nos. 5,565,332; 5,580,717; 5,733,743; and 6,265, 150; and Winter et al., Annu. Rev. Immunol. 12:433-455, 1994.
- the phage display technology McCafferty et al., Nature 348:552-553, 1990
- V immunoglobulin variable
- antibody V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle.
- a filamentous bacteriophage such as M13 or fd
- the filamentous particle contains a single-stranded DNA copy of the phage genome
- selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties.
- the phage mimics some of the properties of the B cell.
- Phage display can be performed in a variety of formats; for review see, e.g., Johnson, Kevin S. and Chiswell, David J., Current Opinion in Structural Biology 3:564-571 , 1993.
- V-gene segments can be used for phage display. Clackson et al., Nature 352:624-628, 1991 , isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice. A repertoire of V genes from human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Mark et al., 1991 , J. Mol. Biol. 222:581-597, or Griffith et al., 1993, EMBO J. 12:725- 734.
- antibodies may be made using hybridoma technology. It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human, hybridoma cell lines.
- the route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein.
- the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.
- Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C, 1975, Nature 256:495-497 or as modified by Buck, D. W., et al., In Vitro, 18:377-381 , 1982. Available myeloma lines, including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization. Generally, the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art.
- a fusogen such as polyethylene glycol
- the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells.
- a selective growth medium such as hypoxanthine-aminopterin-thymidine (HAT) medium
- HAT hypoxanthine-aminopterin-thymidine
- Any of the media described herein, supplemented with or without serum, can be used for culturing hybridomas that secrete monoclonal antibodies.
- EBV immortalized B cells may be used to produce the PDGF-B monoclonal antibodies of the subject invention.
- hybridomas or other immortalized B-cells are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
- immunoassay procedures e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay.
- Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies specific for PDGF-B, or a portion thereof.
- Hybridomas that produce such antibodies may be grown in vitro or in vivo using known procedures.
- the monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired.
- Undesired activity, if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen.
- a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin
- the PDGF-B antibody (monoclonal or polyclonal) of interest may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation.
- the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
- Production of recombinant monoclonal antibodies in cell culture can be carried out through cloning of antibody genes from B cells by means known in the art. See, e.g. Tiller et al., 2008, J. Immunol. Methods 329, 1 12; US Patent No. 7,314,622.
- the polynucleotide sequence may be used for genetic manipulation to "humanize” the antibody or to improve the affinity, or other characteristics of the antibody.
- Antibodies may also be customized for use, for example, in dogs, cats, primate, equines and bovines.
- Fully human antibodies may be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
- Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are XenomouseTM from Abgenix, Inc. (Fremont, CA) and HuMAb-Mouse® and TC MouseTM from Medarex, Inc. (Princeton, NJ).
- Antibodies may be made recombinantly by first isolating the antibodies and antibody producing cells from host animals, obtaining the gene sequence, and using the gene sequence to express the antibody recombinantly in host cells (e.g., CHO cells). Another method which may be employed is to express the antibody sequence in plants (e.g., tobacco) or transgenic milk. Methods for expressing antibodies recombinantly in plants or milk have been disclosed. See, for example, Peeters, et al. Vaccine 19:2756, 2001 ; Lonberg, N. and D. Huszar Int. Rev. Immunol 13:65, 1995; and Pollock, et al., J Immunol Methods 231 : 147, 1999. Methods for making derivatives of antibodies, e.g., domain, single chain, etc. are known in the art.
- Immunoassays and flow cytometry sorting techniques such as fluorescence activated cell sorting (FACS) can also be employed to isolate antibodies that are specific for PDGF-B.
- FACS fluorescence activated cell sorting
- DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
- the hybridoma cells serve as a preferred source of such DNA.
- the DNA may be placed into expression vectors (such as expression vectors disclosed in PCT Publication No. WO 87/04462), which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- expression vectors such as expression vectors disclosed in PCT Publication No. WO 87/04462
- host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells
- the DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., Proc. Nat. Acad. Sci. 81 :6851 , 1984, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, "chimeric" or “hybrid” antibodies are prepared that have the binding specificity of a PDGF-B antibody herein.
- Antibody fragments can be produced by proteolytic or other degradation of the antibodies, by recombinant methods (i.e., single or fusion polypeptides) as described above or by chemical synthesis.
- Polypeptides of the antibodies, especially shorter polypeptides up to about 50 amino acids, are conveniently made by chemical synthesis. Methods of chemical synthesis are known in the art and are commercially available.
- an antibody could be produced by an automated polypeptide synthesizer employing the solid phase method. See also, U.S. Patent Nos. 5,807,715; 4,816,567; and 6,331 ,415.
- a polynucleotide comprises a sequence encoding the heavy chain and/or the light chain variable regions of antibody MOR8457, or germlined versions thereof.
- the sequence encoding the antibody of interest may be maintained in a vector in a host cell and the host cell can then be expanded and frozen for future use.
- Vectors (including expression vectors) and host cells are further described herein.
- affinity matured antibodies can be produced by procedures known in the art (Marks et al., 1992, Bio/Technology, 10:779-783; Barbas et al., 1994, Proc Nat. Acad. Sci, USA 91 :3809- 3813; Schier et al., 1995, Gene, 169: 147-155; Yelton et al., 1995, J. Immunol., 155:1994-2004; Jackson et al., 1995, J. Immunol., 154(7):3310-9; Hawkins et al., 1992, J. Mol. Biol., 226:889-896; and PCT Publication No. WO2004/058184).
- library scanning mutagenesis One way of characterizing a CDR of an antibody and/or altering (such as improving) the binding affinity of a polypeptide, such as an antibody, termed "library scanning mutagenesis".
- library scanning mutagenesis works as follows. One or more amino acid positions in the CDR are replaced with two or more (such as 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, 15, 16, 17, 18, 19, or 20) amino acids using art recognized methods. This generates small libraries of clones (in some embodiments, one for every amino acid position that is analyzed), each with a complexity of two or more members (if two or more amino acids are substituted at every position).
- the library also includes a clone comprising the native (unsubstituted) amino acid.
- a small number of clones e.g., about 20-80 clones (depending on the complexity of the library), from each library are screened for binding affinity to the target polypeptide (or other binding target), and candidates with increased, the same, decreased, or no binding are identified. Methods for determining binding affinity are well-known in the art.
- Binding affinity may be determined using, for example, BiacoreTM surface plasmon resonance analysis, which detects differences in binding affinity of about 2-fold or greater, Kinexa ® Biosensor, scintillation proximity assays, ELISA, ORIGEN ® immunoassay, fluorescence quenching, fluorescence transfer, and/or yeast display. Binding affinity may also be screened using a suitable bioassay. BiacoreTM is particularly useful when the starting antibody already binds with a relatively high affinity, for example a KD of about 10 nM or lower.
- every amino acid position in a CDR is replaced (in some embodiments, one at a time) with all 20 natural amino acids using art recognized mutagenesis methods (some of which are described herein). This generates small libraries of clones (in some embodiments, one for every amino acid position that is analyzed), each with a complexity of 20 members (if all 20 amino acids are substituted at every position).
- the library to be screened comprises substitutions in two or more positions, which may be in the same CDR or in two or more CDRs.
- the library may comprise substitutions in two or more positions in one CDR.
- the library may comprise substitution in two or more positions in two or more CDRs.
- the library may comprise substitution in 3, 4, 5, or more positions, said positions found in two, three, four, five or six CDRs.
- the substitution may be prepared using low redundancy codons. See, e.g., Table 2 of Balint et al., 1993, Gene 137(1 ):109-18.
- the CDR may be heavy chain variable region (VH) CDR3 and/or light chain variable region (VL) CDR3.
- the CDR may be one or more of VH CDR1 , VH CDR2, VH CDR3, VL CDR1 , VL CDR2, and/or VL CDR3.
- the CDR may be a Kabat CDR, a Chothia CDR, an extended CDR, an AbM CDR, a contact CDR, or a conformational CDR.
- Candidates with improved binding may be sequenced, thereby identifying a CDR substitution mutant which results in improved affinity (also termed an "improved" substitution).
- Candidates that bind may also be sequenced, thereby identifying a CDR substitution which retains binding.
- candidates each comprising an amino acid substitution at one or more position of one or more CDR
- candidates with improved binding are also useful for the design of a second library containing at least the original and substituted amino acid at each improved CDR position (i.e., amino acid position in the CDR at which a substitution mutant showed improved binding).
- Preparation, and screening or selection of this library is discussed further below.
- Library scanning mutagenesis also provides a means for characterizing a CDR, in so far as the frequency of clones with improved binding, the same binding, decreased binding or no binding also provide information relating to the importance of each amino acid position for the stability of the antibody-antigen complex. For example, if a position of the CDR retains binding when changed to all 20 amino acids, that position is identified as a position that is unlikely to be required for antigen binding. Conversely, if a position of CDR retains binding in only a small percentage of substitutions, that position is identified as a position that is important to CDR function.
- the library scanning mutagenesis methods generate information regarding positions in the CDRs that can be changed to many different amino acids (including all 20 amino acids), and positions in the CDRs which cannot be changed or which can only be changed to a few amino acids.
- Candidates with improved affinity may be combined in a second library, which includes the improved amino acid, the original amino acid at that position, and may further include additional substitutions at that position, depending on the complexity of the library that is desired, or permitted using the desired screening or selection method.
- adjacent amino acid position can be randomized to at least two or more amino acids. Randomization of adjacent amino acids may permit additional conformational flexibility in the mutant CDR, which may in turn, permit or facilitate the introduction of a larger number of improving mutations.
- the library may also comprise substitution at positions that did not show improved affinity in the first round of screening.
- the second library is screened or selected for library members with improved and/or altered binding affinity using any method known in the art, including screening using KinexaTM biosensor analysis, and selection using any method known in the art for selection, including phage display, yeast display, and ribosome display.
- DNA fragments encoding VH and VL regions can first be obtained using any of the methods described above.
- Various modifications, e.g. mutations, deletions, and/or additions can also be introduced into the DNA sequences using standard methods known to those of skill in the art.
- mutagenesis can be carried out using standard methods, such as PCR-mediated mutagenesis, in which the mutated nucleotides are incorporated into the PCR primers such that the PCR product contains the desired mutations or site-directed mutagenesis.
- the invention encompasses modifications to the variable regions shown in Figure 1 and the CDRs indicated in Figure 1.
- the invention includes antibodies comprising functionally equivalent variable regions and CDRs which do not significantly affect their properties as well as variants which have enhanced or decreased activity and/or affinity.
- the amino acid sequence may be mutated to obtain an antibody with the desired binding affinity to PDGF-B.
- Modification of polypeptides is routine practice in the art and need not be described in detail herein. Examples of modified polypeptides include polypeptides with conservative substitutions of amino acid residues, one or more deletions or additions of amino acids which do not significantly deleteriously change the functional activity, or which mature (enhance) the affinity of the polypeptide for its ligand, or use of chemical analogs.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to an epitope tag.
- Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.
- the antibodies may also be modified, e.g., in the variable domains of the heavy and/or light chains, e.g., to alter a binding property of the antibody. Changes in the variable region can alter binding affinity and/or specificity. In some embodiments, no more than one to five conservative amino acid substitutions are made within a CDR domain. In other embodiments, no more than one to three conservative amino acid substitutions are made within a CDR domain. For example, a mutation may be made in one or more of the CDR regions to increase or decrease the K D of the antibody for PDGF-B, to increase or decrease k 0ff , or to alter the binding specificity of the antibody. Techniques in site-directed mutagenesis are well-known in the art. See, e.g., Sambrook et al. and Ausubel et al., supra.
- a modification or mutation may also be made in a framework region or constant region to increase the half-life of a PDGF-B antibody. See, e.g., PCT Publication No. WO 00/09560.
- a mutation in a framework region or constant region can also be made to alter the immunogenicity of the antibody, to provide a site for covalent or non-covalent binding to another molecule, or to alter such properties as complement fixation, FcR binding and antibody-dependent cell-mediated cytotoxicity.
- a single antibody may have mutations in any one or more of the CDRs or framework regions of the variable domain or in the constant region.
- Modifications also include glycosylated and nonglycosylated polypeptides, as well as polypeptides with other post-translational modifications, such as, for example, glycosylation with different sugars, acetylation, and phosphorylation.
- Antibodies are glycosylated at conserved positions in their constant regions (Jefferis and Lund, 1997, Chem. Immunol. 65:1 1 1-128; Wright and Morrison, 1997, TibTECH 15:26-32).
- the oligosaccharide side chains of the immunoglobulins affect the protein's function (Boyd et al., 1996, Mol. Immunol. 32:131 1 -1318; Wittwe and Howard, 1990, Biochem.
- Oligosaccharides may also serve to target a given glycoprotein to certain molecules based upon specific recognition structures. Glycosylation of antibodies has also been reported to affect antibody-dependent cellular cytotoxicity (ADCC).
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine, asparagine-X-threonine, and asparagine-X-cysteine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
- glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above- described tripeptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
- glycosylation pattern of antibodies may also be altered without altering the underlying nucleotide sequence. Glycosylation largely depends on the host cell used to express the antibody. Since the cell type used for expression of recombinant glycoproteins, e.g. antibodies, as potential therapeutics is rarely the native cell, variations in the glycosylation pattern of the antibodies can be expected (see, e.g. Hse et al., 1997, J. Biol. Chem. 272:9062-9070).
- factors that affect glycosylation during recombinant production of antibodies include growth mode, media formulation, culture density, oxygenation, pH, purification schemes and the like.
- Various methods have been proposed to alter the glycosylation pattern achieved in a particular host organism including introducing or overexpressing certain enzymes involved in oligosaccharide production (U.S. Patent Nos. 5,047,335; 5,510,261 and 5,278,299).
- Glycosylation or certain types of glycosylation, can be enzymatically removed from the glycoprotein, for example, using endoglycosidase H (Endo H), N-glycosidase F, endoglycosidase F1 , endoglycosidase F2, endoglycosidase F3.
- Endo H endoglycosidase H
- N-glycosidase F N-glycosidase F
- endoglycosidase F1 endoglycosidase F2
- endoglycosidase F3 endoglycosidase F3
- the recombinant host cell can be genetically engineered to be defective in processing certain types of polysaccharides.
- Modifications include using coupling techniques known in the art, including, but not limited to, enzymatic means, oxidative substitution and chelation. Modifications can be used, for example, for attachment of labels for immunoassay. Modified polypeptides are made using established procedures in the art and can be screened using standard assays known in the art, some of which are described below and in the Examples.
- the antibody comprises a modified constant region that has increased or decreased binding affinity to a human Fc gamma receptor, is immunologically inert or partially inert, e.g., does not trigger complement mediated lysis, does not stimulate antibody-dependent cell mediated cytotoxicity (ADCC), or does not activate microglia; or has reduced activities (compared to the unmodified antibody) in any one or more of the following: triggering complement mediated lysis, stimulating ADCC, or activating microglia.
- Different modifications of the constant region may be used to achieve optimal level and/or combination of effector functions. See, for example, Morgan et al., Immunology 86:319-324, 1995; Lund et al., J.
- the constant region is modified as described in Eur. J. Immunol., 1999, 29:2613-2624; PCT Application No. PCT/GB99/01441 ; and/or UK Patent Application No. 9809951.8.
- an antibody constant region can be modified to avoid interaction with Fc gamma receptor and the complement and immune systems.
- the techniques for preparation of such antibodies are described in WO 99/58572.
- the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. See, e.g., U.S. Pat. Nos. 5,997,867 and 5,866,692.
- the constant region is modified as described in Eur. J. Immunol., 1999, 29:2613-2624; PCT Application No. PCT/GB99/01441 ; and/or UK Patent Application No. 9809951.8.
- the Fc can be human lgG 2 or human lgG 4 .
- the Fc can be human lgG 2 containing the mutation A330P331 to S330S331 (lgG2Aa), in which the amino acid residues are numbered with reference to the wild type lgG 2 sequence.
- the antibody comprises a constant region of lgG 4 comprising the following mutations (Armour et al., 2003, Molecular Immunology 40 585-593): E233F234L235 to P233V234A235 (lgG 4 A C ), in which the numbering is with reference to wild type lgG4.
- the Fc is human lgG 4 E233F234L235 to P233V234A235 with deletion G236 (lgG 4 At>)-
- the Fc is any human lgG 4 Fc (lgG 4 , lgG 4 Ab or lgG 4 A C ) containing hinge stabilizing mutation S228 to P228 (Aalberse et al., 2002, Immunology 105, 9-19).
- the antibody comprises a human heavy chain lgG 2 constant region comprising the following mutations: A330P331 to S330S331 (amino acid numbering with reference to the wild type lgG 2 sequence). Eur. J. Immunol., 1999, 29:2613-2624.
- the constant region is aglycosylated for relinked glycosylation. In some embodiments, the constant region is aglycosylated for relinked glycosylation by mutating the oligosaccharide attachment residue and/or flanking residues that are part of the N-glycosylation recognition sequence in the constant region.
- N-glycosylation site N297 may be mutated to, e.g., A, Q, K, or H. See, Tao et al., J. Immunology 143: 2595-2601 , 1989; and Jefferis et al., Immunological Reviews 163:59-76, 1998.
- the constant region is aglycosylated for N-linked glycosylation.
- the constant region may be aglycosylated for N-linked glycosylation enzymatically (such as removing carbohydrate by enzyme PNGase), or by expression in a glycosylation deficient host cell.
- antibody modifications include antibodies that have been modified as described in PCT Publication No. WO 99/58572. These antibodies comprise, in addition to a binding domain directed at the target molecule, an effector domain having an amino acid sequence substantially homologous to all or part of a constant region of a human immunoglobulin heavy chain. These antibodies are capable of binding the target molecule without triggering significant complement dependent lysis, or cell-mediated destruction of the target. In some embodiments, the effector domain is capable of specifically binding FcRn and/or FcyRllb. These are typically based on chimeric domains derived from two or more human immunoglobulin heavy chain CH2 domains. Antibodies modified in this manner are particularly suitable for use in chronic antibody therapy, to avoid inflammatory and other adverse reactions to conventional antibody therapy.
- the disclosure also provides an antibody constant domain that may be further modified. It is known that variants of the Fc region, e.g., amino acid substitutions, insertions, and/or additions and/or deletions, enhance or diminish effector function. See, e.g., Presta et al, 2002, Biochem. Soc. Trans. 30:487-490; Strohl, 2009, Curr. Opin. Biotechnol. 20(6):685-691 ; U.S. patents 5,624,821 , 5,648,260, 5,885,573, 6,737,056, 7,317,091 ; PCT publication Nos.
- the antibody comprises a modified constant region that has increased binding affinity for FcRn and/or an increased serum half-life as compared with the unmodified antibody.
- VH and VL sequences In a process known as "germlining", certain amino acids in the VH and VL sequences can be mutated to match those found naturally in germline VH and VL sequences.
- the amino acid sequences of the framework regions in the VH and VL sequences can be mutated to match the germline sequences to reduce the risk of immunogenicity when the antibody is administered.
- Germline DNA sequences for human VH and VL genes are known in the art (see e.g., the "Vbase” human germline sequence database; see also Kabat, E. A., et al., 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.
- Another type of amino acid substitution that may be made is to remove potential proteolytic sites in the antibody. Such sites may occur in a CDR or framework region of a variable domain or in the constant region of an antibody. Substitution of cysteine residues and removal of proteolytic sites may decrease the risk of heterogeneity in the antibody product and thus increase its homogeneity.
- Another type of amino acid substitution is to eliminate asparagine-glycine pairs, which form potential deamidation sites, by altering one or both of the residues.
- the C-terminal lysine of the heavy chain of a PDGF-B antibody of the invention can be cleaved or otherwiwse removed.
- the heavy and light chains of the antibodies may optionally include a signal sequence.
- DNA fragments encoding the VH and VL segments of the present invention can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full- length antibody chain genes, to Fab fragment genes, or to a scFv gene.
- a VL- or VH-encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker.
- the term "operatively linked”, as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.
- the isolated DNA encoding the VH region can be converted to a full-length heavy chain gene by operatively linking the VH-encoding DNA to another DNA molecule encoding heavy chain constant regions (CH1 , CH2 and CH3).
- the sequences of human heavy chain constant region genes are known in the art (see e.g., Kabat, E. A., et al., 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91 -3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the heavy chain constant region can be an IgG-i, lgG 2 , lgG 3 , lgG 4 , IgA, IgE, IgM or IgD constant region, but most preferably is an IgGi or lgG 2 constant region.
- the IgG constant region sequence can be any of the various alleles or allotypes known to occur among different individuals, such as Gm(1 ), Gm(2), Gm(3), and Gm(17). These allotypes represent naturally occurring amino acid substitution in the lgG1 constant regions.
- the VH-encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH1 constant region.
- the CH1 heavy chain constant region may be derived from any of the heavy chain genes.
- the isolated DNA encoding the VL region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the VL-encoding DNA to another DNA molecule encoding the light chain constant region, CL.
- the sequences of human light chain constant region genes are known in the art (see e.g., Kabat, E. A., et al., 1991 , Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the light chain constant region can be a kappa or lambda constant region.
- the kappa constant region may be any of the various alleles known to occur among different individuals, such as lnv(1 ), lnv(2), and lnv(3).
- the lambda constant region may be derived from any of the three lambda genes.
- VH- and VL-encoding DNA fragments are operatively linked to another fragment encoding a flexible linker such that the VH and VL sequences can be expressed as a contiguous single-chain protein, with the VL and VH regions joined by the flexible linker (See e.g., Bird et al., 1988, Science 242:423-426; Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; McCafferty et al., 1990, Nature 348:552-554.
- linking peptide is (GGGGS) 3 (SEQ ID NO: 18), which bridges approximately 3.5 nm between the carboxy terminus of one variable region and the amino terminus of the other variable region.
- Linkers of other sequences have been designed and used (Bird et al., 1988, supra). Linkers can in turn be modified for additional functions, such as attachment of drugs or attachment to solid supports.
- the single chain antibody may be monovalent, if only a single VH and VL are used, bivalent, if two VH and VL are used, or polyvalent, if more than two VH and VL are used. Bispecific or polyvalent antibodies may be generated that bind specifically to PDGF-B and to another molecule.
- the single chain variants can be produced either recombinantly or synthetically.
- an automated synthesizer can be used for synthetic production of scFv.
- a suitable plasmid containing polynucleotide that encodes the scFv can be introduced into a suitable host cell, either eukaryotic, such as yeast, plant, insect or mammalian cells, or prokaryotic, such as E. coli.
- a suitable host cell either eukaryotic, such as yeast, plant, insect or mammalian cells, or prokaryotic, such as E. coli.
- Polynucleotides encoding the scFv of interest can be made by routine manipulations such as ligation of polynucleotides.
- the resultant scFv can be isolated using standard protein purification techniques known in the art.
- Diabodies are bivalent, bispecific antibodies in which VH and VL are expressed on a single polypeptide chain, but using a linker that is too short to allow for pairing between the two domains on the same chain, thereby forcing the domains to pair with complementary domains of another chain and creating two antigen binding sites (see e.g., Holliger, P., et al., 1993, Proc. Natl. Acad Sci. USA 90:6444-6448; Poljak, R. J., et al., 1994, Structure 2:1 121 -1 123).
- Heteroconjugate antibodies comprising two covalently joined antibodies, are also within the scope of the invention. Such antibodies have been used to target immune system cells to unwanted cells (U.S. Patent No. 4,676,980), and for treatment of HIV infection (PCT Publication Nos. WO 91/00360 and WO 92/200373; EP 03089). Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents and techniques are well known in the art, and are described in U.S. Patent No. 4,676,980.
- Chimeric or hybrid antibodies also may be prepared in vitro using known methods of synthetic protein chemistry, including those involving cross-linking agents.
- immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioether bond.
- suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
- the invention also encompasses fusion proteins comprising one or more fragments or regions from the antibodies disclosed herein.
- a fusion antibody may be made that comprises all or a portion of a PDGF-B antibody of the invention linked to another polypeptide.
- only the variable domains of the PDGF-B antibody are linked to the polypeptide.
- the VH domain of a PDGF-B antibody is linked to a first polypeptide, while the VL domain of a PDGF-B antibody is linked to a second polypeptide that associates with the first polypeptide in a manner such that the VH and VL domains can interact with one another to form an antigen binding site.
- the VH domain is separated from the VL domain by a linker such that the VH and VL domains can interact with one another.
- the VH- linker- VL antibody is then linked to the polypeptide of interest.
- fusion antibodies can be created in which two (or more) single-chain antibodies are linked to one another. This is useful if one wants to create a divalent or polyvalent antibody on a single polypeptide chain, or if one wants to create a bispecific antibody.
- a fusion polypeptide that comprises at least 10 contiguous amino acids of the variable light chain region shown in SEQ ID NOs: 1 or 4 and/or at least 10 amino acids of the variable heavy chain region shown in SEQ ID NOs: 2 or 6. In other embodiments, a fusion polypeptide is provided that comprises at least about 10, at least about 15, at least about 20, at least about 25, or at least about 30 contiguous amino acids of the variable light chain region and/or at least about 10, at least about 15, at least about 20, at least about 25, or at least about 30 contiguous amino acids of the variable heavy chain region.
- the fusion polypeptide comprises a light chain variable region and/or a heavy chain variable region, as shown in any of the sequence pairs selected from among SEQ ID NOs: 1 and 2, and 4 and 6.
- the fusion polypeptide comprises one or more CDR(s).
- the fusion polypeptide comprises VH CDR3 and/or VL CDR3.
- a fusion protein contains one or more antibodies and another amino acid sequence to which it is not attached in the native molecule, for example, a heterologous sequence or a homologous sequence from another region.
- Exemplary heterologous sequences include, but are not limited to a "tag" such as a FLAG tag or a 6His tag. Tags are well known in the art.
- a fusion polypeptide can be created by methods known in the art, for example, synthetically or recombinantly.
- the fusion proteins of this invention are made by preparing an expressing a polynucleotide encoding them using recombinant methods described herein, although they may also be prepared by other means known in the art, including, for example, chemical synthesis.
- other modified antibodies may be prepared using nucleic acid molecules encoding a PDGF-B antibody.
- nucleic acid molecules encoding a PDGF-B antibody.
- “Kappa bodies” III et al., 1997, Protein Eng. 10:949-57
- “Minibodies” Martin et al., 1994, EMBO J. 13:5303-9
- “Diabodies” Holliger et al., supra
- “Janusins” Traunecker et al., 1991 , EMBO J. 10:3655-3659 and Traunecker et al., 1992, Int. J. Cancer (Suppl.) 7:51-52
- Kappa bodies III et al., 1997, Protein Eng. 10:949-57
- “Minibodies” Martin et al., 1994, EMBO J. 13:5303-9
- “Diabodies” Holliger et al., supra
- “Janusins” Tra
- bispecific antibodies monoclonal antibodies that have binding specificities for at least two different antigens
- methods for making bispecific antibodies are known in the art (see, e.g., Suresh et al., 1986, Methods in Enzymology 121 :210).
- bispecific antibodies or antigen-binding fragments can be produced by fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, 1990, Clin. Exp. Immunol. 79:315-321 , Kostelny et al., 1992, J. Immunol. 148:1547-1553.
- bispecific antibodies Traditionally, the recombinant production of bispecific antibodies was based on the coexpression of two immunoglobulin heavy chain-light chain pairs, with the two heavy chains having different specificities (Millstein and Cuello, 1983, Nature 305, 537-539).
- bispecific antibodies may be formed as "diabodies" or "Janusins.”
- the bispecific antibody binds to two different epitopes of PDGF-B.
- the modified antibodies described above are prepared using one or more of the variable domains or CDR regions from a PDGF-B antibody provided herein.
- antibody variable domains with the desired binding specificities are fused to immunoglobulin constant region sequences.
- the fusion preferably is with an immunoglobulin heavy chain constant region, comprising at least part of the hinge, CH2 and CH3 regions. It is preferred to have the first heavy chain constant region (CH1 ), containing the site necessary for light chain binding, present in at least one of the fusions.
- DNAs encoding the immunoglobulin heavy chain fusions and, if desired, the immunoglobulin light chain are inserted into separate expression vectors, and are cotransfected into a suitable host organism.
- the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm.
- This asymmetric structure with an immunoglobulin light chain in only one half of the bispecific molecule, facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations. This approach is described in PCT Publication No. WO 94/04690.
- compositions comprising antibodies conjugated (for example, linked) to an agent that facilitate coupling to a solid support (such as biotin or avidin).
- a solid support such as biotin or avidin.
- Conjugation generally refers to linking these components as described herein.
- the linking (which is generally fixing these components in proximate association at least for administration) can be achieved in any number of ways. For example, a direct reaction between an agent and an antibody is possible when each possesses a substituent capable of reacting with the other.
- a nucleophilic group such as an amino or sulfhydryl group
- a carbonyl-containing group such as an anhydride or an acid halide, or with an alkyl group containing a good leaving group (e.g., a halide) on the other.
- the antibodies can be bound to many different carriers.
- Carriers can be active and/or inert. Examples of well-known carriers include polypropylene, polystyrene, polyethylene, dextran, nylon, amylases, glass, natural and modified celluloses, polyacrylamides, agaroses and magnetite. The nature of the carrier can be either soluble or insoluble for purposes of the invention. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine experimentation.
- the carrier comprises a moiety that targets the lung, heart, or heart valve.
- An antibody or polypeptide of this invention may be linked to a labeling agent such as a fluorescent molecule, a radioactive molecule or any others labels known in the art.
- Labels are known in the art which generally provide (either directly or indirectly) a signal.
- the invention also provides polynucleotides encoding any of the antibodies, including antibody fragments and modified antibodies described herein, such as, e.g., antibodies having impaired effector function.
- the invention provides a method of making any of the polynucleotides described herein. Polynucleotides can be made and expressed by procedures known in the art.
- the invention provides polynucleotides or compositions, including pharmaceutical compositions, comprising polynucleotides, encoding any of the following PDGF-B antibodies and antigen-binding fragments thereof: MOR8457 VL (SEQ ID NO:1 ), MOR8457 VH (SEQ ID NO:2), MOR8457-GL-VL (SEQ ID NO:4), MOR8457-GL-VH (SEQ ID NO:6), MOR8457-GI-hlgG1 -3m-HC (SEQ ID NO:14), MOR8457-GL-LC (SEQ ID NO:16), MOR8457-GL-IKR-LC (SEQ ID NO:17), MOR8457-hlgG1-3m-HC (SEQ ID NO:18), MOR8457-15-VL (SEQ ID NO:34), MOR8457-15-LC (SEQ ID NO:37), MOR8457-16-VL (SEQ ID NO:39), MOR8457-16-LC (SEQ
- the invention provides polynucleotides, or compositions comprising the polynucleotides, encoding any of the following PDGF-B antibodies and antigen-binding fragments thereof or the invention, including: MOR8457 VL (SEQ ID NO:1 ), MOR8457 VH (SEQ ID NO:2), MOR8457-GL-VL (SEQ ID NO:4), MOR8457-GL-VH (SEQ ID NO:6), MOR8457-GI-hlgG1 -3m-HC (SEQ ID NO:14), MOR8457-GL-LC (SEQ ID NO:16), MOR8457-GL-IKR-LC (SEQ ID NO:17), MOR8457-hlgG1-3m-HC (SEQ ID NO:18), MOR8457-15-VL (SEQ ID NO:34), MOR8457-15-LC (SEQ ID NO:37), MOR8457-16-VL (SEQ ID NO:39), MOR8457-16-LC (S
- the invention provides polynucleotides and variants thereor encoding a PDGF-B antibody, wherein such variant polynucleotides share at least 70%, at least 75%, at least 80%, at least 85%, at least 87%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any of the specific nucleic acid disclosed herein.
- Polynucleotides complementary to any such sequences are also encompassed by the present invention.
- Polynucleotides may be single-stranded (coding or antisense) or double-stranded, and may be DNA (genomic, cDNA or synthetic) or RNA molecules.
- RNA molecules include HnRNA molecules, which contain introns and correspond to a DNA molecule in a one-to-one manner, and mRNA molecules, which do not contain introns. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide of the present invention, and a polynucleotide may, but need not, be linked to other molecules and/or support materials.
- Polynucleotides may comprise a native sequence (i.e., an endogenous sequence that encodes an antibody or a fragment thereof) or may comprise a variant of such a sequence.
- Polynucleotide variants contain one or more substitutions, additions, deletions and/or insertions such that the immunoreactivity of the encoded polypeptide is not diminished, relative to a native immunoreactive molecule. The effect on the immunoreactivity of the encoded polypeptide may generally be assessed as described herein.
- Variants preferably exhibit at least about 70% identity, more preferably, at least about 80% identity, yet more preferably, at least about 90% identity, and most preferably, at least about 95% identity to a polynucleotide sequence that encodes a native antibody or a fragment thereof.
- Two polynucleotide or polypeptide sequences are said to be “identical” if the sequence of nucleotides or amino acids in the two sequences is the same when aligned for maximum correspondence as described below. Comparisons between two sequences are typically performed by comparing the sequences over a comparison window to identify and compare local regions of sequence similarity.
- a “comparison window” as used herein refers to a segment of at least about 20 contiguous positions, usually 30 to about 75, or 40 to about 50, in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- MegAlign ® program in the Lasergene ® suite of bioinformatics software (DNASTAR ® , Inc., Madison, Wl), using default parameters.
- This program embodies several alignment schemes described in the following references: Dayhoff, M.O., 1978, A model of evolutionary change in proteins - Matrices for detecting distant relationships. In Dayhoff, M.O. (ed.) Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, Washington DC Vol. 5, Suppl. 3, pp. 345-358; Hein J., 1990, Unified Approach to Alignment and Phylogenes pp. 626-645 Methods in Enzymology vol. 183, Academic Press, Inc., San Diego, CA; Higgins, D.G.
- the "percentage of sequence identity” is determined by comparing two optimally aligned sequences over a window of comparison of at least 20 positions, wherein the portion of the polynucleotide or polypeptide sequence in the comparison window may comprise additions or deletions (i.e., gaps) of 20 percent or less, usually 5 to 15 percent, or 10 to 12 percent, as compared to the reference sequences (which does not comprise additions or deletions) for optimal alignment of the two sequences.
- additions or deletions i.e., gaps
- the percentage is calculated by determining the number of positions at which the identical nucleic acid bases or amino acid residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the reference sequence (i.e., the window size) and multiplying the results by 100 to yield the percentage of sequence identity.
- Variants may also, or alternatively, be substantially homologous to a native gene, or a portion or complement thereof.
- Such polynucleotide variants are capable of hybridizing under moderately stringent conditions to a naturally occurring DNA sequence encoding a native antibody (or a complementary sequence).
- Suitable "moderately stringent conditions" include prewashing in a solution of 5 X SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0); hybridizing at 50°C-65°C, 5 X SSC, overnight; followed by washing twice at 65°C for 20 minutes with each of 2X, 0.5X and 0.2X SSC containing 0.1 % SDS.
- highly stringent conditions or “high stringency conditions” are those that: (1 ) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1 % sodium dodecyl sulfate at 50°C; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1 % bovine serum albumin/0.1 % Ficoll/0.1 % polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42°C; or (3) employ 50% formamide, 5 x SSC (0.75 M NaCI, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1 % sodium pyrophosphate, 5 x Denhardt's solution, sonicated salmon sperm DNA (50 g/ml), 0.1 % SDS, and
- nucleotide sequences that encode a polypeptide as described herein. Some of these polynucleotides bear minimal homology to the nucleotide sequence of any native gene. Nonetheless, polynucleotides that vary due to differences in codon usage are specifically contemplated by the present invention. Further, alleles of the genes comprising the polynucleotide sequences provided herein are within the scope of the present invention. Alleles are endogenous genes that are altered as a result of one or more mutations, such as deletions, additions and/or substitutions of nucleotides. The resulting mRNA and protein may, but need not, have an altered structure or function. Alleles may be identified using standard techniques (such as hybridization, amplification and/or database sequence comparison).
- polynucleotides of this invention can be obtained using chemical synthesis, recombinant methods, or PCR. Methods of chemical polynucleotide synthesis are well known in the art and need not be described in detail herein. One of skill in the art can use the sequences provided herein and a commercial DNA synthesizer to produce a desired DNA sequence.
- a polynucleotide comprising a desired sequence can be inserted into a suitable vector, and the vector in turn can be introduced into a suitable host cell for replication and amplification, as further discussed herein.
- Polynucleotides may be inserted into host cells by any means known in the art. Cells are transformed by introducing an exogenous polynucleotide by direct uptake, endocytosis, transfection, F-mating or electroporation. Once introduced, the exogenous polynucleotide can be maintained within the cell as a non-integrated vector (such as a plasmid) or integrated into the host cell genome.
- the polynucleotide so amplified can be isolated from the host cell by methods well known within the art. See, e.g., Sambrook et al., 1989.
- PCR allows reproduction of DNA sequences.
- PCR technology is well known in the art and is described in U.S. Patent Nos. 4,683,195, 4,800,159, 4,754,065 and 4,683,202, as well as PCR: The Polymerase Chain Reaction, Mullis et al. eds., Birkauswer Press, Boston, 1994.
- RNA can be obtained by using the isolated DNA in an appropriate vector and inserting it into a suitable host cell. When the cell replicates and the DNA is transcribed into RNA, the RNA can then be isolated using methods well known to those of skill in the art, as set forth in Sambrook et al., 1989, supra, for example.
- Suitable cloning vectors may be constructed according to standard techniques, or may be selected from a large number of cloning vectors available in the art. While the cloning vector selected may vary according to the host cell intended to be used, useful cloning vectors will generally have the ability to self-replicate, may possess a single target for a particular restriction endonuclease, and/or may carry genes for a marker that can be used in selecting clones containing the vector.
- Suitable examples include plasmids and bacterial viruses, e.g., pUC18, pUC19, Bluescript (e.g., pBS SK+) and its derivatives, mp18, mp19, pBR322, pMB9, ColE1 , pCR1 , RP4, phage DNAs, and shuttle vectors such as pSA3 and pAT28.
- Bluescript e.g., pBS SK+
- shuttle vectors such as pSA3 and pAT28.
- Expression vectors are further provided.
- Expression vectors generally are replicable polynucleotide constructs that contain a polynucleotide according to the invention. It is implied that an expression vector must be replicable in the host cells either as episomes or as an integral part of the chromosomal DNA. Suitable expression vectors include but are not limited to plasmids, viral vectors, including adenoviruses, adeno-associated viruses, retroviruses, cosmids, and expression vector(s) disclosed in PCT Publication No. WO 87/04462.
- Vector components may generally include, but are not limited to, one or more of the following: a signal sequence; an origin of replication; one or more marker genes; suitable transcriptional controlling elements (such as promoters, enhancers and terminator). For expression (i.e., translation), one or more translational controlling elements are also usually required, such as ribosome binding sites, translation initiation sites, and stop codons.
- the vectors containing the polynucleotides of interest and/or the polynucleotides themselves, can be introduced into the host cell by any of a number of appropriate means, including electroporation, transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (e.g., where the vector is an infectious agent such as vaccinia virus).
- electroporation employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances
- microprojectile bombardment e.g., where the vector is an infectious agent such as vaccinia virus.
- infection e.g., where the vector is an infectious agent such as vaccinia virus.
- the choice of introducing vectors or polynucleotides will often depend on features of the host cell.
- the invention also provides host cells comprising any of the polynucleotides described herein. Any host cells capable of over-expressing heterologous DNAs can be used for the purpose of isolating the genes encoding the antibody, polypeptide or protein of interest.
- mammalian host cells include but not limited to COS, HeLa, and CHO cells. See also PCT Publication No. WO 87/04462.
- Suitable non-mammalian host cells include prokaryotes (such as E. coli or B. subtillis) and yeast (such as S. cerevisae, S. pombe; or K. lactis).
- the host cells express the cDNAs at a level of about 5 fold higher, more preferably, 10 fold higher, even more preferably, 20 fold higher than that of the corresponding endogenous antibody or protein of interest, if present, in the host cells.
- Screening the host cells for a specific binding to PDGF-B is effected by an immunoassay or FACS. A cell overexpressing the antibody or protein of interest can be identified.
- An expression vector can be used to direct expression of a PDGF-B antibody.
- One skilled in the art is familiar with administration of expression vectors to obtain expression of an exogenous protein in vivo. See, e.g., U.S. Patent Nos. 6,436,908; 6,413,942; and 6,376,471.
- Administration of expression vectors includes local or systemic administration, including injection, oral administration, particle gun or catheterized administration, and topical administration.
- the expression vector is administered directly to the sympathetic trunk or ganglion, or into a coronary artery, atrium, ventrical, or pericardium.
- Targeted delivery of therapeutic compositions containing an expression vector, or subgenomic polynucleotides can also be used.
- Receptor-mediated DNA delivery techniques are described in, for example, Findeis et al., Trends Biotechnol., 1993, 1 1 :202; Chiou et al., Gene Therapeutics: Methods And Applications Of Direct Gene Transfer, J.A. Wolff, ed., 1994; Wu et al., J. Biol. Chem., 1988, 263:621 ; Wu et al., J. Biol. Chem., 1994, 269:542; Zenke et al., Proc. Natl. Acad. Sci.
- compositions containing a polynucleotide are administered in a range of about 100 ng to about 200 mg of DNA for local administration in a gene therapy protocol. Concentration ranges of about 500 ng to about 50 mg, about 1 ⁇ g to about 2 mg, about 5 ⁇ g to about 500 ⁇ g, and about 20 ⁇ g to about 100 ⁇ g of DNA can also be used during a gene therapy protocol.
- the therapeutic polynucleotides and polypeptides can be delivered using gene delivery vehicles.
- the gene delivery vehicle can be of viral or non-viral origin (see generally, Jolly, Cancer Gene Therapy, 1994, 1 :51 ; Kimura, Human Gene Therapy, 1994, 5:845; Connelly, Human Gene Therapy, 1995, 1 :185; and Kaplitt, Nature Genetics, 1994, 6:148). Expression of such coding sequences can be induced using endogenous mammalian or heterologous promoters. Expression of the coding sequence can be either constitutive or regulated.
- Viral-based vectors for delivery of a desired polynucleotide and expression in a desired cell are well known in the art.
- Exemplary viral-based vehicles include, but are not limited to, recombinant retroviruses (see, e.g., PCT Publication Nos. WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/1 1230; WO 93/10218; WO 91/02805; U.S. Patent Nos. 5, 219,740 and 4,777, 127; GB Patent No. 2,200,651 ; and EP Patent No.
- alphavirus-based vectors e.g., Sindbis virus vectors, Semliki forest virus (ATCC VR-67; ATCC VR-1247), Ross River virus (ATCC VR-373; ATCC VR-1246) and Venezuelan equine encephalitis virus (ATCC VR-923; ATCC VR-1250; ATCC VR 1249; ATCC VR-532)
- AAV adeno-associated virus
- Non-viral delivery vehicles and methods can also be employed, including, but not limited to, polycationic condensed DNA linked or unlinked to killed adenovirus alone (see, e.g., Curiel, Hum. Gene Ther., 1992, 3:147); ligand-linked DNA (see, e.g., Wu, J. Biol. Chem., 1989, 264:16985); eukaryotic cell delivery vehicles cells (see, e.g., U.S. Patent No. 5,814,482; PCT Publication Nos.
- WO 95/07994 WO 96/17072; WO 95/30763; and WO 97/423378
- nucleic charge neutralization or fusion with cell membranes can also be employed.
- Exemplary naked DNA introduction methods are described in PCT Publication No. WO 90/1 1092 and U.S. Patent No. 5,580,859.
- Liposomes that can act as gene delivery vehicles are described in U.S. Patent No. 5,422, 120; PCT Publication Nos. WO 95/13796; WO 94/23697; WO 91/14445; and EP 0524968. Additional approaches are described in Philip, Mol. Cell Biol., 1994, 14:241 1 , and in Woffendin, Proc. Natl. Acad. Sci., 1994, 91 :1581.
- Therapeutic methods involve administering to a subject in need of treatment a therapeutically effective amount, or "effective amount", of a PDGF-B antibody, or antigen-binding portion, of the invention and are contemplated by the present disclosure.
- a therapeutically effective, or “effective”, amount refers to an amount of an antibody or portion thereof that is of sufficient quantity to result in a decrease in severity of disease symptoms, an increase in frequency and duration of disease symptom-free periods, or a prevention of impairment or disability due to the disease affliction - either as a single dose or according to a multiple dose regimen, alone or in combination with other agents.
- the subject may be a human or non-human animal (e.g., rabbit, rat, mouse, monkey or other lower-order primate).
- an antibody or antigen-binding portion of the invention might be coadministered with known medicaments, and in some instances the antibody might itself be modified.
- an antibody could be conjugated to an immunotoxin or radioisotope to potentially further increase efficacy.
- additional therapeutic agents can include a cytotoxic agent, a radiotoxic agent or an immunosuppressive agent.
- the antibody can be linked to the agent (as an immunocomplex) or can be administered separately from the agent. In the latter case (separate administration), the antibody can be administered before, after or concurrently with the agent or can be co-administered with other known therapies, e.g., an anticancer therapy, e.g., radiation.
- Such therapeutic agents include, among others, anti- neoplastic agents such as doxorubicin (adriamycin), cisplatin bleomycin sulfate, carmustine, chlorambucil, and cyclophosphamide hydroxyurea which, by themselves, are only effective at levels which are toxic or subtoxic to a patient.
- Cisplatin can be intravenously administered as a 100 mg dose once every four weeks and adriamycin is intravenously administered as a 60 to 75 mg dose once every 21 days.
- Co administration of the PDGF-B antibodies, or antigen binding fragments thereof, of the present disclosure with a therapeutic agent provides two agents which operate via different mechanisms may provide a therapeutic and perhaps synergistic effect to human disease. Such co-administration can solve problems due to development of resistance to drugs or, in the treatment of tumorigenesis and/or unwanted cell proliferation, a change in the antigenicity of the tumor cells which would render them unreactive with the antibody.
- the antibodies and antigen-binding portions disclosed herein can be used as a therapeutic or a diagnostic tool in a variety of situations where PDGF-B is undesirably expressed or found as reviewed in Trojanowska, 2008, Rheumatology 47:v2-v4; Andrae et al. 2008 Genes Dev. 22: 1276-1312; Heldin and Westermark, 1999, Physiological Revs. 79(4):1238-1316; Laimer et al., 2012, Nature Med.
- diseases, disorders or conditions include, but are not limited to, conditions related to abnormal cell growth, for example, mesothelioma, hepatocarcinoma, prostate carcinoma, adenocarcinoma, glioma, glioblastoma, ovarian carcinoma, cholangiocarcinoma, NPM-ALK-driven lymphomas, colorectal cancer, skin cancer, breast cancer, pancreatic cancer, lung cancer, or a combination of one or more of the foregoing cancers.
- conditions related to abnormal cell growth for example, mesothelioma, hepatocarcinoma, prostate carcinoma, adenocarcinoma, glioma, glioblastoma, ovarian carcinoma, cholangiocarcinoma, NPM-ALK-driven lymphomas, colorectal cancer, skin cancer, breast cancer, pancreatic cancer, lung cancer, or a combination of one or more of the foregoing cancers.
- PDGF-B mediated conditions that may be treated with the antibodies, or fragments thereof, of the invention include, but are not limited to, inflammatory conditions (e.g., atherosclerosis, restenosis, osteoarthritis, rheumatoid arthritis, Type 1 diabetes, chronic obstructive pulmonary disease, ischemia, stroke, thrombosis), fibrotic conditions (e.g., idiopathic pulmonary fibrosis, renal disease, biliary fibrosis, liver fibrosis, idiopathic peritoneal fibrosis, glomerulonephritis, IgA nephropathy, lupus nephritis, Alport syndrome, Fanconi disease, focal segmental glomerulosclerosis, hypertensive nephrosclerosis, nephritic disease, scleroderma (SSc), cardiac, hypertrophy, primary biliary sclerosis, Peyronie's disease, uterine fibroids, end
- compositions for use in accordance with the present disclosure may be formulated in a conventional manner using one or more pharmaceutically acceptable carriers or excipients and administered as more fully discussed below.
- Determining a therapeutically effective amount of an antibody or antigen- binding portion will largely depend on particular patient characteristics, route of administration, and the nature of the disorder being treated and is more fully discussed below.
- the antibodies, engineered antibodies, and engineered antibody conjugates of the invention can be used for diagnostic imaging.
- the engineered antibody conjugate can be a radiolabeled monoclonal antibody. See, for example, Srivastava (ed.), Radiolabeled Monoclonal Antibodies For Imaging And Therapy, Plenum Press (1988); Chase, “Medical Applications of Radioisotopes,” in Remington's Pharmaceutical Sciences, 18th Edition, Gennaro et al. (eds.), Mack Publishing Co., pp. 624-652 (1990); and Brown, “Clinical Use of Monoclonal Antibodies,” in Biotechnology and Pharmacy, Pezzuto et al. (eds.), Chapman and Hall, pp.
- This technique also known as immunoscintigraphy, uses a gamma camera to detect the location of gamma-emitting radioisotopes conjugated to monoclonal antibodies. Diagnostic imaging can be used to diagnose cancer, autoimmune disease, infectious disease and/or cardiovascular disease. (See, e.g., Brown, supra.)
- the engineered antibody conjugates can be used to diagnose cardiovascular disease.
- engineered antibody conjugates comprising anti-myosin antibody fragments can be used for imaging myocardial necrosis associated with acute myocardial infarction, among other uses.
- monoclonal antibody imaging can be used to monitor therapeutic responses, detect recurrences of a disease, and guide subsequent clinical decisions.
- radioisotopes may be bound to antibody fragments either directly or indirectly by using an intermediary functional group.
- intermediary functional groups include, for example, DTPA (diethylenetriaminepentaacetic acid) and EDTA (ethylene diamine tetraacetic acid).
- the radiation dose delivered to the patient is typically maintained at as low a level as possible. This may be accomplished through the choice of isotope for the best combination of minimum half-life, minimum retention in the body, and minimum quantity of isotope which will permit detection and accurate measurement.
- Examples of radioisotopes which can be bound to antibodies and are appropriate for diagnostic imaging include "mTc and 111 ln.
- antibody fragments particularly Fab and Fab', provide suitable tumor/background ratios. (See, e.g., Brown, supra.)
- the engineered antibody conjugates also can be labeled with paramagnetic ions for purposes of in vivo diagnosis.
- Elements which are particularly useful for Magnetic Resonance Imaging include Gd, Mn, Dy, and Fe ions.
- the engineered antibody conjugates can also detect the presence of particular antigens in vitro.
- the engineered antibody conjugates may be utilized in liquid phase or bound to a solid-phase carrier.
- an intact antibody, or antigen-binding fragment thereof can be attached to a polymer, such as aminodextran, in order to link the antibody component to an insoluble support such as a polymer-coated bead, plate, or tube.
- the engineered antibody conjugates can be used to detect the presence of particular antigens in tissue sections prepared from a histological specimen.
- in situ detection can be accomplished, for example, by applying a detectably- labeled immunoconjugate to the tissue sections.
- In situ detection can be used to determine the presence of a particular antigen and to determine the distribution of the antigen in the examined tissue.
- General techniques of in situ detection are well known to those of ordinary skill. (See, e.g., Ponder, "Cell Marking Techniques and Their Application,” in Mammalian Development: A Practical Approach, Monk (ed.), IRL Press, pp. 1 15-138 (1987); Coligan et al., supra.)
- Detectable labels such as enzymes, fluorescent compounds, electron transfer agents, and the like can be linked to a carrier by conventional methods well known to the art.
- These labeled carriers and the engineered antibody conjugates prepared from them can be used for in vitro immunoassays and for in situ detection, much as an antibody conjugate can be prepared by direct attachment of the labels to antibody.
- the loading of the engineered antibody conjugates with a plurality of labels can increase the sensitivity of immunoassays or histological procedures, where only a low extent of binding of the antibody, or antibody fragment, to target antigen is achieved.
- the invention also provides pharmaceutical compositions comprising an effective amount of a PDGF-B antibody described herein.
- the composition comprises one or more PDGF-B antibodies.
- the PDGF-B antibody recognizes PDGF-B.
- the PDGF-B antibody is a human antibody.
- the PDGF-B antibody is a humanized antibody.
- the PDGF-B antibody comprises a constant region that is capable of triggering a desired immune response, such as antibody-mediated lysis or ADCC.
- the PDGF-B antibody comprises a constant region that does not trigger an unwanted or undesirable immune response, such as antibody- mediated lysis or ADCC.
- the PDGF-B antibody comprises one or more CDR(s) of the antibody (such as one, two, three, four, five, or, in some embodiments, all six CDRs).
- compositions can comprise more than one PDGF-B antibody (e.g., a mixture of PDGF-B antibodies that recognize different epitopes of PDGF-B).
- Other exemplary compositions comprise more than one PDGF-B antibody that recognize the same epitope(s), or different species of PDGF-B antibodies that bind to different epitopes of PDGF-B.
- the compositions comprise a mixture of PDGF-B antibodies that recognize different variants of PDGF-B or a mixture of PDGF antibodies that recognize a variety of PDGFs, e.g., PDGF-A, -B, -C and -D.
- the compositions comprise a single PDGF-B antibody that recognizes epitope 1 and epitope 2 of PDGF-B.
- composition used in the present invention can further comprise pharmaceutically acceptable carriers, excipients, or stabilizers (Remington: The Science and practice of Pharmacy 20th Ed., 2000, Lippincott Williams and Wilkins, Ed. K. E. Hoover), in the form of lyophilized formulations or aqueous solutions.
- Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations, and may comprise buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine,
- the PDGF-B antibody and compositions thereof can also be used in conjunction with other agents that serve to enhance and/or complement the effectiveness of the agents.
- compositions comprising any of the polynucleotides of the invention.
- the composition comprises an expression vector comprising a polynucleotide encoding the antibody as described herein.
- composition comprises an expression vector comprising a polynucleotide encoding any of the antibodies described herein.
- the composition comprises either or both of the polynucleotides comprising the sequence shown in SEQ ID NO: 3 and SEQ ID NO: 5, either or both of the polynucleotides shown in SEQ ID NO: 13 and SEQ ID NO: 15, either or both of the polynucleotides shown in SEQ ID NO:35 and SEQ ID NO:45, either or both of the polynucleotides shown in SEQ ID NO:38 and SEQ ID NO:47, either or both of the polynucleotides shown in SEQ ID NO:40 and SEQ ID NO:45, or either or both of the polynucleotides shown in SEQ ID NO:43 and SEQ ID NO:47.
- the polynucleotide can encode the VH, VL and/or both of the antibody of the invention. That is, the composition comprises a single polynucleotide or more than one polynucleotide encoding the antibody, or antigen-binding portion thereof, or the invention.
- compositions of the disclosure also can be administered in combination therapy, such as, combined with other agents.
- the combination therapy can include an engineered antibody or conjugate thereof of the present disclosure combined with at least one other therapy wherein the therapy may be surgery, immunotherapy, chemotherapy, radiation treatment, or drug therapy.
- the pharmaceutical compounds of the disclosure may include one or more pharmaceutically acceptable salts.
- Such salts include acid addition salts and base addition salts.
- Acid addition salts include those derived from nontoxic inorganic acids, such as hydrochloric, nitric, phosphoric, sulfuric, hydrobromic, hydroiodic, phosphorous and the like, as well as from nontoxic organic acids such as aliphatic mono- and dicarboxylic acids, phenyl-substituted alkanoic acids, hydroxy alkanoic acids, aromatic acids, aliphatic and aromatic sulfonic acids and the like.
- Base addition salts include those derived from alkaline earth metals, such as sodium, potassium, magnesium, calcium and the like, as well as from nontoxic organic amines, such as ⁇ , ⁇ '-dibenzylethylenediamine, N-methylglucamine, chloroprocaine, choline, diethanolamine, ethylenediamine, procaine and the like.
- a pharmaceutical composition of the disclosure also may include a pharmaceutically acceptable anti-oxidant.
- pharmaceutically acceptable antioxidants include: (1 ) water soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil- soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil- soluble antioxidants such as ascorbyl palmitate, but
- aqueous and non-aqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions may also contain adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption such as aluminum monostearate and gelatin.
- adjuvants such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of presence of microorganisms may be ensured both by sterilization procedures and by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents,
- compositions typically must be sterile and stable under the conditions of manufacture and storage.
- the composition can be formulated as a solution, microemulsion, liposome, or other ordered structure suitable to high drug concentration.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
- the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- isotonic agents for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- Sterile injectable solutions can be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- a pharmaceutical composition of the invention may be prepared, packaged, or sold in a formulation suitable for ophthalmic administration.
- Such formulations may, for example, be in the form of eye drops including, for example, a 0.1 1.0% (w/w) solution or suspension of the active ingredient in an aqueous or oily liquid carrier.
- Such drops may further comprise buffering agents, salts, or one or more other of the additional ingredients described herein.
- Other ophthalmalmically-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form or in a liposomal preparation.
- additional ingredients include, but are not limited to, one or more of the following: excipients; surface active agents; dispersing agents; inert diluents; granulating and disintegrating agents; binding agents; lubricating agents; sweetening agents; flavoring agents; coloring agents; preservatives; physiologically degradable compositions such as gelatin; aqueous vehicles and solvents; oily vehicles and solvents; suspending agents; dispersing or wetting agents; emulsifying agents, demulcents; buffers; salts; thickening agents; fillers; emulsifying agents; antioxidants; antibiotics; antifungal agents; stabilizing agents; and pharmaceutically acceptable polymeric or hydrophobic materials.
- compositions of the invention are known in the art and described, for example in Remington's Pharmaceutical Sciences, Genaro, ed., Mack Publishing Co., Easton, PA (1985), which is incorporated herein by reference.
- the antibody, engineered antibody or engineered antibody conjugate is administered in an intravenous formulation as a sterile aqueous solution containing 5 mg/m, or more preferably, about 10 mg/ml, or yet more preferably, about 15 mg/ml, or even more preferably, about 20 mg/ml of antibody, with sodium acetate, polysorbate 80, and sodium chloride at a pH ranging from about 5 to 6.
- the intravenous formulation is a sterile aqueous solution containing 5 or 10 mg/ml of antibody, with 20 mM sodium acetate, 0.2 mg/ml polysorbate 80, and 140 mM sodium chloride at pH 5.5.
- a solution comprising an engineered antibody or engineered antibody conjugate can comprise, among many other compounds, histidine, mannitol, sucrose, trehalose, glycine, poly(ethylene) glycol, EDTA, methionine, and any combination thereof, and many other compounds known in the relevant art.
- part of the dose is administered by an intraveneous bolus and the rest by infusion of the antibody, engineered antibody or engineered antibody conjugate formulation.
- a 0.01 mg/kg intravenous injection of the antibody, engineered antibody or engineered antibody conjugate may be given as a bolus, and the rest of a predetermined engineered antibody or engineered antibody conjugate dose may be administered by intravenous injection.
- a predetermined dose of the antibody or engineered antibody may be administered, for example, over a period of an hour and a half to two hours to five hours.
- a therapeutic agent where the agent is, e.g., a small molecule, it can be present in a pharmaceutical composition in the form of a physiologically acceptable ester or salt, such as in combination with a physiologically acceptable cation or anion, as is well known in the art.
- compositions described herein may be prepared by any method known or hereafter developed in the art of pharmacology.
- preparatory methods include the step of bringing the active ingredient into association with a carrier or one or more other accessory ingredients, and then, if necessary or desirable, shaping or packaging the product into a desired single- or multi- dose unit.
- compositions of the disclosure are pyrogen-free formulations which are substantially free of endotoxins and/or related pyrogenic substances.
- Endotoxins include toxins that are confined inside a microorganism and are released when the microorganisms are broken down or die.
- Pyrogenic substances also include fever- inducing, thermostable substances (glycoproteins) from the outer membrane of bacteria and other microorganisms. Both of these substances can cause fever, hypotension and shock if administered to humans. Due to the potential harmful effects, it is advantageous to remove even low amounts of endotoxins from intravenously administered pharmaceutical drug solutions.
- endotoxin units EU
- pyrogen levels in the composition are less than 10 EU/mg, or less than 5 EU/mg, or less than 1 EU/mg, or less than 0.1 EU/mg, or less than 0.01 EU/mg, or less than 0.001 EU/mg.
- endotoxin and pyrogen levels in the composition are less than about 10 EU/mg, or less than about 5 EU/mg, or less than about 1 EU/mg, or less than about 0.1 EU/mg, or less than about 0.01 EU/mg, or less than about 0.001 EU/mg.
- the disclosure comprises administering a composition wherein said administration is oral, parenteral, intramuscular, intranasal, vaginal, rectal, lingual, sublingual, buccal, intrabuccal, intravenous, cutaneous, subcutaneous or transdermal.
- the disclosure further comprises administering a composition in combination with other therapies, such as surgery, chemotherapy, hormonal therapy, biological therapy, immunotherapy or radiation therapy.
- compositions including an antibody, engineered antibody or engineered antibody conjugate of the disclosure are mixed with a pharmaceutically acceptable carrier or excipient.
- a pharmaceutically acceptable carrier or excipient can be prepared by mixing with physiologically acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions, lotions, or suspensions (see, e.g., Hardman, et al. (2001 ) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.
- an administration regimen for a therapeutic depends on several factors, including the serum or tissue turnover rate of the entity, the level of symptoms, the immunogenicity of the entity, and the accessibility of the target cells in the biological matrix.
- an administration regimen maximizes the amount of therapeutic delivered to the patient consistent with an acceptable level of side effects.
- the amount of biologic delivered depends in part on the particular entity and the severity of the condition being treated. Guidance in selecting appropriate doses of antibodies, cytokines, and small molecules are available (see, e.g., Wawrzynczak, 1996, Antibody Therapy, Bios Scientific Pub.
- Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment or predicted to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects.
- Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
- Actual dosage levels of the active ingredients in the pharmaceutical compositions of the present disclosure may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present disclosure employed, or the ester, salt or amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- compositions comprising antibodies, engineered antibodies or engineered antibody conjugates of the disclosure can be provided by continuous infusion, or by doses at intervals of, e.g., one day, one week, or 1 -7 times per week.
- Doses may be provided intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, or by inhalation.
- a specific dose protocol is one involving the maximal dose or dose frequency that avoids significant undesirable side effects.
- a total weekly dose may be at least 0.05 ⁇ g/kg body weight, at least 0.2 ⁇ g/kg, at least 0.5 ⁇ g/kg, at least 1 ⁇ g/kg, at least 10 ⁇ g/kg, at least 100 ⁇ g/kg, at least 0.2 mg/kg, at least 1.0 mg/kg, at least 2.0 mg/kg, at least 10 mg/kg, at least 15 mg/kg, at least 20 mg/kg, at least 25 mg/kg, or at least 50 mg/kg (see, e.g., Yang, et al., 2003, New Engl. J. Med. 349:427-434; Herold, et al., 2002, New Engl. J. Med.
- the dose may be at least 15 ⁇ g, at least 20 ⁇ g, at least 25 ⁇ g, at least 30 ⁇ g, at least 35 ⁇ g, at least 40 ⁇ g, at least 45 ⁇ g, at least 50 ⁇ g, at least 55 ⁇ g, at least 60 ⁇ g, at least 65 ⁇ g, at least 70 ⁇ g, at least 75 ⁇ g, at least 80 ⁇ g, at least 85 ⁇ g, at least 90 ⁇ g, at least 95 ⁇ g, or at least 100 ⁇ g.
- the doses administered to a subject may number at least 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , or 12, or more.
- the dosage administered to a patient may be 0.0001 mg/kg to 100 mg/kg of the patient's body weight.
- the dosage may be between 0.0001 mg/kg and 20 mg/kg, 0.0001 mg/kg and 10 mg/kg, 0.0001 mg/kg and 5 mg/kg, 0.0001 and 2 mg/kg, 0.0001 and 1 mg/kg, 0.0001 mg/kg and 0.75 mg/kg, 0.0001 mg/kg and 0.5 mg/kg, 0.0001 mg/'kg to 0.25 mg/kg, 0.0001 to 0.15 mg/kg, 0.0001 to 0.10 mg/kg, 0.001 to 0.5 mg/kg, 0.01 to 0.25 mg/kg or 0.01 to 0.10 mg/kg of the patient's body weight.
- the dosage of the antibody or engineered antibodies or engineered antibody conjugates of the disclosure may be calculated using the patient's weight in kilograms (kg) multiplied by the dose to be administered in mg/kg.
- the dosage of the antibodies of the disclosure may be 150 ⁇ g/kg or less, 125 ⁇ g/kg or less, 100 ⁇ g/kg or less, 95 ⁇ g/kg or less, 90 ⁇ g/kg or less, 85 ⁇ /kg or less, 80 ⁇ /kg or less, 75 ⁇ /kg or less, 70 ⁇ /kg or less, 65 ⁇ /kg or less, 60 ⁇ /kg or less, 55 ⁇ /kg or less, 50 ⁇ /kg or less, 45 ⁇ /kg or less, 40 ⁇ /kg or less, 35 ⁇ /kg or less, 30 ⁇ /kg or less, 25 ⁇ /kg or less, 20 ⁇ /kg or less, 15 ⁇ /kg or less, 10 ⁇ /kg or less, 5 ⁇ /kg or less, 2.5 ⁇ /kg or less, 2 ⁇ /kg
- Unit dose of the engineered antibodies or engineered antibody conjugates of the disclosure may be 0.1 mg to 20 mg, 0.1 mg to 15 mg, 0.1 mg to 12 mg, 0.1 mg to 10 mg, 0.1 mg to 8 mg, 0.1 mg to 7 mg, 0.1 mg to 5 mg, 0.1 to 2.5 mg, 0.25 mg to 20 mg, 0.25 to 15 mg, 0.25 to 12 mg, 0.25 to 10 mg, 0.25 to 8 mg, 0.25 mg to 7 m g, 0.25 mg to 5 mg, 0.5 mg to 2.5 mg, 1 mg to 20 mg, 1 mg to 15 mg, 1 mg to 12 mg, 1 mg to 10 mg, 1 mg to 8 mg, 1 mg to 7 mg, 1 mg to 5 mg, or 1 mg to 2.5 mg.
- the dosage of the antibodies, engineered antibodies or engineered antibody conjugates of the disclosure may achieve a serum titer of at least 0.1 ⁇ g/ml, at least 0.5 g/ml, at least 1 ⁇ g/ml, at least 2 ⁇ g/ml, at least 5 ⁇ g/ml, at least 6 ⁇ g/ml, at least 10 ⁇ g/ml, at least 15 ⁇ g/ml, at least 20 ⁇ g/ml, at least 25 ⁇ g/ml, at least 50 ⁇ g/ml, at least 100 ⁇ g/ml, at least 125 ⁇ g/ml, at least 150 v, at least 175 ⁇ g/ml, at least 200 ⁇ g/ml, at least 225 pg/ml, at least 250 pg/ml, at least 275 pg/ml, at least 300 pg/ml, at least 325 ⁇ / ⁇ , at least 350 g/ml, at least 375 [ g
- the dosage of the antibodies of the disclosure may achieve a serum titer of at least 0.1 g/ml, at least 0.5 ⁇ / ⁇ , at least 1 ⁇ / ⁇ , at least, 2 ⁇ / ⁇ , at least 5 ⁇ / ⁇ , at least 6 ⁇ / ⁇ , at least 10 ⁇ / ⁇ , at least 15 ⁇ / ⁇ , at least 20 ⁇ / ⁇ , at least 25 ⁇ / ⁇ , at least 50 ⁇ / ⁇ , at least 100 ⁇ / ⁇ , at least 125 ⁇ / ⁇ , at least 150 ⁇ / ⁇ , at least 175 ⁇ / ⁇ , at least 200 ⁇ / ⁇ , at least 225 g/ml, at least 250 g/ml, at least 275 ⁇ / ⁇ , at least 300 ⁇ / ⁇ , at least 325 g/ml, at least 350 ⁇ / ⁇ , at least 375 ⁇ / ⁇ , or at least 400 g/ml in the subject.
- Doses of antibodies, engineered antibodies or engineered antibody conjugates of the disclosure may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 15 days, 30 days, 45 days, 2 months, 75 days, 3 months, or at least 6 months.
- An effective amount for a particular patient may vary depending on factors such as the condition being treated, the overall health of the patient, the method route and dose of administration and the severity of side effects (see, e.g., Maynard, et al., 1996, A Handbook of SOPs for Good Clinical Practice, Interpharm Press, Boca Raton, Fla.; Dent, 2001 , Good Laboratory and Good Clinical Practice, Urch Publ, London, UK).
- the route of administration may be by, e.g., topical or cutaneous application, injection or infusion by intravenous, intraperitoneal, intracerebral, intramuscular, intraocular, intraarterial, intracerebrospinal, intralesional, or by sustained release systems or an implant (see, e.g., Sidman et al., 1983, Biopolymers 22:547-556; Langer, et al., 1981 , J. Biomed. Mater. Res. 15: 167-277; Langer, 1982, Chem. Tech. 12:98-105; Epstein, et al., 1985, Proc. Natl. Acad. Sci.
- composition may also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection.
- pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. See, e.g., U.S. Pat. Nos.
- an engineered antibody or engineered antibody conjugate, combination therapy, or a composition of the disclosure is administered using Alkermes AIRTM pulmonary drug delivery technology (Alkermes, Inc., Cambridge, Mass.).
- a composition of the present disclosure may also be administered via one or more routes of administration using one or more of a variety of methods known in the art.
- routes of administration include intravenous, intramuscular, intradermal, intraperitoneal, subcutaneous, spinal or other parenteral routes of administration, for example by injection or infusion.
- Parenteral administration may represent modes of administration other than enteral and topical administration, usually by injection, and includes, without limitation, intravenous, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal injection and infusion.
- a composition of the disclosure can be administered via a non-parenteral route, such as a topical, epidermal or mucosal route of administration, for example, intranasally, orally, vaginally, rectally, sublingually or topically.
- a pump may be used to achieve controlled or sustained release (see Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:20; Buchwald et al., 1980, Surgery 88:501 ; Saudek et al., 1989, N. Engl. J. Med. 321 :514).
- Polymeric materials can be used to achieve controlled or sustained release of the therapies of the disclosure (see e.g., Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla. (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York - H O - il 984); Ranger and Peppas, 1983, J., Macromol. ScL Rev. Macromol. Chem. 23:61 ; see also Levy et al, 1985, Science 1 1 225:190; During et al., 19Z9, Ann. Neurol. 25:351 ; Howard et al, 1989, J. Neurosurg.
- polymers used in sustained release formulations include, but are not limited to, poly(2-hydroxy ethyl methacrylate), poly(methyl methacrylate), poly(acrylic acid), poly(ethylene-co- vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N -vinyl pyrrolidone), polyvinyl alcohol), polyacrylamide, polyethylene glycol), polylactides (PLA), polyoeactide-co-glycolides) (PLGA), and polyorthoesters.
- the polymer used in a sustained release formulation is inert, free of leachable impurities, stable on storage, sterile, and biodegradable.
- a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 1 15-138 (1984)).
- Controlled release systems are discussed in the review by Langer, 1990, Science 249:1527-1533. Any technique known to one of skill in the art can be used to produce sustained release formulations comprising one or more antibodies of the disclosure or conjugates thereof. See, e.g., U.S. Pat. No. 4,526,938, International Patent Publication Nos.
- the antibody, engineered antibody or engineered antibody conjugate of the disclosure can be formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well-known to one of skill in the art. See, e.g., Remington's Pharmaceutical Sciences and Introduction to Pharmaceutical Dosage Forms, 19th ed., Mack Pub. Co., Easton, Pa. (1995).
- viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity, in some instances, greater than water are typically employed.
- Suitable formulations include, without limitation, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, and the like, which are, if desired, sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, such as, for example, osmotic pressure.
- auxiliary agents e.g., preservatives, stabilizers, wetting agents, buffers, or salts
- Other suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient, in some instances, in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as freon) or in a squeeze bottle.
- a pressurized volatile e.g., a gaseous propellant, such as freon
- humectants can also be added to
- compositions comprising antibodies, engineered antibodies or engineered antibody conjugates are administered intranasally, it can be formulated in an aerosol form, spray, mist or in the form of drops.
- prophylactic or therapeutic agents for use according to the present disclosure can be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas).
- a suitable propellant e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- the dosage unit may be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
- a second therapeutic agent e.g., a cytokine, steroid, chemotherapeutic agent, antibiotic, or radiation
- a second therapeutic agent e.g., a cytokine, steroid, chemotherapeutic agent, antibiotic, or radiation
- An effective amount of therapeutic may decrease the symptoms by at least 10 percent; by at least 20 percent; at least about 30 percent; at least 40 percent, or at least 50 percent.
- Additional therapies which can be administered in combination with the engineered antibodies or engineered antibody conjugates of the disclosure, may be administered less than 5 minutes apart, less than 30 minutes apart, 1 hour apart, at about 1 hour apart, at about 1 to about 2 hours apart, at about 2 hours to about 3 hours apart, at about 3 hours to about 4 hours apart, at about 4 hours to about 5 hours apart, at about 5 hours to about 6 hours apart, at about 6 hours to about 7 hours apart, at about 7 hours to about 8 hours apart, at about 8 hours to about 9 hours apart, at about 9 hours to about 10 hours apart, at about 10 hours to about 1 1 hours apart, at about 1 1 hours to about 12 hours apart, at about 12 hours to 18 hours apart, 18 hours to 24 hours apart, 24 hours to 36 hours apart, 36 hours to 48 hours apart, 48 hours to 52 hours apart, 52 hours to 60 hours apart, 60 hours to 72 hours apart, 72 hours to 84 hours apart, 84 hours to 96 hours apart, or 96 hours to 120 hours apart from the antibodies of the disclosure.
- the antibodies, engineered antibodies or engineered antibody conjugates of the disclosure and the other therapies may be cyclically administered. Cycling therapy involves the administration of a first therapy (e.g., a first prophylactic or therapeutic agent) for a period of time, followed by the administration of a second therapy (e.g., a second prophylactic or therapeutic agent) for a period of time, optionally, followed by the administration of a third therapy (e.g., prophylactic or therapeutic agent) for a period of time and so forth, and repeating this sequential administration, i.e., the cycle in order to reduce the development of resistance to one of the therapies, to avoid or reduce the side effects of one of the therapies, and/or to improve the efficacy of the therapies.
- a first therapy e.g., a first prophylactic or therapeutic agent
- a second therapy e.g., a second prophylactic or therapeutic agent
- a third therapy e.g., prophylactic or therapeutic agent
- the antibodies, engineered antibodies or engineered antibody conjugates of the disclosure can be formulated to ensure proper distribution in vivo.
- the blood-brain barrier excludes many highly hydrophilic compounds.
- the therapeutic compounds of the disclosure cross the BBB (if desired)
- they can be formulated, for example, in liposomes.
- liposomes For methods of manufacturing liposomes, see, e.g., U.S. Patents 4,522,81 1 ; 5,374,548; and 5,399,331.
- the liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V.V. Ranade, 1989, J. Clin. Pharmacol. 29:685).
- Exemplary targeting moieties include folate or biotin (see, e.g., U.S. Patent 5,416,016); mannosides (Umezawa et al., Biochem. Biophys. Res. Commun. 153: 1038); antibodies (P. G. Bloeman et al., 1995, FEBS Lett. 357: 140; M. Owais et al., 1995, Antimicrob. Agents Chemother. 39: 180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol. 1233: 134); pl20 (Schreier et al. (1994) J. Biol. Chem. 269:9090); see also K. Keinanen; M.L. Laukkanen, 1994, FEBS Lett. 346:123; Killion; Fidler, 1994; Immunomethods 4:273.
- biotin see, e.g., U.S. Patent 5,416,016);
- the disclosure provides protocols for the administration of pharmaceutical composition comprising antibodies, engineered antibodies or engineered antibody conjugates of the disclosure alone or in combination with other therapies to a subject in need thereof.
- the therapies e.g., prophylactic or therapeutic agents
- the therapy e.g., prophylactic or therapeutic agents
- the combination therapies of the present disclosure can also be cyclically administered.
- Cycling therapy involves the administration of a first therapy (e.g., a first prophylactic or therapeutic agent) for a period of time, followed by the administration of a second therapy (e.g., a second prophylactic or therapeutic agent) for a period of time and repeating this sequential administration, i.e., the cycle, in order to reduce the development of resistance to one of the therapies (e.g., agents) to avoid or reduce the side effects of one of the therapies (e.g., agents), and/or to improve, the efficacy of the therapies.
- a first therapy e.g., a first prophylactic or therapeutic agent
- a second therapy e.g., a second prophylactic or therapeutic agent
- the therapies (e.g., prophylactic or therapeutic agents) of the combination therapies of the disclosure can be administered to a subject concurrently.
- the term "concurrently” is not limited to the administration of therapies (e.g., prophylactic or therapeutic agents) at exactly the same time, but rather it is meant that a pharmaceutical composition comprising antibodies, engineered antibodies or engineered antibody conjugates of the disclosure are administered to a subject in a sequence and within a time interval such that the antibodies of the disclosure or conjugates thereof can act together with the other therapy(ies) to provide an increased benefit than if they were administered otherwise.
- each therapy may be administered to a subject at the same time or sequentially in any order at different points in time; however, if not administered at the same time, they should be administered sufficiently close in time so as to provide the desired therapeutic or prophylactic effect.
- Each therapy can be administered to a subject separately, in any appropriate form and by any suitable route.
- the therapies are administered to a subject less than 15 minutes, less than 30 minutes, less than 1 hour apart, at about 1 hour apart, at about 1 hour to about 2 hours apart, at about 2 hours to about 3 hours apart, at about 3 hours to about 4 hours apart, at about 4 hours to about 5 hours apart, at about 5 hours to about 6 hours apart, at about 6 hours to about 7 hours apart, at about 7 hours to about 8 hours apart, at about 8 hours to about 9 hours apart, at about 9 hours to about 10 hours apart, at about 10 hours to about 1 1 hours apart, at about 1 1 hours to about 12 hours apart, 24 hours apart, 48 hours apart, 72 hours apart, or 1 week apart.
- two or more therapies are administered to a within the same patient visit.
- the prophylactic or therapeutic agents of the combination therapies can be administered to a subject in the same pharmaceutical composition.
- the prophylactic or therapeutic agents of the combination therapies can be administered concurrently to a subject in separate pharmaceutical compositions.
- the prophylactic or therapeutic agents may be administered to a subject by the same or different routes of administration. Kits
- kits of the invention include one or more containers comprising a PDGF-B antibody described herein and instructions for use in accordance with any of the methods of the invention described herein. Generally, these instructions comprise a description of administration of the antibody for the above described therapeutic treatments.
- kits are provided for producing a single-dose administration unit.
- the kit can contain both a first container having a dried protein and a second container having an aqueous formulation.
- kits containing an applicator e.g., single and multi-chambered pre-filled syringes (e.g., liquid syringes and lyosyringes) ,are included.
- the antibody is a human antibody. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a monoclonal antibody.
- the instructions relating to the use of a PDGF-B antibody generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the invention are typically written instructions on a label or package insert (e.g., a paper sheet included in the kit), but machine-readable instructions (e.g., instructions carried on a magnetic or optical storage disk) are also acceptable.
- kits of this invention are in suitable packaging.
- suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging (e.g., sealed Mylar or plastic bags), and the like.
- packages for use in combination with a specific device such as an inhaler, nasal administration device (e.g., an atomizer) or an infusion device such as a minipump.
- a kit may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the container may also have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- At least one active agent in the composition is a PDGF-B antibody of the invention.
- the container may further comprise a second pharmaceutically active agent.
- Kits may optionally provide additional components such as buffers and interpretive information.
- the kit comprises a container and a label or package insert(s) on or associated with the container.
- the invention also provides diagonistic kits comprising any or all of the antibodies described herein.
- the diagonistic kits are useful for, for example, detecting the presence of PDGF-B in a sample.
- a diagnostic kit can be used to identify an individual with a latent disease, disorder or condition that may put them at risk of developing PDGF-B mediated disease, disorder or condition.
- a diagonistic kit can be used to determine whether an individual is at risk for a staphylococcal disease.
- a diagnostic kit can be used to detect the presence and/or level of PDGF-B in an individual suspected of having a PDGF-B mediated disease.
- Diagnostic kits of the invention include one or more containers comprising a
- an exemplary diagonistic kit can be configured to contain reagents such as, for example, a PDGF-B antibody, a negative control sample, a positive control sample, and directions for using the kit.
- Vector MOR8457-GL-VH having ATCC Accession No. PTA- 13303 comprises a DNA insert encoding the germlined MOR8457 heavy chain variable region
- vector MOR8457-GL-VL having ATCC Accession No. PTA-13302 comprises a DNA insert encoding the germlined MOR8457 light chain variable region.
- the deposits were made under the provisions of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purpose of Patent Procedure and Regulations thereunder (Budapest Treaty).
- the phagemid library is based on the HuCAL® concept (Knappik et al., J Mol Biol, 2000, 296; 57-86 and employs the CysDisplayTM technology for displaying the Fab on the phage surface (Lohning, 2001 WO 01/05950 HuCAL GOLD® antibody-phage of different frameworks were either combined to form one pool (VH1-6) or were divided into sub-pools (e.g., VH1/5, VH2/4/6, VH3) and subsequently these sub-pools were individually subjected to selection rounds on antigen as described below.
- Phage for the 1 st round of pannings were prepared by Hyperphage ( ⁇ 13 ⁇ 07 ⁇ , Progen, Heidelberg, Germany). Solid phase panning against PDGF-BB
- Solid phase panning was performed using recombinant human PDGF-BB (PHG0043, Lot 032001 ; Biosource Int. Inc.). For all three rounds of pannings 400 nM (10 g/ml) hPDGF-BB diluted in PBS was filled into an appropriate number of wells on Maxisorp plates (F96 MaxisorpTM, 442402, Nunc).
- Respective plates were then incubated overnight at 4 °C. On the next day, the wells were washed twice with PBS and then blocked with MPBST (5% (w/v) milk powder, PBS, 0.05% Tween20 (Sigma, St. Louis, MO, USA)) for 2 hours at room temperature (RT). Phage (100 ⁇ ) from original HuCAL GOLD® subpools (VH 1-6, VH1/5 and VH3, prepared with hyperphage) were used. Phage were pre-blocked in a PBS solution containing 2.5% milk powder, 2.5% bovine serum albumin (BSA) and 0.05% Tween20. The pre-blocking of phage was performed in 2 ml reaction tubes for 2 hours at RT on a rotator.
- MPBST 5% (w/v) milk powder, PBS, 0.05% Tween20 (Sigma, St. Louis, MO, USA)
- the antigen solution was removed from the plate and the wells were washed three times with PBS.
- the pre-blocked phage were added to the corresponding wells and the plate was incubated for 2 hours at RT on a microplate shaker. Then, the phage solution was removed and the wells were washed several times (the washing stringency depended on the panning strategy and the selection round) with PBST (PBS, 0.05% Tween20), followed by the same washing steps with PBS.
- the washing stringency was increased from round to round. PBS was removed after the last washing step before continuing with elution.
- Helper phage infection TG1 cells were infected with the helper phage VCSM13 (multiplicity of infection of at least 20) at 37 °C. The infected cells were harvested by centrifugation and resuspended in 2x YT medium containing 34 ⁇ g/ml chloramphenicol, 50 ⁇ g/ml kanamycin and 0.25 mM IPTG (isopropyl ⁇ -D-thiogalactopyranoside) for induction of Fab expression. The cells were grown overnight and the phage produced were precipitated from the supernatant with polyethylene glycol (PEG)/NaCI and the phage were resuspended in PBS. Input and output titers were determined by spot titration.
- PEG polyethylene glycol
- Second and third panning round was performed using 10 nM biotin-hPDGF- BB.
- PDGF-AA was used as a competitor at 10 fold molar excess of PDGF-AA was used for pre-blocking of phage.
- Pre-adsorbed Streptavidin Dynabeads® were added to the phage-antigen solution and incubated for further 10 min at RT on a rotator.
- a magnetic particle separator, MPC-E (Dynal Biotech, Oslo, Norway), was used to separate phage bound to the captured antigen.
- the beads were washed several times with PBST (PBS, 0.05 % Tween 20), followed by several washing steps with PBS. The washing stringency was increased with every panning round. PBS was removed after the last washing step before continuing with elution. Elution and further steps were performed as described for solid phase panning.
- Plasmid DNA of the phage display vector encoding Fab fragments from the 2nd round panning pools were prepared by using the Qiagen Midiprep Kit (Cat. No.12243).
- the DNA was cut with Bbs ⁇ and Sph ⁇ , thereby releasing the LCDR3-CL insert, and separated on a 1 % agarose gel.
- HCDR2 RapMATTM-libraries were performed by cutting the DNA with EcoR ⁇ and Xba ⁇ thus releasing the HCDR2-CH insert which was also separated from the vector backbone on a 1 % agarose gel.
- the expected band of the pMORPH®23 vector backbone ( ⁇ 4650bp) was excised from the gel and purified using Easy Pure Kit (Biozyme; Cat. No.390001 ).
- Vector backbones were ligated with HuCAL® kappa or lambda light chain CDR cassettes or HuCAL® heavy chain CDR cassettes, respectively, at a molar ratio of 1 :4.
- E. co// Top10F electrocompetent cells were transformed with the ligation samples.
- 2xYT medium containing 34 ⁇ g/ml chloramphenicol and 1 % glucose was inoculated with transformed cells and cultures were grown until reaching an OD600 nm of 1.5 - 2.0.
- the Fab encoding inserts of the selected HuCAL GOLD® phage were subcloned via Xba ⁇ and EcoR ⁇ into the expression vector pMORPH®X9_MH.
- chloramphenicol-resistant single clones were picked into the wells of a sterile 384-well microtiter plate pre-filled with 2xYT medium (supplemented with 34 ⁇ g/ml chloramphenicol and 1 % glucose) and grown overnight at 37 °C. These plates were regarded as masterplates. Before storage of the masterplates at -80 °C, the E.
- coli TG1 F- cultures were inoculated into new, sterile 384-well microtiter plates pre-filled with 40 ⁇ 2xYT medium supplemented with 34 ⁇ g/ml chloramphenicol and 0.1 % glucose per well.
- the microtiter plates were incubated at 30 °C shaking at 400 rpm on a microplate shaker until the cultures were slightly turbid (-2-4 h) with an OD600nm of -0.5.
- PDGF-BB positive clones were identified by screening clones for antigen binding using ELISA as well as functional PDGF-BB inhibitory activity using a receptor inhibition assay in parallel.
- Human PDGF-BB was used for overnight coating of Maxisorp microtiter plates at 4 °C at a concentration of 5 ⁇ g/ml (diluted in PBS). After overnight incubation, coated plates were washed twice with PBST (PBS/0.05% Tween20) and blocked with 5% MPBST (5% milk powder in PBST) for 1 hour at RT on a microplate shaker. The plates were washed twice with PBST before primary antibodies were added (crude extracts of microexpressed HuCAL® Fabs, purified HuCAL® Fabs, control antibody Fab_MOR07295). The plates containing the primary antibodies were incubated for 1 hour at RT on a microplate shaker.
- the plates were washed twice with PBST and for the detection of HuCAL® Fabs, the secondary antibody (Goat anti-human F(ab)2- Fragment specific - AP labeled, Jackson Cat. No. 109-055-097) was added, diluted 1 :5000 in 0.5% MPBST (0.5% milk powder in PBST).
- the plate containing the secondary antibodies was incubated for 1 hour at RT on a microplate shaker.
- the wells were washed five times with TBST (TBS/0.05% Tween20), Attophos (AttoPhos Substrate Set, Roche, Cat. No. 1 1681982001 ) was added (diluted 1 : 10 in water) and fluorescence emission at 535 nm was recorded with excitation at 430 nm.
- Plates were washed twice with PBST (PBS/0.05% Tween20) before primary antibodies were added (crude extracts of microexpressed HuCAL® Fabs, purified HuCAL® Fabs, control antibody Fab_MOR07295) and incubated for 1 hour at RT on a microplate shaker. Plates were washed twice with PBST (PBS/0.05% Tween20) and biotin-PDGF-BB antigen (0.5 ⁇ g/ml diluted in PBS) was incubated for 1 hour at RT on a microplate shaker. Plates were washed twice with PBST (PBS/0.05% Tween20) followed by incubation of Streptavidin-AP, (Zymed; Cat.No.
- a 384 well MSD plate was coated with 2.5 ⁇ g/ml PDGF-R3-Fc fusion protein (Cat.No. 385-PR, R&D Systems) overnight at 4 °C.
- 20 ⁇ of E. coli crude extract was preincubated with 20 ⁇ of 30 ng/ml biotin-PDGF-BB diluted in BV-buffer (PBS/0.02% Tween20 /0.5% BSA) for 1 hour at RT on a microplate shaker.
- MSD plates were washed three times with 50 ⁇ BV-buffer followed by transfer of the preincubated crude extract: biotin-PDGF-B complex.
- Fab fragments encoded by pMORPHX9_FH in TG-1 F- cells was carried out in shaker flask cultures with 1 I of 2xTY medium supplemented with 34 ⁇ g/ml chloramphenicol. After induction with 0.5 mM IPTG, cells were grown at 30 °C for 20 hours.
- Whole cell lysis (Lysozyme) of cell pellets was prepared and Fab fragments were isolated by HT-IMAC-purification. The apparent molecular weights were determined by size exclusion chromatography (SEC) with calibration standards. Concentrations were determined by UV-spectrophotometry.
- PDGF-R3 receptor phosphorylation by PDGF-BB ligand was analyzed using PAE cells stably transfected with PDGF-R3 cultured in culture medium (F12 Nutrient ham medium with L-Glutamine (Gibco; Cat.No. 21765) supplemented with 10% FBS (PAN Biotech, Lot P2501 12), 2 mM L-Glutamine (PAA, Cat.No. P04-80100) and 500 pg/ml geneticin (PAA; Cat.No. P1 1 -012).
- culture medium F12 Nutrient ham medium with L-Glutamine (Gibco; Cat.No. 21765) supplemented with 10% FBS (PAN Biotech, Lot P2501 12), 2 mM L-Glutamine (PAA, Cat.No. P04-80100) and 500 pg/ml geneticin (PAA; Cat.No. P1 1 -012).
- culture medium was exchanged to starving medium (culture medium cont.
- Fabs were tested for their inhibitory activity in receptor phosphorylation assay.
- Stably transfected PAE PDGF-R3 cells constitutively express the PDGF- ⁇ receptor and can be stimulated by PDGF-BB resulting in the receptor phosphorylation on position Tyr751.
- a Phospho-PDGFRbeta kit (Mesoscale Discovery) was used based on detection of P-Tyr751 by a specific anti-P- Tyr751 antibody.
- amino acid sequence of MOR8457 variable heavy domain is:
- GQGTLVTVSS (SEQ ID NO:1 )
- amino acid sequence of MOR8457 variable light domain is: SYELTQPPSVSVAPGQTARISCSGDSLGSYFVHWYQQKPGQAPVLVIYDDSNRPS GIPERFSGSNSGNTATLTISGTQAEDEADYYCSAFTHNSDVFGGGTKLTVL
- variable domain fragments of heavy (VH) and light chains (VL) were subcloned from Fab expression vectors into appropriate vectors for expression as human IgG.
- VH variable domain fragments of heavy
- VL light chains
- a synthetic DNA insert encoding the variable region of the heavy or light chain of the anti-PDGF-BB antibodies was created via commercial gene synthesis. Fragments were subcloned in-frame with human or mouse constant regions into expression vectors for transient expression.
- the constant regions consisted of human wild type lgG2 (SEQ ID NO:22), wild-type human lgG1 (SEQ ID NO:19), a human lgG1 with targeted mutations to ablate effector function termed "lgG1-3m" (SEQ ID NO:21 ), or mouse lgG1 (SEQ ID NO:20).
- MOR8457 was constructed with a light chain comprising germlined MOR8457 VL (SEQ ID NO:4) and further comprising an inadvertent sequence alteration in the light chain constant domain wherein the amino acid sequence TLV was substituted by IKR as the result of a PCR cloning error.
- the full length light chain comprising germlined MOR8457 VL and the light chain constant lambda domain comprising the IKR mutation was designated "MOR8457-GL-IKR-LC” (SEQ ID NO:17). Any antibody comprising a light chain constant domain comprising the "IKR” mutation is designated herein by including "IKR" in the name.
- the antibody comprising a light chain comprising the germlined MOR8457 VL sequence (SEQ ID NO:4) and further comprising the constant domain comprising the IKR sequence alteration in the constant domain (SEQ ID NO:17) and comprising a heavy chain comprising the germlined MOR8457 VH (SEQ ID NO:6) further comprising the human lgG1 triple effector null mutation in the constant region (SEQ ID NO:14) is referred to herein as antibody "MOR- 8457-GL-IKR-hlgG1 -3m".
- An antibody comprising at least one germlined V domain is referred to herein by the designation of "GL”, and any antibody not comprising a germlined domain does not include that designation in its name. More preferably, both VH and VL domains are germlined where the antibody is designated as "GL.”
- Transient expression of full length IgG was performed in HKB1 1 or HEK-293F cells, which were transfected with expression vectors encoding the heavy and light chains separately. Cell culture supernatant was harvested three to seven days after transfection and cleared by centrifugation.
- EXAMPLE 5 Design and generation of genes encoding a qermlined antibody variant of MOR8457
- the Morphosys HuCAL library was constructed using consensus sequences derived from seven heavy and seven light chain variable regions, respectively.
- the lead sequences which were obtained from this library contain amino acids at multiple positions which differ from their human germline counterparts, and could represent a theoretical immunogenicity risk. Mutation of the sequence at these non- germline positions back to the germline residues (termed "germlining") was performed to eliminate this potential liability.
- variable chain sequences of the phage derived MOR-8457 lead were compared to those available in the ImmunoGenetics (IMGT) immunoglobulin repertoire.
- the most appropriate human heavy ( Figure 1A) and light chain (Figure 1 B) germline variable sequence was identified by alignment.
- Figures 1 A and 1 B show the alignments and the percent shared sequence identity between the MOR8457 V H ( Figure 1A) and V L ( Figure 1 B) and each of the various germline sequences. Germlining of heavy chain V domain
- MOR8457 heavy chain V domain sequence For germlining of the MOR-8457 heavy chain (SEQ ID NO:2), the germline variable region encoded by IMGT IGHV3-23 * 01 (DP-54; SEQ ID NO:25), sharing 98.6% sequence identity, was determined to be the most appropriate. As depicted in Figure 1A, the framework regions of this variable gene contain the following substitutions V5L and R94K (Kabat numbering). Thus, a new germlined heavy chain V domain sequence (hereinafter referred to as "MOR8457-GL-VH", SEQ ID NO:6) was selected by replacing each of the substituted amino acids with those from the DP-54 germline variable region.
- MOR8457-GL-VH a new germlined heavy chain V domain sequence
- the germline variable region encoded by IMGT IGLV3-1 * 01 (DPL-23; SEQ ID NO:29), sharing 92.7% sequence identity with MOR8457 VL, was determined to be the most appropriate.
- the framework regions of this variable gene contain substitutions at five positions: A14S, R20S, S22T, A43S and E81 M (Kabat numbering) compared with MOR8457 (SEQ ID NO:1 ).
- a new germlined sequence hereinafter referred to as "MOR8457-GL-VL", SEQ ID NO:4 was selected by replacing each of the substituted amino acids with those from the DPL-23 germline variable region.
- MOR8457-IKR-hlgG1 -3m comprises a full length heavy chain (MOR8457-hlgG1-3m- HC; SEQ ID NO:18) comprising the original MOR8457 V H region sequence (SEQ ID NO:2) and a human lgG1 heavy chain constant domain containing an effector function null mutation (MOR8457-hlgG1 -3m; SEQ ID NO:21 ) and a full-length light chain (SEQ ID NO:17; MOR8457-IKR-LC) comprising the original V L region sequence (SEQ ID NO:1 ) and a human lambda light chain constant domain (CA; SEQ ID NO:23) wherein the light chain sequence comprises an inadvertent sequence mutation as described previously elsewhere herein.
- MOR8457-IKR-hlgG1 -3m comprises a full length heavy chain (MOR8457-hlgG1-3m- HC; SEQ ID NO:18) comprising the original MOR84
- MOR8457-mlgG1 comprises a full length heavy chain comprising the original MOR8457 V H region sequence (SEQ ID NO:2) and further comprises a mouse wild type lgG1 heavy chain constant domain (SEQ ID NO:20) to provide a full-length heavy chain termed "MOR8457-mlgG1-HC".
- the MOR8457-mlgG1 antibody further comprises a full-length light chain (MOR8457-m-LC) comprising the original MOR8457 V L region sequence (SEQ ID NO:1 ) and a mouse wild type lambda constant domain (SEQ ID NO:24) .
- MOR8457-GL-hlgG1-3m Another variant MOR8457 antibody, termed "MOR8457-GL-hlgG1-3m", was constructed which comprises a full-length heavy chain (MOR8457-GL-hlgG1-3m-HC; SEQ ID NO:14) comprising the germlined MOR8457 V H region sequence (MOR8457- GL-VH; SEQ ID NO:6) and a human lgG1 heavy chain constant domain containing an effector function null mutation (hlgG1 -3m; SEQ ID NO:21 ) and the antibody further comprises a full-length light chain (SEQ ID NO:16; MOR8457-GL-LC) comprising the germlined MOR8457 V L region sequence (SEQ ID NO:4; MOR8457-GL-VL) and the wild type human lambda light chain constant domain (SEQ ID NO:23).
- MOR8457 IgG variants MOR8457-IKR-hlgG1-3m, MOR8457-mlgG1 , and MOR8457-GL-hlgG1 -3m
- human PDGF ligands including human PDGF-AA, -AB, -DD, as well as rat PDGF-BB (all obtained from R&D systems, Minneapolis, MN) and mouse PDGF-BB (Invitrogen, Carlsbad, CA) were tested.
- anti-human or anti-mouse IgG (GE Healthcare) antibodies were immobilized in adjacent flow cells of a CM5 sensor chip between 8000-10,000 resonance units (RU) using amine coupling as directed by the manufacturer.
- Antibodies were diluted into PBS-NET (10 mM Phosphate pH 7.4, 287 mM NaCI, 2.7 mM KCI, 3.2 mM EDTA, 0.01 % Tween 20) to 1 ⁇ g/mL and injected independently over the respective anti-human or anti-mouse surface for 10 seconds resulting in a stable anti-PDGF surface between 50-100 RU.
- PDGF proteins were diluted to 1 nM in PBS-NET and serially diluted two-fold to 0.25 nM.
- MOR8457 antibody constructs were specific for PDGF-B demonstrated by the fact that MOR8457 variants only bound PDGF-BB and PDGF-AB (Table 2) but did not bind to PDGF-AA nor PDGF- DD (data not shown). Binding of MOR8457 to PDGF-AB and PDGF-BB, but not PDGF- AA, suggests that each PDGF-B subunit in the dimer has one exposed MOR8457 binding site.
- Binding affinities to PDGF-AB and PDGF-BB showed a slight difference, 69 pM and 28 pM, which may be due to minor conformational differences of PDGF-B present in the hetero-dimer PDGF-AB and the homo-dimer PDGF-BB.
- PDGF-BB binds to homodimeric PDGFR- ⁇ and PDGFR- ⁇ receptor complex as well as to heterodimeric PDGFR- ⁇ receptor complex
- PDGF-AB binds to homodimeric PDGFR- ⁇ and heterodimeric PDGFR- ⁇ receptors to trigger down steam signaling involved in various diseases or disorders.
- Binding of MOR8457 to PDGF-AB and PDGF-BB, which blocks binding of PDGF-B to its receptors, could be used to block PDGF-AB and PDGF-BB interaction with their respective receptor complexes, thereby inhibiting the downstream signaling which mediates or is associated with various disease states.
- MOR8457 may provide a novel therapeutic for any PDGF-AB and PDGF-BB associated disease. Further, MOR8457 bound with similar characteristics to mouse and rat PDGF-BB, i.e., 10 pM and 25 pM, respectively, making it a useful surrogate antibody for use in preclinical animal model studies thus further increasing its potential usefulness in development of potential therapeutics to treat PDGF-B-mediated signaling diseases or disorders.
- each PDGF-B subunit comprises at least one MOR8457 binding site. This raised the question of whether the two binding sites on a PDGF-BB homodimer interact with two IgV domains from one antibody or from two antibodies, in other words, it was unclear whether the stoichiometry of antibody binding to PDGF-BB is 1 :1 or 2:1 .
- MOR8457-mlgG1 mouse
- MOR8457-GL-IKR-hlgG1-3m human
- MOR8457-mlgG1 was captured via anti-mouse IgG (GE Healthcare) immobilized onto a CM5 sensor chip, resulting in a stable surface of 200-400RU. Then, human PDGF-BB at 1 nM was injected for 6 minutes followed by MOR8457-IKR-hlgG1-3m as illustrated in the drawing shown in Figure 3 and in the sensorgram shown by the solid line after Inject 2.
- the sensorgram data disclosed for Cycle 1 after Inject 3 demonstrate that MOR8457-IKR- hlgG1 -3m bound to pre-assembled MOR8457-mlgG/PDGF-BB complex (formed after Inject 2, indicating MOR8457-mlgG bound only to one site on PDGF-BB while the other binding site on PDGF-BB was available for a second antibody, in this case, the second site was available for MOR8457-IKR-hlgG1 -3m binding. Therefore, these data demonstrate that the binding stoichiometry of MOR8457 to PDGF-BB is 2:1 .
- PDGF-BB signaling is activated after its binding to cell surface PDGF receptor ⁇ dimers.
- competitive binding analyses were performed between MOR8457 and a PDGFR3-hlgG1 fusion protein comprising the ectodomain of PDGFR3 and a human wild type lgG1 constant domain to provide a soluble PDGFR3 on Biacore via either sequentially binding on the chip or neutralizing PDGF-BB in solution.
- PDGFR3-hlgG1 was captured onto a CM5 sensor chip via an anti-human IgG antibody as illustrated in the drawing in Figure 4A).
- Human PDGF-BB was then injected at a concentration of 1 nM for 6 minutes to saturate the binding sites on PDGFR3-hlgG1 , followed by injecting MOR8457-mlgG1 .
- Binding of PDGFR3-hlgG1 to PDGF-BB blocked the binding of MOR8457-mlgG1 to PDGF-BB (see sensorgram for Cycle 1 shown in Figure 4).
- MOR8457 directly competes with the PDGFR3 receptor for binding with PDGF-BB further supporting the use of MOR8457 as a potential novel therapeutic for treatment of diseases or disorders mediated by PDGF- BB binding to its receptors (PDGFRa3 and PDGFR33). Sequential binding analysis in solution
- MOR8457-mlgG1 was serially diluted in PBS then mixed with 1 mM of human PDGF-BB and incubated for 20 hours at 2-8 °C to reach equilibrium.
- Each MOR8457-mlgG1 and PDGF-BB dilution mixture shown between [brackets] in Figure 5A was then injected over the surface of PDGFRp-hlgG1 captured by anti-human lgG1 on a CM5 chip.
- Figure 5B depicts a graph showing the concentration response curve of MOR8457 inhibition. With increased concentration, MOR8457-mlgG1 completely blocked the binding of PDGF-BB to PDGFRp-hlgG1 on the chip. All of these data demonstrate a shared binding site between MOR8457 and PDGFRp onto PDGF-BB. These data further demonstrate that the binding site of MOR8457 for PDGF-BB directly competes with the binding site of the receptor for PDGF-BB and that binding of one MOR8457 on PDGF-BB is sufficient to block the ligand's binding to its receptor. These data further confirm the potential usefulness of MOR8457 as a novel therapeutic to treat diseases or disorders mediated by or associated with PDGF-B binding to its receptors.
- EXAMPLE 7 Crystal structure of PDGF-BB in complex with the neutralizing antibody fragment Fab-MOR8457
- PDGF-BB in complex with MOR8457-Fab was crystallized at 18°C from a solution containing 22% PEG 3350 and 0.1 M Tris, pH 7.0.
- a data set to a 2.3 A resolution was collected from a single frozen crystal at IMCA beamline 17-ID at the Argonne National Laboratory (APS). The data were processed and scaled using autoPROC and SCALA. The final data set was 99.7% complete with average redundancy of 3.4 and with R sym of 5.8 %.
- the structure was solved by molecular replacement with PHASER starting with the fab fragment models prepared from the Brookhaven PDB entries: 2adg and 8fab, and with the PDGF-BB model prepared from entry: 3mjg.
- the initial solution was obtained by searching for each of the four domains of the Fab molecule separately. This partial solution was used to search for a second copy of the Fab fragment, followed by a final search for the PDGF-BB molecule.
- the final complete molecular replacement solution contained two MOR8457-Fab fragments bound to one PDGF-BB dimer.
- the final MOR8457-Fab +PDGF-BB model comprises two chains of the first Fab copy, H and L (residues 1 H-133H, 142H- 191 H, 200H-220H of heavy chain H and residues 3L- 205L of light chain L), two chains of the second Fab copy, B and A (1 B-134B, 141 B- 220B of heavy chain B and 2A-207A of light chain A) and two chains of PDGF-BB, C and D (10C-101 C of chain C and 7D-102D of chain D). Missing amino acids in some regions were not modeled into the structure because of the lack of electron density, very likely due to disorder. Non-protein atoms present in the model include 327 water molecules.
- the crystal structure revealed two MOR8457-Fab molecules binding to the two symmetrical sites at the two opposite ends of a single PDGF-BB cytokine as illustrated by the ribbon diagram shown in Figure 6.
- the C-termini of the two MOR8457-Fab molecules are separated by about 190 A, which imposes certain geometric constraints on observed stoichiometry and further confirms the 2:1 binding stoichiometry for MOR8457 and PDGF-BB, with one PDGF-BB molecule cross-linked by two spatially distant MOR8457 antibodies.
- the crystal structure reveals two MOR8457-Fab molecules binding to the two symmetrical sites at the two opposite ends of a single PDGF-BB cytokine (ribbon diagram in Figure 6).
- the C-termini of the two MOR8457-Fab molecules are separated by about 190 A, which imposes certain geometric constraints on observed stoichiometry.
- FIG. 7 details displayed in Figure 7 refer to only one epitope, binding epitope number 1 , that involves the antibody chains H and L (represented by the molecular surface shown in Figure 7) and the cytokine monomers C and D represented by the ribbon diagram in Figure 7.
- the PDGF-BB residues essential for binding are contributed by both PDGF-B monomers, with 87% of the interactions coming from one monomer (Loop 1 and Loop 3) and the remaining 13% (Loop 2) from the other monomer.
- a total of 17 residues from PDGF-BB and 22 residues from MOR8457-Fab are involved in interactions at each interface as indicated by the fact that they are less than four angstroms (4 A) apart and therefore considered "contact residues.” All CDR regions, except CDR-H1 , are involved in interaction with PDGF-BB, with the largest contribution coming from CDR-H3.
- Each binding interface results from an interplay of hydrogen-bonding and aromatic ring interactions, with striking complementarily between negatively charged CDRs and positively charged Arg/Lys residues on PDGF-BB.
- All direct interactions within 4 A, covering both binding epitopes #1 and #2, are set forth in Table 3 below.
- Table 3 below.
- Trp 47 Trp 47, Tyr 50, Leu 57, Tyr 59, Tyr 60 and
- the contact residues on PDGF-B are as follows for epitope number 1 : Chain C: Leu 38, Val, 39 and Trp 40 from loop 1 ; Glu 71 , Arg 73, lie 75, lie 77,
- amino acid residues on MOR8457 and their respective contact (less than 4 A apart) residues on PDGF-BB are provided in Table 4 (epitope 1 ) and Table 5 (epitope 2) below.
- Table 4 amino acid residues on MOR8457 and their respective contact (less than 4 A apart) residues on PDGF-BB are provided in Table 4 (epitope 1 ) and Table 5 (epitope 2) below.
- MOR8457 binding to PDGF-BB blocked binding of the ligand to PDGFR3, the ability of MOR8457-IKR-lgG1-3mM to functionally inhibit PDGF-BB induced mesangial proliferation in primary human mesangial cells was assessed.
- Figure 8A depicts a graph showing the concentration response curve showing the dose-dependent increase in mesangial cell proliferation induced by increasing concentrations of PDGF-BB in the absence of MOR8457.
- MOR8457-IKR-hlgG1 - 3m was half-log diluted from 100 nM down to 0.1 nM then mixed with 2.5 ng/ml of PDGF-BB in serum-free MCM media with 0.1 % BSA for 30 minutes before adding to the cells.
- Figure 8B shows a representative dose-dependent curve showing inhibition of mesangial cell proliferation with increasing concentrations of MOR8457-IKR-hlgG1-3m.
- the average IC50 was determined from three independent experiments and is 13.4 ⁇ 2.8 pM and the maximum inhibition is 87.9 ⁇ 5.7%, demonstrating that MOR8457- is a functionally potent inhibitor of PDGF-B/PDGF- ⁇ mediated human mesangial proliferation.
- a series of log (DR-1 ) values for a series of log [B] antibody concentrations were plotted on a graph and the pA2 is deduced from the graph, referring to as the concentration of the antibody that causes two-fold shift of the PDGF-BB concentration response curve.
- the value of pA2 is system independent and reflects the intrinsic affinity of the antibody in the functional cell assay.
- the concentration response curve of PDGF-BB shifted to the right with the increased concentration of MOR8457-IKR-hlgG1 -3m and the extent of the inhibition was surmountable (Figure 9A).
- the deduced pA2 was about 20 pM which was in the same range as determined by Biacore (13 pM, Table 2). Because the 2:1 binding mode of MOR8457-IKR-hlgG1-3m to PDGF-BB, the right shift of the concentration response curves did not appear parallel as expected seen with a simple 1 :1 competitive inhibitor. This was also reflected in a ⁇ 1 slope of the Schild plot shown on Figure 9B.
- MOR8457-IKR-hlgG1 -3m is a potent and competitive PDGF-BB inhibitor of human mesangial cells proliferation.
- MOR8457 which is a potent competitive inhibitor of PDGF-BB that functionally inhibits mesangial cell proliferation would be a novel potential therapeutic for treatment of mesangioproliferative diseases associated with increased levels of PDGF-BB and/or PDGF-B mediated signaling.
- EXAMPLE 9 Assessment of MOR8457-mlqG1 in an acute Thy1 .1 rat model
- PrdU bromodeoxyuridine
- MOR8457-mlgG1 induced a dose dependent decrease in mesangial cell proliferation, determined by accumulation of BrdU as shown in Figure 10A.
- MOR8457-mlgG1 induced a dose dependent decrease in mesangial cell proliferation as shown by the decrease in alpha-smooth muscle actin positive staining ( Figure 10B).
- the viscosity of monoclonal antibodies at high concentrations is determined by a number of factors including charge, shape, volume and specific self-interactions (Yadav et al., 2010, J. Pharm. Sci., 99(12):4812-4829). Experimental results show that the total charge dictates some of the viscosity at high concentrations, but also close range specific interactions are seen to be equally important (Yadav 2010, supra). The total charge along with the precise patterning of the charges is important to determine the self-association at high concentrations. Coarse-grained molecular dynamics simulations suggest that a decrease in viscosity in solution correlates to a decreases in Fab-Fab attractions.
- the viscosity was compared to the total charge of the Fab (Figure 1 1 ), dipole moment of the Fab ( Figure 12) and net charge of the CDR ( Figure 13).
- bapineuzumab and IMA-638 structural models of the Fab were required.
- RK35, MAb1 and MAb2 crystal structures were available.
- AAB-001 , IMA-638, MOR8457 and MOR8457-GL homology models were generated using the Modeler package from Discovery Studio 3.5.
- the charge assignment was generated using the "Calculate Protein Ionization and Residue pK" package from Discovery Studio 3.5. Using the charges calculated, the total charge of the Fab at pH6.0 and the dipole moment were calculated.
- each antibody is shown in Figure 14 with the low viscosity antibodies shown in panels A- D (AAB-001.RK35, MAb2 and IMA-638, respectively) and higher viscosity antibodies shown in panels E-G (Mab1 , MOR8457-GL, and MOR8457, respectively). These data demonstrate that the higher viscosity antibodies have larger negative charge patches in their CDR regions (larger white patch in the figure) than the lower viscosity antibodies. Design Strategy
- Table 6 List of mutations which are predicted to increase the net charge without affecting stability or binding affinity.
- the antibodies, or antigen-binding portion thereof is dimeric, single mutants comprise two mutations per antibody molecule, i.e., one on each H or L chain. Similarly, where double mutations are present, the antibody comprises four (4) mutations since there are two heavy chains and two light chains. Where there are three (3) mutations which one on the H or L chain and two on the other H or L chain, the antibody comprises six mutations, and so on. Table 7: Mutations Tested Experimentally
- Transient expression of full length IgG was performed in HEK-293F cells, which were transfected with expression vectors encoding the heavy and light chains separately (MOR8457-2 to MOR8457-18 from table 7). Cell culture supernatant was harvested three to seven days after transfection and cleared by centrifugation.
- Viscosity of the engineered variants of MOR8457 was measured as follows. Proteins in PBS were extensively dialyzed against 20 mM histidine, 85 mg/ml sucrose, 0.05 mg/ml EDTA pH 6.0 using membrane cassette devices 10K MWCO (Thermo Scientific). Proteins were harvested from dialysis and filtered using a 0.2 micron syringe filter. Proteins were concentrated using Vivaspin centrifugal concentrators 10K MWCO (GE Healthcare). Sample aliquots (12 ⁇ ) were removed from the concentrator retentate as the protein volume was reduced and the protein concentration increased. 300 nm beads (Nanosphere, Thermo Scientific) were added to the protein samples and buffer blank.
- the beads were diluted 1 :10 in 20 mM histidine, 85 mg/ml sucrose, 0.05 mg/ml EDTA pH 6.0 and 0.75 ⁇ diluted beads were spiked into the protein sample.
- the protein/bead and buffer/bead samples were mixed by gently vortexing. 8 ⁇ sample was transferred to 1536 well plate (SensoPlate, glass bottom, Greiner Bio-One) for analysis by dynamic light scattering measurements (DLS).
- the plate was sealed with optically clear tape and centrifuged at 2000 RPM for 2 minutes to remove bubbles.
- the DLS measurements were made using a DynaPro Plate Reader (Wyatt Technology, Santa Barbara, CA). Samples were incubated at 25°C and measured with 15 consecutive 25 second acquisitions. Radius of the bead was averaged for data acquisitions that had acceptable decay curves. The viscosity was calculated based on the Stokes-Einstein equation. Sample viscosity was calculated as the measured apparent radius divided by the nominal bead radius times 0.893 cP, the viscosity of water at 25°C.
- MOR8457-15 and MOR8457-16 showed increased stability and expression relative to the parental mAb MOR8457-GL (see examples 11 , 12). In addition to stability and expression improvements, MOR8457-16 showed decreased viscosity relative to MOR8457 parental antibody and to MOR8457-GL. Both clones shared the heavy chain E6Q and Q13K mutations, while MOR8457-15 also had a light chain D96N mutation and MOR8457-16 had a light chain N53K mutation, i.e., they share a common heavy chain and differ in the light chain by a single amino acid residue. Homology models of these two mutants in complex with PDGF-B are shown in Figure 16.
- Decreased viscosity is an important factor in the successful commercialization of a protein therapeutic as it relates to the ability to manufacture the protein in that it may provide decreased aggregation and may affect the ability to concentrate the protein to deliver the protein parenterally or subcutaneously.
- decreased viscosity may facilitate the delivery of the antibody to a patient, including the ability to administer through a delivery device comprising a smaller bore (i.e., internal diameter) and/or guage (i.e., external diameter) and/or at a faster delivery rate.
- ADA anti-drug antibodies
- decreased viscosity of the MOR8457 variants is an important desirable characteristic that may provide a significant advantage to the antibody as a potential novel therapeutic.
- EXAMPLE 1 1 Improved Stability of Engineered MOR8457 variants
- EXAMPLE 12 Improved Manufacturability Profile of Engineered MOR8457 variants Yield and purity analysis of MOR8457-GL and the engineered variants.
- binding affinities of MOR8457-16 to different PDGF isoforms were determined as previously described (Example 6) using a Biacore 3000 (GE Healthcare, Piscataway NJ). Briefly, an anti-human IgG (GE Healthcare) antibody was immobilized in flow cells of a CM5 sensor chip between 8,000-10,000 resonance units (RU) using amine coupling as directed by the manufacturer.
- Test antibodies were diluted into PBS- NET (10 mM Phosphate pH 7.4, 287 mM NaCI, 2.7 mM KCI, 3.2 mM EDTA, 0.01 % Tween-20) to 0.5 ug/mL and injected over the anti-human antibody surface for 30 seconds resulting in a stable anti-PDGF surface between 82-122 RU.
- PDGF proteins were diluted to 1 nM in PBS-NET and serially diluted two-fold to 0.25nM. Each concentration of PDGF was then injected over the antibody surface for 2 minutes at a flow rate of 100ul/min. The complex was allowed to dissociate for 10 minutes.
- the MOR8457-16 antibody retained the low pM binding affinity to human PDGF- AB and BB and the cross reactivity to mouse and rat PDGF-BB ( Figure 20 and Table 8). Its binding affinity and specificity were comparable to that of parent MOR8457-GL
- Example 6 suggesting that the mutations resulting in the improvement of the viscosity did not comprise the binding to PDGFs.
- MOR8457-16 we tested its inhibition of mesangial cell proliferation. The assay was performed as described previously (Example 8). Briefly, antibodies were half-log diluted from 100nM down to 0.1 nM then mixed with 2.5 ng/ml of PDGF-BB in serum-free MCM media with 0.1 % BSA for 30 minutes before adding to the cells.
- Figure 21 shows the inhibition curve of MOR8457- 16 (A) compared with parent MOR8457-GL (B) in the same experiment.
- the IC50 of MOR8457-16 is 14 pM, which is similar to the IC 5 o of parent MOR8457 of 20 pM.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Immunology (AREA)
- Rheumatology (AREA)
- Urology & Nephrology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Pain & Pain Management (AREA)
- Ophthalmology & Optometry (AREA)
- Vascular Medicine (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Pulmonology (AREA)
- Physical Education & Sports Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Description
Claims
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2015005874A MX2015005874A (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof. |
| RU2015115956A RU2015115956A (en) | 2012-11-09 | 2013-10-28 | ANTIBODIES SPECIFIC TO THE THROMBOCYTE B GROWTH FACTOR, AND THEIR COMPOSITION AND APPLICATION |
| SG11201503245PA SG11201503245PA (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
| HK16104404.4A HK1216428A1 (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
| BR112015010722A BR112015010722A2 (en) | 2012-11-09 | 2013-10-28 | SPECIFIC GROWTH FACTOR ANTIBODIES DERIVED FROM ISOFORM B PLATELETS AND COMPOSITIONS AND USES THEREOF |
| JP2015541262A JP2015536339A (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor B specific antibodies and compositions and uses thereof |
| KR1020157014869A KR20150082503A (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
| CA2890483A CA2890483A1 (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
| AU2013343099A AU2013343099A1 (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor B specific antibodies and compositions and uses thereof |
| EP13820911.9A EP2917237A1 (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
| CN201380068100.1A CN105026426A (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
| US14/075,755 US9428577B2 (en) | 2012-11-09 | 2013-11-08 | Platelet-derived growth factor B specific antibodies and compositions and uses thereof |
| IL238568A IL238568A0 (en) | 2012-11-09 | 2015-04-30 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261724888P | 2012-11-09 | 2012-11-09 | |
| US61/724,888 | 2012-11-09 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2014072876A1 true WO2014072876A1 (en) | 2014-05-15 |
Family
ID=49955419
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2013/059718 Ceased WO2014072876A1 (en) | 2012-11-09 | 2013-10-28 | Platelet-derived growth factor b specific antibodies and compositions and uses thereof |
Country Status (16)
| Country | Link |
|---|---|
| US (1) | US9428577B2 (en) |
| EP (1) | EP2917237A1 (en) |
| JP (1) | JP2015536339A (en) |
| KR (1) | KR20150082503A (en) |
| CN (1) | CN105026426A (en) |
| AR (1) | AR093394A1 (en) |
| AU (1) | AU2013343099A1 (en) |
| BR (1) | BR112015010722A2 (en) |
| CA (1) | CA2890483A1 (en) |
| HK (1) | HK1216428A1 (en) |
| IL (1) | IL238568A0 (en) |
| MX (1) | MX2015005874A (en) |
| RU (1) | RU2015115956A (en) |
| SG (1) | SG11201503245PA (en) |
| TW (1) | TWI522364B (en) |
| WO (1) | WO2014072876A1 (en) |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105085652A (en) * | 2014-05-16 | 2015-11-25 | 中国人民解放军军事医学科学院生物工程研究所 | Platelet-derived growth factor B mutant, its preparation method and use |
| EP2975056A1 (en) * | 2014-07-17 | 2016-01-20 | Novo Nordisk A/S | Site directed mutagenesis of TREM-1 antibodies for decreasing viscosity |
| WO2016009086A1 (en) * | 2014-07-17 | 2016-01-21 | Novo Nordisk A/S | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| WO2016075037A1 (en) * | 2014-11-10 | 2016-05-19 | F. Hoffmann-La Roche Ag | Bispecific antibodies and methods of use in ophthalmology |
| WO2016075036A1 (en) * | 2014-11-10 | 2016-05-19 | F. Hoffmann-La Roche Ag | Anti-pdgf-b antibodies and methods of use |
| CN105732809A (en) * | 2014-12-31 | 2016-07-06 | 广东众生药业股份有限公司 | Antibodies against platelet-derived factor |
| WO2017030909A1 (en) * | 2015-08-14 | 2017-02-23 | Allergan, Inc. | Heavy chain only antibodies to pdgf |
| CN107849126A (en) * | 2015-07-29 | 2018-03-27 | 阿勒根公司 | The only antibody of anti-ANG 2 of heavy chain |
| US10189904B2 (en) | 2012-02-15 | 2019-01-29 | Novo Nordisk A/S | Antibodies that bind and block triggering receptor expressed on myeloid cells-1 (TREM-1) |
| US10344085B2 (en) | 2014-11-10 | 2019-07-09 | Hoffman-La Roche, Inc. | Anti-IL-1beta antibodies |
| US10538585B2 (en) | 2014-11-10 | 2020-01-21 | Hoffmann-La Roche Inc. | Anti-ANG2 antibodies and methods of use |
| WO2020262576A1 (en) * | 2019-06-28 | 2020-12-30 | Chugai Seiyaku Kabushiki Kaisha | Antigen binding molecules that bind pdgf-b and pdgf-d and uses thereof |
| US11155618B2 (en) | 2018-04-02 | 2021-10-26 | Bristol-Myers Squibb Company | Anti-TREM-1 antibodies and uses thereof |
| WO2022159875A1 (en) * | 2021-01-25 | 2022-07-28 | Regeneron Pharmaceuticals, Inc. | Anti-pdgf-b antibodies and mehods of use for treating pulmonary arterial hypertension (pah) |
| US11976119B2 (en) | 2018-05-25 | 2024-05-07 | Alector Llc | Anti-SIRPa antibodies and methods of use thereof |
| US12226482B2 (en) | 2016-12-09 | 2025-02-18 | Alector Llc | Anti-SIRP-alpha antibodies and methods of use thereof |
| WO2025150482A1 (en) * | 2024-01-08 | 2025-07-17 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules that bind pdgf-b and pdgf-d, and methods of use |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3026061A1 (en) * | 2014-11-26 | 2016-06-01 | Novo Nordisk A/S | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity. |
| CA3029332A1 (en) * | 2016-07-01 | 2018-01-04 | Ludwig Institute For Cancer Research Ltd | Methods and compositions for pdgf-cc inhibition |
| CN109021104B (en) * | 2017-06-12 | 2022-08-12 | 上海睿智化学研究有限公司 | An antibody against human platelet-derived growth factor beta receptor and its application |
| EP4724490A2 (en) | 2023-06-12 | 2026-04-15 | Amgen Inc. | Lymphotoxin beta receptor agonist binding proteins |
Citations (99)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0003089A1 (en) | 1978-01-06 | 1979-07-25 | Bernard David | Drier for silkscreen printed sheets |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4526938A (en) | 1982-04-22 | 1985-07-02 | Imperial Chemical Industries Plc | Continuous release formulations |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4754065A (en) | 1984-12-18 | 1988-06-28 | Cetus Corporation | Precursor to nucleic acid probe |
| GB2200651A (en) | 1987-02-07 | 1988-08-10 | Al Sumidaie Ayad Mohamed Khala | A method of obtaining a retrovirus-containing fraction from retrovirus-containing cells |
| US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4880078A (en) | 1987-06-29 | 1989-11-14 | Honda Giken Kogyo Kabushiki Kaisha | Exhaust muffler |
| EP0345242A2 (en) | 1988-06-03 | 1989-12-06 | Smithkline Biologicals S.A. | Expression of gag proteins from retroviruses in eucaryotic cells |
| WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
| WO1990011092A1 (en) | 1989-03-21 | 1990-10-04 | Vical, Inc. | Expression of exogenous polynucleotide sequences in a vertebrate |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| WO1991002805A2 (en) | 1989-08-18 | 1991-03-07 | Viagene, Inc. | Recombinant retroviruses delivering vector constructs to target cells |
| WO1991005548A1 (en) | 1989-10-10 | 1991-05-02 | Pitman-Moore, Inc. | Sustained release composition for macromolecular proteins |
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| WO1991014445A1 (en) | 1990-03-21 | 1991-10-03 | Research Development Foundation | Heterovesicular liposomes |
| US5128326A (en) | 1984-12-06 | 1992-07-07 | Biomatrix, Inc. | Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same |
| WO1992019244A2 (en) | 1991-05-01 | 1992-11-12 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | A method for treating infectious respiratory diseases |
| WO1992020373A1 (en) | 1991-05-14 | 1992-11-26 | Repligen Corporation | Heteroconjugate antibodies for treatment of hiv infection |
| WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
| WO1993006213A1 (en) | 1991-09-23 | 1993-04-01 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
| WO1993011230A1 (en) | 1991-12-02 | 1993-06-10 | Dynal As | Modified mammalian stem cell blocking viral replication |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| WO1993019191A1 (en) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Defective recombinant adenoviruses expressing cytokines for use in antitumoral treatment |
| WO1993025698A1 (en) | 1992-06-10 | 1993-12-23 | The United States Government As Represented By The | Vector particles resistant to inactivation by human serum |
| WO1993025234A1 (en) | 1992-06-08 | 1993-12-23 | The Regents Of The University Of California | Methods and compositions for targeting specific tissue |
| US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
| WO1994003622A1 (en) | 1992-07-31 | 1994-02-17 | Imperial College Of Science, Technology & Medicine | D-type retroviral vectors, based on mpmv |
| WO1994004690A1 (en) | 1992-08-17 | 1994-03-03 | Genentech, Inc. | Bispecific immunoadhesins |
| WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
| WO1994023697A1 (en) | 1993-04-22 | 1994-10-27 | Depotech Corporation | Cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
| WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| WO1995007994A2 (en) | 1993-09-15 | 1995-03-23 | Viagene, Inc. | Recombinant alphavirus vectors |
| WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| WO1995013796A1 (en) | 1993-11-16 | 1995-05-26 | Depotech Corporation | Vesicles with controlled release of actives |
| US5422120A (en) | 1988-05-30 | 1995-06-06 | Depotech Corporation | Heterovesicular liposomes |
| WO1995030763A2 (en) | 1994-05-09 | 1995-11-16 | Chiron Viagene, Inc. | Retroviral vectors having a reduced recombination rate |
| US5510261A (en) | 1991-11-21 | 1996-04-23 | The Board Of Trustees Of The Leland Stanford Juniot University | Method of controlling the degradation of glycoprotein oligosaccharides produced by cultured Chinese hamster ovary cells |
| WO1996017072A2 (en) | 1994-11-30 | 1996-06-06 | Chiron Viagene, Inc. | Recombinant alphavirus vectors |
| WO1996020698A2 (en) | 1995-01-05 | 1996-07-11 | The Board Of Regents Acting For And On Behalf Of The University Of Michigan | Surface-modified nanoparticles and method of making and using same |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| WO1997032572A2 (en) | 1996-03-04 | 1997-09-12 | The Penn State Research Foundation | Materials and methods for enhancing cellular internalization |
| US5679377A (en) | 1989-11-06 | 1997-10-21 | Alkermes Controlled Therapeutics, Inc. | Protein microspheres and methods of using them |
| WO1997042338A1 (en) | 1996-05-06 | 1997-11-13 | Chiron Corporation | Crossless retroviral vectors |
| WO1997044013A1 (en) | 1996-05-24 | 1997-11-27 | Massachusetts Institute Of Technology | Aerodynamically light particles for pulmonary drug delivery |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1998031346A1 (en) | 1997-01-16 | 1998-07-23 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5814482A (en) | 1993-09-15 | 1998-09-29 | Dubensky, Jr.; Thomas W. | Eukaryotic layered vector initiation systems |
| US5855913A (en) | 1997-01-16 | 1999-01-05 | Massachusetts Instite Of Technology | Particles incorporating surfactants for pulmonary drug delivery |
| US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
| US5885573A (en) | 1993-06-01 | 1999-03-23 | Arch Development Corporation | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| WO1999015154A1 (en) | 1997-09-24 | 1999-04-01 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release preparations |
| WO1999020253A1 (en) | 1997-10-23 | 1999-04-29 | Bioglan Therapeutics Ab | Encapsulation method |
| US5912015A (en) | 1992-03-12 | 1999-06-15 | Alkermes Controlled Therapeutics, Inc. | Modulated release from biocompatible polymers |
| US5916597A (en) | 1995-08-31 | 1999-06-29 | Alkermes Controlled Therapeutics, Inc. | Composition and method using solid-phase particles for sustained in vivo release of a biologically active agent |
| US5934272A (en) | 1993-01-29 | 1999-08-10 | Aradigm Corporation | Device and method of creating aerosolized mist of respiratory drug |
| US5985309A (en) | 1996-05-24 | 1999-11-16 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
| WO1999066903A2 (en) | 1998-06-24 | 1999-12-29 | Advanced Inhalation Research, Inc. | Large porous particles emitted from an inhaler |
| US6019968A (en) | 1995-04-14 | 2000-02-01 | Inhale Therapeutic Systems, Inc. | Dispersible antibody compositions and methods for their preparation and use |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2001005950A2 (en) | 1999-07-20 | 2001-01-25 | Morphosys Ag | Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| US6316024B1 (en) | 1996-10-11 | 2001-11-13 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| US6350466B1 (en) | 1994-08-05 | 2002-02-26 | Targesome, Inc. | Targeted polymerized liposome diagnostic and treatment agents |
| US6376471B1 (en) | 1997-10-10 | 2002-04-23 | Johns Hopkins University | Gene delivery compositions and methods |
| US6413942B1 (en) | 1989-03-21 | 2002-07-02 | Vical, Inc. | Methods of delivering a physiologically active polypeptide to a mammal |
| US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| WO2004058184A2 (en) | 2002-12-24 | 2004-07-15 | Rinat Neuroscience Corp. | Anti-ngf antibodies and methods using same |
| US20060024298A1 (en) | 2002-09-27 | 2006-02-02 | Xencor, Inc. | Optimized Fc variants |
| US20060121032A1 (en) | 2003-03-03 | 2006-06-08 | Xencor, Inc. | Optimized anti-CD20 monoclonal antibodies having Fc variants |
| WO2006105338A2 (en) | 2005-03-31 | 2006-10-05 | Xencor, Inc. | Fc VARIANTS WITH OPTIMIZED PROPERTIES |
| US20060235208A1 (en) | 2002-09-27 | 2006-10-19 | Xencor, Inc. | Fc variants with optimized properties |
| US20070148170A1 (en) | 2005-10-03 | 2007-06-28 | Desjarlais John R | Fc Variants With Optimized Fc Receptor Binding Properties |
| US7314622B2 (en) | 2005-04-15 | 2008-01-01 | Neogenix Oncology, Inc. | Recombinant monoclonal antibodies and corresponding antigens for colon and pancreatic cancers |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2008022152A2 (en) | 2006-08-14 | 2008-02-21 | Xencor, Inc. | Optimized antibodies that target cd19 |
| WO2008150494A1 (en) | 2007-05-30 | 2008-12-11 | Xencor, Inc. | Methods and compositions for inhibiting cd32b expressing cells |
| WO2010033736A1 (en) | 2008-09-17 | 2010-03-25 | Xencor, Inc. | Novel compositons and methods for treating ige-mediated disorders |
| US7888486B2 (en) | 2005-08-19 | 2011-02-15 | Wyeth Llc | Antagonist antibodies against GDF-8 |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ATE529750T1 (en) * | 2005-07-28 | 2011-11-15 | Vittorio Enrico Avvedimento | STIMULATORY AUTOANTIBODIES AGAINST THE PDGF RECEPTOR AS A PATHOLOGICAL MARKER AND THERAPEUTIC TARGET |
| CL2007002225A1 (en) * | 2006-08-03 | 2008-04-18 | Astrazeneca Ab | SPECIFIC UNION AGENT FOR A RECEIVER OF THE GROWTH FACTOR DERIVED FROM PLATES (PDGFR-ALFA); NUCLEIC ACID MOLECULA THAT CODIFIES IT; VECTOR AND CELL GUESTS THAT UNDERSTAND IT; CONJUGADO UNDERSTANDING THE AGENT; AND USE OF THE AGENT OF A |
-
2013
- 2013-10-28 CA CA2890483A patent/CA2890483A1/en not_active Abandoned
- 2013-10-28 SG SG11201503245PA patent/SG11201503245PA/en unknown
- 2013-10-28 CN CN201380068100.1A patent/CN105026426A/en active Pending
- 2013-10-28 WO PCT/IB2013/059718 patent/WO2014072876A1/en not_active Ceased
- 2013-10-28 JP JP2015541262A patent/JP2015536339A/en active Pending
- 2013-10-28 KR KR1020157014869A patent/KR20150082503A/en not_active Ceased
- 2013-10-28 MX MX2015005874A patent/MX2015005874A/en unknown
- 2013-10-28 HK HK16104404.4A patent/HK1216428A1/en unknown
- 2013-10-28 RU RU2015115956A patent/RU2015115956A/en not_active Application Discontinuation
- 2013-10-28 EP EP13820911.9A patent/EP2917237A1/en not_active Withdrawn
- 2013-10-28 BR BR112015010722A patent/BR112015010722A2/en not_active Application Discontinuation
- 2013-10-28 AU AU2013343099A patent/AU2013343099A1/en not_active Abandoned
- 2013-11-06 TW TW102140293A patent/TWI522364B/en not_active IP Right Cessation
- 2013-11-07 AR ARP130104081A patent/AR093394A1/en unknown
- 2013-11-08 US US14/075,755 patent/US9428577B2/en not_active Expired - Fee Related
-
2015
- 2015-04-30 IL IL238568A patent/IL238568A0/en unknown
Patent Citations (108)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0003089A1 (en) | 1978-01-06 | 1979-07-25 | Bernard David | Drier for silkscreen printed sheets |
| US4526938A (en) | 1982-04-22 | 1985-07-02 | Imperial Chemical Industries Plc | Continuous release formulations |
| US4522811A (en) | 1982-07-08 | 1985-06-11 | Syntex (U.S.A.) Inc. | Serial injection of muramyldipeptides and liposomes enhances the anti-infective activity of muramyldipeptides |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US6331415B1 (en) | 1983-04-08 | 2001-12-18 | Genentech, Inc. | Methods of producing immunoglobulins, vectors and transformed host cells for use therein |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5128326A (en) | 1984-12-06 | 1992-07-07 | Biomatrix, Inc. | Drug delivery systems based on hyaluronans derivatives thereof and their salts and methods of producing same |
| US4754065A (en) | 1984-12-18 | 1988-06-28 | Cetus Corporation | Precursor to nucleic acid probe |
| US4683202B1 (en) | 1985-03-28 | 1990-11-27 | Cetus Corp | |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US5399331A (en) | 1985-06-26 | 1995-03-21 | The Liposome Company, Inc. | Method for protein-liposome coupling |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4683195B1 (en) | 1986-01-30 | 1990-11-27 | Cetus Corp | |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| US4800159A (en) | 1986-02-07 | 1989-01-24 | Cetus Corporation | Process for amplifying, detecting, and/or cloning nucleic acid sequences |
| US5374548A (en) | 1986-05-02 | 1994-12-20 | Genentech, Inc. | Methods and compositions for the attachment of proteins to liposomes using a glycophospholipid anchor |
| GB2200651A (en) | 1987-02-07 | 1988-08-10 | Al Sumidaie Ayad Mohamed Khala | A method of obtaining a retrovirus-containing fraction from retrovirus-containing cells |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US4880078A (en) | 1987-06-29 | 1989-11-14 | Honda Giken Kogyo Kabushiki Kaisha | Exhaust muffler |
| US5422120A (en) | 1988-05-30 | 1995-06-06 | Depotech Corporation | Heterovesicular liposomes |
| EP0345242A2 (en) | 1988-06-03 | 1989-12-06 | Smithkline Biologicals S.A. | Expression of gag proteins from retroviruses in eucaryotic cells |
| US5047335A (en) | 1988-12-21 | 1991-09-10 | The Regents Of The University Of Calif. | Process for controlling intracellular glycosylation of proteins |
| WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
| US5580859A (en) | 1989-03-21 | 1996-12-03 | Vical Incorporated | Delivery of exogenous DNA sequences in a mammal |
| WO1990011092A1 (en) | 1989-03-21 | 1990-10-04 | Vical, Inc. | Expression of exogenous polynucleotide sequences in a vertebrate |
| US6413942B1 (en) | 1989-03-21 | 2002-07-02 | Vical, Inc. | Methods of delivering a physiologically active polypeptide to a mammal |
| US5416016A (en) | 1989-04-03 | 1995-05-16 | Purdue Research Foundation | Method for enhancing transmembrane transport of exogenous molecules |
| WO1991000360A1 (en) | 1989-06-29 | 1991-01-10 | Medarex, Inc. | Bispecific reagents for aids therapy |
| WO1991002805A2 (en) | 1989-08-18 | 1991-03-07 | Viagene, Inc. | Recombinant retroviruses delivering vector constructs to target cells |
| WO1991005548A1 (en) | 1989-10-10 | 1991-05-02 | Pitman-Moore, Inc. | Sustained release composition for macromolecular proteins |
| US5679377A (en) | 1989-11-06 | 1997-10-21 | Alkermes Controlled Therapeutics, Inc. | Protein microspheres and methods of using them |
| EP0524968A1 (en) | 1990-03-21 | 1993-02-03 | Res Dev Foundation | LIPOSOMES CONTAINING A NON-UNIFORM BUBBLE. |
| WO1991014445A1 (en) | 1990-03-21 | 1991-10-03 | Research Development Foundation | Heterovesicular liposomes |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5278299A (en) | 1991-03-18 | 1994-01-11 | Scripps Clinic And Research Foundation | Method and composition for synthesizing sialylated glycosyl compounds |
| US5290540A (en) | 1991-05-01 | 1994-03-01 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | Method for treating infectious respiratory diseases |
| WO1992019244A2 (en) | 1991-05-01 | 1992-11-12 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | A method for treating infectious respiratory diseases |
| WO1992020373A1 (en) | 1991-05-14 | 1992-11-26 | Repligen Corporation | Heteroconjugate antibodies for treatment of hiv infection |
| US5997867A (en) | 1991-07-16 | 1999-12-07 | Waldmann; Herman | Method of using humanized antibody against CD18 |
| WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
| US5866692A (en) | 1991-09-18 | 1999-02-02 | Kyowa Hakko Kogyo Co., Ltd. | Process for producing humanized chimera antibody |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993006213A1 (en) | 1991-09-23 | 1993-04-01 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
| US5510261A (en) | 1991-11-21 | 1996-04-23 | The Board Of Trustees Of The Leland Stanford Juniot University | Method of controlling the degradation of glycoprotein oligosaccharides produced by cultured Chinese hamster ovary cells |
| WO1993011230A1 (en) | 1991-12-02 | 1993-06-10 | Dynal As | Modified mammalian stem cell blocking viral replication |
| US5912015A (en) | 1992-03-12 | 1999-06-15 | Alkermes Controlled Therapeutics, Inc. | Modulated release from biocompatible polymers |
| WO1993019191A1 (en) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Defective recombinant adenoviruses expressing cytokines for use in antitumoral treatment |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1993025234A1 (en) | 1992-06-08 | 1993-12-23 | The Regents Of The University Of California | Methods and compositions for targeting specific tissue |
| WO1993025698A1 (en) | 1992-06-10 | 1993-12-23 | The United States Government As Represented By The | Vector particles resistant to inactivation by human serum |
| WO1994003622A1 (en) | 1992-07-31 | 1994-02-17 | Imperial College Of Science, Technology & Medicine | D-type retroviral vectors, based on mpmv |
| WO1994004690A1 (en) | 1992-08-17 | 1994-03-03 | Genentech, Inc. | Bispecific immunoadhesins |
| WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
| US5934272A (en) | 1993-01-29 | 1999-08-10 | Aradigm Corporation | Device and method of creating aerosolized mist of respiratory drug |
| WO1994023697A1 (en) | 1993-04-22 | 1994-10-27 | Depotech Corporation | Cyclodextrin liposomes encapsulating pharmacologic compounds and methods for their use |
| US5885573A (en) | 1993-06-01 | 1999-03-23 | Arch Development Corporation | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
| WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
| US5814482A (en) | 1993-09-15 | 1998-09-29 | Dubensky, Jr.; Thomas W. | Eukaryotic layered vector initiation systems |
| WO1995007994A2 (en) | 1993-09-15 | 1995-03-23 | Viagene, Inc. | Recombinant alphavirus vectors |
| WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
| WO1995013796A1 (en) | 1993-11-16 | 1995-05-26 | Depotech Corporation | Vesicles with controlled release of actives |
| WO1995030763A2 (en) | 1994-05-09 | 1995-11-16 | Chiron Viagene, Inc. | Retroviral vectors having a reduced recombination rate |
| US6350466B1 (en) | 1994-08-05 | 2002-02-26 | Targesome, Inc. | Targeted polymerized liposome diagnostic and treatment agents |
| WO1996017072A2 (en) | 1994-11-30 | 1996-06-06 | Chiron Viagene, Inc. | Recombinant alphavirus vectors |
| WO1996020698A2 (en) | 1995-01-05 | 1996-07-11 | The Board Of Regents Acting For And On Behalf Of The University Of Michigan | Surface-modified nanoparticles and method of making and using same |
| US6019968A (en) | 1995-04-14 | 2000-02-01 | Inhale Therapeutic Systems, Inc. | Dispersible antibody compositions and methods for their preparation and use |
| US6436908B1 (en) | 1995-05-30 | 2002-08-20 | Duke University | Use of exogenous β-adrenergic receptor and β-adrenergic receptor kinase gene constructs to enhance myocardial function |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| US5916597A (en) | 1995-08-31 | 1999-06-29 | Alkermes Controlled Therapeutics, Inc. | Composition and method using solid-phase particles for sustained in vivo release of a biologically active agent |
| US5985320A (en) | 1996-03-04 | 1999-11-16 | The Penn State Research Foundation | Materials and methods for enhancing cellular internalization |
| WO1997032572A2 (en) | 1996-03-04 | 1997-09-12 | The Penn State Research Foundation | Materials and methods for enhancing cellular internalization |
| WO1997042338A1 (en) | 1996-05-06 | 1997-11-13 | Chiron Corporation | Crossless retroviral vectors |
| US5874064A (en) | 1996-05-24 | 1999-02-23 | Massachusetts Institute Of Technology | Aerodynamically light particles for pulmonary drug delivery |
| US5985309A (en) | 1996-05-24 | 1999-11-16 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| WO1997044013A1 (en) | 1996-05-24 | 1997-11-27 | Massachusetts Institute Of Technology | Aerodynamically light particles for pulmonary drug delivery |
| US6316024B1 (en) | 1996-10-11 | 2001-11-13 | Sequus Pharmaceuticals, Inc. | Therapeutic liposome composition and method of preparation |
| US5855913A (en) | 1997-01-16 | 1999-01-05 | Massachusetts Instite Of Technology | Particles incorporating surfactants for pulmonary drug delivery |
| WO1998031346A1 (en) | 1997-01-16 | 1998-07-23 | Massachusetts Institute Of Technology | Preparation of particles for inhalation |
| US5989463A (en) | 1997-09-24 | 1999-11-23 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release devices |
| WO1999015154A1 (en) | 1997-09-24 | 1999-04-01 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release preparations |
| US6376471B1 (en) | 1997-10-10 | 2002-04-23 | Johns Hopkins University | Gene delivery compositions and methods |
| WO1999020253A1 (en) | 1997-10-23 | 1999-04-29 | Bioglan Therapeutics Ab | Encapsulation method |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| WO1999066903A2 (en) | 1998-06-24 | 1999-12-29 | Advanced Inhalation Research, Inc. | Large porous particles emitted from an inhaler |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| WO2000042072A2 (en) | 1999-01-15 | 2000-07-20 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| WO2001005950A2 (en) | 1999-07-20 | 2001-01-25 | Morphosys Ag | Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| US20060235208A1 (en) | 2002-09-27 | 2006-10-19 | Xencor, Inc. | Fc variants with optimized properties |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| US20060024298A1 (en) | 2002-09-27 | 2006-02-02 | Xencor, Inc. | Optimized Fc variants |
| WO2004058184A2 (en) | 2002-12-24 | 2004-07-15 | Rinat Neuroscience Corp. | Anti-ngf antibodies and methods using same |
| US20060121032A1 (en) | 2003-03-03 | 2006-06-08 | Xencor, Inc. | Optimized anti-CD20 monoclonal antibodies having Fc variants |
| WO2006105338A2 (en) | 2005-03-31 | 2006-10-05 | Xencor, Inc. | Fc VARIANTS WITH OPTIMIZED PROPERTIES |
| US7314622B2 (en) | 2005-04-15 | 2008-01-01 | Neogenix Oncology, Inc. | Recombinant monoclonal antibodies and corresponding antigens for colon and pancreatic cancers |
| US7888486B2 (en) | 2005-08-19 | 2011-02-15 | Wyeth Llc | Antagonist antibodies against GDF-8 |
| US20070148170A1 (en) | 2005-10-03 | 2007-06-28 | Desjarlais John R | Fc Variants With Optimized Fc Receptor Binding Properties |
| WO2008022152A2 (en) | 2006-08-14 | 2008-02-21 | Xencor, Inc. | Optimized antibodies that target cd19 |
| WO2008150494A1 (en) | 2007-05-30 | 2008-12-11 | Xencor, Inc. | Methods and compositions for inhibiting cd32b expressing cells |
| WO2010033736A1 (en) | 2008-09-17 | 2010-03-25 | Xencor, Inc. | Novel compositons and methods for treating ige-mediated disorders |
Non-Patent Citations (234)
| Title |
|---|
| "Animal Cell Culture", 1987 |
| "Antibodies: a practical approach", 1988, IRL PRESS |
| "Cancer Chemotherapy and Biotherapy", 2001, LIPPINCOTT, WILLIAMS AND WILKINS |
| "Cell and Tissue Culture: Laboratory Procedures", 1993, J. WILEY AND SONS |
| "Cell Biology: A Laboratory Notebook", 1998, ACADEMIC PRESS |
| "Controlled Drug Bioavailability, Drug Product Design and Performance", 1984, WILEY |
| "Current Protocols in Immunology", 1991 |
| "Current Protocols in Molecular Biology", 1987 |
| "Gene Transfer Vectors for Mammalian Cells", 1987 |
| "Goodman and Gilman's The Pharmacological Basis of Therapeutics", 2001, MCGRAW-HILL |
| "Handbook of Experimental Immunology" |
| "Medical Applications of Controlled Release", 1974, CRC PRES. |
| "Methods in Enzymology", ACADEMIC PRESS, INC. |
| "Methods in Molecular Biology", HUMANA PRESS |
| "Monoclonal Antibodies and Peptide Therapy in Autoimmune Diseases", 1993, MARCEL DEKKER |
| "Monoclonal Antibodies, Cytokines and Arthritis", 1991, MARCEL DEKKER |
| "Monoclonal antibodies: a practical approach", 2000, OXFORD UNIVERSITY PRESS |
| "Oligonucleotide Synthesis", 1984 |
| "PCR: The Polymerase Chain Reaction", 1994 |
| "PCR: The Polymerase Chain Reaction", 1994, BIRKAUSWER PRESS |
| "Pharmaceutical Dosage Forms: Disperse Systems", 1990, MARCEL DEKKER |
| "Pharmaceutical Dosage Forms: Parenteral Medications", 1993, MARCEL DEKKER |
| "Pharmaceutical Dosage Forms: Tablets", 1990, MARCEL DEKKER |
| "Pharmacotherapeutics for Advanced Practice: A Practical Approach", 2001, LIPPINCOTT, WILLIAMS AND WILKINS |
| "Radiolabeled Monoclonal Antibodies For Imaging And Therapy", 1988, PLENUM PRESS |
| "Remington, The Science and Practice of Pharmacy", 2000, MACK PUBLISHING |
| "Remington: The Science and practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS AND WILKINS |
| "Remington's Pharmaceutical Sciences and Introduction to Pharmaceutical Dosage Forms", 1995, MACK PUB. CO. |
| "Remington's Pharmaceutical Sciences", 1985, MACK PUBLISHING CO. |
| "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO. |
| "Short Protocols in Molecular Biology", 1999, WILEY AND SONS |
| "The Antibodies", 1995, HARWOOD ACADEMIC PUBLISHERS |
| A, Q, K; H. SEE, TAO ET AL., J. IMMUNOLOGY, vol. 143, 1989, pages 2595 - 2601 |
| AALBERSE ET AL., IMMUNOLOGY, vol. 105, 2002, pages 9 - 19 |
| ANDRAE ET AL., GENES DEV., vol. 22, 2008, pages 1276 - 1312 |
| ARMOUR ET AL., EUR. J. IMMUNOL., vol. 29, no. 8, 1999, pages 2613 - 2624 |
| ARMOUR ET AL., MOLECULAR IMMUNOLOGY, vol. 40, 2003, pages 585 - 593 |
| ARUNKLAKSHANA; SCHILD, BR. J. PHARMACOL., vol. 65, 1959, pages 48 - 58 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 2002, JOHN WILEY & SONS |
| BAERT ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 601 - 608 |
| BALINT ET AL., GENE, vol. 137, no. 1, 1993, pages 109 - 18 |
| BARBAS ET AL., PROC NAT. ACAD. SCI, USA, vol. 91, 1994, pages 3809 - 3813 |
| BENIAMINOVITZ ET AL., NEW ENGL. J. MED., vol. 342, 2000, pages 613 - 619 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BONNER, JC, CYTOKINE GROWTH FACTOR REV., vol. 15, 2004, pages 255 - 273 |
| BOOR ET AL., NEPHROL. DIAL. TRANSPLANT., vol. 22, 2007, pages 1323 - 1331 |
| BORKHAM ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 321, 2004, pages 413 - 423 |
| BORKHAM ET AL., LAB. INVEST., vol. 84, 2004, pages 766 - 777 |
| BOYD ET AL., MOL. IMMUNOL., vol. 32, 1996, pages 1311 - 1318 |
| BRISCOE ET AL., AM. J. PHYSIOL., vol. 1233, 1995, pages 134 |
| BROWN ET AL.: "Biotechnology and Pharmacy", 1993, CHAPMAN AND HALL, article "Clinical Use of Monoclonal Antibodies", pages: 227 - 249 |
| BUCHWALD ET AL., SURGERY, vol. 88, 1980, pages 501 |
| BUCK, D. W. ET AL., IN VITRO, vol. 18, 1982, pages 377 - 381 |
| C.A. JANEWAY; P. TRAVERS, IMMUNOBIOLOGY, 1997 |
| CACECI ET AL., BYTE, vol. 9, 1984, pages 340 - 362 |
| CAPEL ET AL., IMMUNOMETHODS, vol. 4, 1994, pages 25 - 34 |
| CHASE ET AL.: "Remington's Pharmaceutical Sciences", 1990, MACK PUBLISHING CO., article "Medical Applications of Radioisotopes", pages: 624 - 652 |
| CHAUDHRI ET AL., J. PHYS. CHEM. B, vol. 117, no. 5, 2013, pages 1269 - 1279 |
| CHIOU ET AL.: "Gene Therapeutics: Methods And Applications Of Direct Gene Transfer", 1994 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1986, pages 901 - 17 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 83 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, no. 4, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CLEEK; AH: "Biodegradable Polymeric Carriers for a bFGF Antibody for Cardiovascular Application", PRO. MI. SYMP. CONTROL. REL. BIOACT. MATER., vol. 24, 1997, pages 853 - 854 |
| COLIGAN ET AL.: "Short Protocols in Protein Science", 2003, JOHN WILEY & SONS |
| CONNELLY, HUMAN GENE THERAPY, vol. 1, 1995, pages 185 |
| COX ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 827 - 836 |
| CURIEL, HUM. GENE THER., vol. 3, 1992, pages 147 |
| CZOCHRA ET AL., J. HEPATOL., vol. 45, 2006, pages 419 - 28 |
| D.G. MYSZKA ET AL., J. MOL. RECOGNIT, vol. 12, 1999, pages 279 |
| DAYHOFF, M.O.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, NATIONAL BIOMEDICAL RESEARCH FOUNDATION, article "A model of evolutionary change in proteins - Matrices for detecting distant relationships", pages: 345 - 358 |
| DE HAAS ET AL., J. LAB. CLIN. MED., vol. 126, 1995, pages 330 - 41 |
| DURING ET AL., ANN. NEUROL., vol. 25, pages 351 |
| E. HARLOW; D. LANE: "Using antibodies: a laboratory manual", 1999, COLD SPRING HARBOR LABORATORY PRESS |
| EDELHOCH H., BIOCHEMISTRY, vol. 6, 1967, pages 1948 - 1954 |
| EPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 3692 |
| EUR. J. IMMUNOL., vol. 29, 1999, pages 2613 - 2624 |
| FINDEIS ET AL., TRENDS BIOTECHNOL., vol. 11, 1993, pages 202 |
| FLOEGE ET AL., AM. J. PATHOL., vol. 154, 1999, pages 169 - 179 |
| FLOEGE ET AL., CLIN. EXP. IMMUNOL., vol. 86, 1991, pages 334 - 341 |
| FLOEGE ET AL., J. CLIN. INVEST., vol. 92, 1993, pages 2952 - 2962 |
| FRIGUET ET AL., J. IMMUNOL. METHODS, vol. 77, 1985, pages 305 - 319 |
| GENNARO: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS, AND WILKINS |
| GHOSH ET AL., NEW ENGL. J. MED., vol. 348, 2003, pages 24 - 32 |
| GILBERT ET AL., KIDNEY INT., vol. 59, 2001, pages 1324 - 1332 |
| GOODSON, MEDICAL APPLICATIONS OF CONTROLLED RELEASE, vol. 2, 1984, pages 115 - 138 |
| GRAPPONE ET AL., J. HEPATOL., vol. 31, 1999, pages 100 - 109 |
| GRIFFITH ET AL., EMBO J., vol. 12, 1993, pages 725 - 734 |
| GROSSMAN, UROL. CLIN. NORTH AMER., vol. 13, 1986, pages 465 - 474 |
| GUYER ET AL., J. IMMUNOL., vol. 117, 1976, pages 587 |
| HAENEL ET AL., ANAL. BIOCHEM., vol. 339, 2005, pages 182 - 184 |
| HARDMAN ET AL.: "Goodman and Gilman's The Pharmacological Basis of Therapeutics", 2001, MCGRAW-HILL |
| HARLOW; LANE: "Using Antibodies, a Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS, COLD SPRING HARBOR |
| HARLOW; LANE: "Using Antibodies: A Laboratory Manual", 1998, COLD SPRING HARBOR LABORATORY PRESS, COLD SPRING HARBOR |
| HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896 |
| HEIN J.: "Methods in Enzymology", vol. 183, 1990, ACADEMIC PRESS, INC., article "Unified Approach to Alignment and Phylogenes", pages: 626 - 645 |
| HELDIN; WESTERMARK, PHYSIOLOGICAL REVS., vol. 79, no. 4, 1999, pages 1238 - 1316 |
| HEROLD ET AL., NEW ENGL. J. MED., vol. 346, 2002, pages 1692 - 1698 |
| HIGGINS, D.G.; SHARP, P.M., CABIOS, vol. 5, 1989, pages 151 - 153 |
| HOLLIGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLIGER, P. ET AL., PROC. NATL. ACAD SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOWARD ET AL., J. NEUROSURG., vol. 71, 1989, pages 105 |
| HSE ET AL., J. BIOL. CHEM., vol. 272, 1997, pages 9062 - 9070 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| HWANG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4030 - 4034 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 164, no. 8, 2000, pages 4178 - 4184 |
| IDUSOGIE ET AL., J. IMMUNOL., vol. 166, no. 4, 2001, pages 2571 - 2575 |
| IDUSOGIE ET AL., J. IMMUNOLOGY, vol. 164, 2000, pages 4178 - 4184 |
| III ET AL., PROTEIN ENG., vol. 10, 1997, pages 949 - 57 |
| IKURA ET AL., J GASTROENTEROL., vol. 32, 1997, pages 496 - 501 |
| ISAKA ET AL., J. CLIN. INVEST., vol. 92, 1993, pages 2597 - 2601 |
| J.P. MATHER; P.E. ROBERTS: "Introduction to Cell and Tissue Culture", 1998, PLENUM PRESS |
| JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, 1995, pages 3310 - 9 |
| JEFFERIS ET AL., IMMUNOLOGICAL REVIEWS, vol. 163, 1998, pages 59 - 76 |
| JEFFERIS; LUND, CHEM. IMMUNOL., vol. 65, 1997, pages 111 - 128 |
| JOHNSON, KEVIN S; CHISWELL, DAVID J., CURRENT OPINION IN STRUCTURAL BIOLOGY, vol. 3, 1993, pages 564 - 571 |
| JOHNSON; WU, NUCLEIC ACIDS RES., vol. 28, 2000, pages 214 - 8 |
| JOLLY, CANCER GENE THERAPY, vol. 1, 1994, pages 51 |
| K. KEINANEN; M.L. LAUKKANEN, FEBS LETT., vol. 346, 1994, pages 123 |
| KABAT, E. A ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES, NIH PUBLICATION NO. 91-3242 |
| KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES, NIH PUBLICATION NO. 91-3242 |
| KAPLITT, NATURE GENETICS, vol. 6, 1994, pages 148 |
| KARLSSON ET AL., METHODS: A COMPANION TO METHODS IN ENZYMOLOGY, vol. 6, 1994, pages 99 - 110 |
| KETCHEM ET AL.: "Modification of Protein Viscosity by Modification of Protein Surface Charge", PEGS SYMPOSIUM, 2012 |
| KHAW ET AL., SCIENCE, vol. 209, 1980, pages 295 - 297 |
| KILLION; FIDLER, IMMUNOMETHODS, vol. 4, 1994, pages 273 |
| KIM ET AL., J. IMMUNOL., vol. 24, 1994, pages 249 |
| KIMURA, HUMAN GENE THERAPY, vol. 5, 1994, pages 845 |
| KINNMAN ET AL., LAB. INVEST., vol. 80, 2000, pages 697 - 707 |
| KINNMAN ET AL., LAB. INVEST., vol. 81, 2001, pages 1709 - 1716 |
| KINNMAN ET AL., LAB. INVEST., vol. 83, 2003, pages 163 - 173 |
| KNAPPIK ET AL., J MOL BIOL, vol. 296, 2000, pages 57 - 86 |
| KOHLER, B.; MILSTEIN, C., NATURE, vol. 256, 1975, pages 495 - 497 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553 |
| LAIMER ET AL., NATURE MED., vol. 18, no. 11, 2012, pages 1699 - 1704 |
| LAM ET AL.: "Microencapsulation of Recombinant Humanized Monoclonal Antibody for Local Delivery", PROC. MI. SYMP. CONTROL REL. BIOACT. MATER., vol. 24, 1997, pages 759 - 160 |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533 |
| LAZAR ET AL., PROC. NATL. ACAD. SCI. USA, vol. 103, no. 11, 2006, pages 4005 - 4010 |
| LEVEEN ET AL., GENES DEV., vol. 8, 1994, pages 1875 - 1887 |
| LEVY ET AL., SCIENCE, vol. 11, no. 225, 1985, pages 190 |
| LIPSKY ET AL., NEW ENGL. J. MED., vol. 343, 2000, pages 1594 - 1602 |
| LIU ET AL., J. NEUROL. NEUROSURG. PSYCH., vol. 67, 1999, pages 451 - 456 |
| LUND ET AL., J. IMMUNOLOGY, vol. 157, 1996, pages 4963 - 9 |
| M. OWAI ET AL., ANTIMICROB. AGENTS CHEMOTHER., vol. 39, 1995, pages 180 |
| MACCALLUM ET AL., J. MOL. BIOL., vol. 5, 1996, pages 732 - 45 |
| MAKABE ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 283, 2008, pages 1156 - 1166 |
| MARK ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MARKS ET AL., BIO/TECHNOL., vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., BIO/TECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MARTIN ET AL., EMBO J., vol. 13, 1994, pages 5303 - 9 |
| MARTIN ET AL., PROC NATL ACAD SCI (USA, vol. 86, 1989, pages 9268 - 9272 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MILGROM ET AL., NEW ENGL. J. MED., vol. 341, 1999, pages 1966 - 1973 |
| MILLSTEIN; CUELLO, NATURE, vol. 305, 1983, pages 537 - 539 |
| MORGAN ET AL., IMMUNOLOGY, vol. 86, 1995, pages 319 - 324 |
| MORRISON ET AL., PROC. NAT. ACAD. SCI., vol. 81, 1984, pages 6851 |
| MYERS, E.W.; MULLER W., CABIOS, vol. 4, 1988, pages 11 - 17 |
| NAKAMURA ET AL., KIDNEY INT., vol. 59, 2001, pages 2134 - 2145 |
| NEEF ET AL., J. HEPATOL., vol. 44, 2006, pages 167 - 175 |
| NING ET AL.: "Intratumoral Radioimmunotheraphy of a Human Colon Cancer Xenograft Using a Sustained-Release Gel", RADIOTHERAPY AND ONCOLOGY, vol. 59, 1996, pages 179 - 189 |
| OGAWA ET AL., HEPATOL. RES., vol. 40, 2010, pages 1128 - 1141 |
| OGAWA ET AL., HEPATOLOGY RES., vol. 40, 2010, pages 1128 - 1141 |
| OGAWA SHINJI ET AL: "Anti-PDGF-B monoclonal antibody reduces liver fibrosis development", HEPATOLOGY RESEARCH, vol. 40, no. 11, November 2010 (2010-11-01), pages 1128 - 1141, XP002721268, ISSN: 1386-6346, DOI: 10.1111/J.1872-034X.2010.00718.X * |
| OSTENDORF ET AL., J. AM. SOC. NEPHROL., vol. 12, 2001, pages 909 - 918 |
| OSTENDORF ET AL., PEDIATRIC NEPHROL., vol. 27, 2012, pages 1041 - 1050 |
| P. FINCH, ANTIBODIES, 1997 |
| P. G. BLOEMAN ET AL., FEBS LETT., vol. 357, 1995, pages 140 |
| PACE ET AL., PROTEIN SCI., vol. 4, 1995, pages 2411 - 2423 |
| PHILIP, MOL. CELL BIOL., vol. 14, 1994, pages 2411 |
| POLJAK ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| POLJAK, R. J. ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 1123 |
| PONDER: "Mammalian Development: A Practical Approach", 1987, IRL PRESS, article "Cell Marking Techniques and Their Application", pages: 115 - 138 |
| PORTIELJI ET AL., CANCER. IMMUNOL. IMMUNOTHER., vol. 52, 2003, pages 133 - 144 |
| PRESTA ET AL., BIOCHEM. SOC. TRANS., vol. 30, 2002, pages 487 - 490 |
| RANGER; PEPPAS, J., MACROMOL. SCL REV. MACROMOL. CHEM., vol. 23, 1983, pages 61 |
| RAVETCH; KINET, ANN. REV. IMMUNOL., vol. 9, 1991, pages 457 - 92 |
| RICHARDS ET AL., MOL. CANCER THER., vol. 7, no. 8, 2008, pages 2517 - 2527 |
| ROBINSON, E.D, COMB. THEOR., vol. 11, 1971, pages 105 |
| RYAN ET AL., MOL. CANCER. THER., vol. 6, 2007, pages 3009 - 3018 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR PRESS |
| SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SAMUDRALA ET AL.: "Ab Initio Protein Structure Prediction Using a Combined Hierarchical Approach", PROTEINS, STRUCTURE, FUNCTION AND GENETICS, vol. 3, 1999, pages 194 - 198, XP001146416 |
| SANTOU, N; NES, M., MOL. BIOL. EVOL., vol. 4, 1987, pages 406 - 425 |
| SAUDEK ET AL., N. ENGL. J. MED., vol. 321, 1989, pages 514 |
| SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155 |
| SCHREIER ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 9090 |
| SEFTON, CRC CRIT. REF. BIOMED. ENG., vol. 14, 1987, pages 20 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 276, no. 9, 2001, pages 6591 - 6604 |
| SHIM ET AL., PROC. NATL. ACAD. SCI. USA, vol. 107, 2010, pages 11307 - 11312 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556 |
| SILVER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 1056 - 1060 |
| SLAMON ET AL., NEW ENGL. J. MED., vol. 344, 2001, pages 783 - 792 |
| SNEATH, P.H.A.; SOKAL, R.R.: "Numerical Taxonomy the Principles and Practice of Numerical Taxonomy", 1973, FREEMAN PRESS |
| SONG ET AL.: "Antibody Mediated Lung Targeting of Long-Circulating Emulsions", PDA JOURNAL OF PHARMACEUTICAL SCIENCE AND TECHNOLOGY, vol. 50, 1995, pages 372 - 397 |
| SONGSIVILAI; LACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SORIANO P., GENES DEV., vol. 8, 1994, pages 1888 - 1896 |
| STEURER ET AL., J. IMMUNOL., vol. 155, no. 3, 1995, pages 1165 - 1174 |
| STROHL, CURR. OPIN. BIOTECHNOL., vol. 20, no. 6, 2009, pages 685 - 691 |
| SURESH ET AL., METHODS IN ENZYMOLOGY, vol. 121, 1986, pages 210 |
| TAO ET AL., J. IMMUNOLOGY, vol. 143, 1989, pages 2595 - 2601 |
| THE UNITED STATES PHARMACOPEIAL CONVENTION, PHARMACOPEIAL FORUM, vol. 26, no. 1, 2000, pages 223 |
| TILLER ET AL., J. IMMUNOL. METHODS, vol. 329, 2008, pages 112 |
| TOMLINSON ET AL., J. MOL. BIOL., vol. 227, 1992, pages 776 - 798 |
| TRAUNECKER ET AL., EMBO J., vol. 10, 1991, pages 3655 - 3659 |
| TRAUNECKER ET AL., INT. J. CANCER, vol. 7, 1992, pages 51 - 52 |
| TROJANOWSKA, RHEUMATOLOGY, vol. 47, 2008, pages V2 - V4 |
| UMANA ET AL., NATURE BIOTECH., vol. 17, 1999, pages 176 - 180 |
| UMEZAWA ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 153, pages 1038 |
| UNGER ET AL., INVEST. RADIOL., vol. 20, 1985, pages 693 - 700 |
| V.V. RANADE, J. CLIN. PHARMACOL., vol. 29, 1989, pages 685 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WATERHOUSE ET AL., NUCL. ACIDS RES., vol. 21, 1993, pages 2265 - 2266 |
| WAWRZYNCZAK: "Antibody Therapy", 1996, BIOS SCIENTIFIC PUB. LTD |
| WEINER; KOTKOSKIE: "Excipient Toxicity and Safety", 2000, MARCEL DEKKER, INC. |
| WILBUR, W.J.; LIPMAN, D.J., PROC. NATL. ACAD. SCI. USA, vol. 80, 1983, pages 726 - 730 |
| WINTER ET AL., ANNU. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455 |
| WITTWE; HOWARD, BIOCHEM., vol. 29, 1990, pages 4175 - 4180 |
| WOFFENDIN, PROC. NATL. ACAD. SCI., vol. 91, 1994, pages 1581 |
| WONG; LOHMAN, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5428 - 5432 |
| WRIGHT; MORRISON, TIBTECH, vol. 15, 1997, pages 26 - 32 |
| WU ET AL., J. BIOL. CHEM., vol. 263, 1988, pages 621 |
| WU ET AL., J. BIOL. CHEM., vol. 266, 1991, pages 338 |
| WU ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 542 |
| WU, J. BIOL. CHEM., vol. 264, 1989, pages 16985 |
| WYSS; WAGNER, CURRENT OPIN. BIOTECH., vol. 7, 1996, pages 409 - 416 |
| YADAV ET AL., J. PHARM. SCI., vol. 99, no. 12, 2010, pages 4812 - 4829 |
| YADAV ET AL., MOL. PHARMACEUTICS, vol. 9, no. 4, 2012, pages 791 - 802 |
| YANG ET AL., NEW ENGL. J. MED., vol. 349, 2003, pages 427 - 434 |
| YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004 |
| ZENKE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 87, 1990, pages 3655 |
Cited By (54)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10189904B2 (en) | 2012-02-15 | 2019-01-29 | Novo Nordisk A/S | Antibodies that bind and block triggering receptor expressed on myeloid cells-1 (TREM-1) |
| US10906975B2 (en) | 2012-02-15 | 2021-02-02 | Novo Nordisk A/S | Methods of treating autoimmune disease or chronic inflammation with antibodies that bind and block triggering receptor expressed on myeloid cells-1 (TREM-1) |
| US10450358B2 (en) | 2014-05-16 | 2019-10-22 | Institute Of Biotechnology Academy Of Military Medical Sciences P.L.A. China | Platelet-derived growth factor B mutant, preparation method therefor and use thereof |
| CN105085652A (en) * | 2014-05-16 | 2015-11-25 | 中国人民解放军军事医学科学院生物工程研究所 | Platelet-derived growth factor B mutant, its preparation method and use |
| KR102465120B1 (en) | 2014-07-17 | 2022-11-10 | 노보 노르디스크 에이/에스 | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| WO2016009086A1 (en) * | 2014-07-17 | 2016-01-21 | Novo Nordisk A/S | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| KR102833621B1 (en) | 2014-07-17 | 2025-07-14 | 노보 노르디스크 에이/에스 | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| KR20170028439A (en) * | 2014-07-17 | 2017-03-13 | 노보 노르디스크 에이/에스 | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| CN106536559A (en) * | 2014-07-17 | 2017-03-22 | 诺和诺德股份有限公司 | Site-directed mutagenesis of the TREM‑1 antibody to reduce viscosity |
| JP2017522325A (en) * | 2014-07-17 | 2017-08-10 | ノヴォ ノルディスク アクティーゼルスカブ | Site-directed mutagenesis of TREM-1 antibody to reduce viscosity |
| EA037844B1 (en) * | 2014-07-17 | 2021-05-27 | Ново Нордиск А/С | SITE-DIRECTED ANTIBODY MUTAGENESIS TO TREM-1 |
| JP6995170B2 (en) | 2014-07-17 | 2022-01-14 | ノヴォ ノルディスク アクティーゼルスカブ | Site-directed mutagenesis of TREM-1 antibody to reduce viscosity |
| KR20220156093A (en) * | 2014-07-17 | 2022-11-24 | 노보 노르디스크 에이/에스 | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| CN106536559B (en) * | 2014-07-17 | 2021-04-27 | 诺和诺德股份有限公司 | Site-directed mutagenesis of TREM-1 antibody to reduce viscosity |
| US12116408B2 (en) | 2014-07-17 | 2024-10-15 | Novo Nordisk A/S | Site directed mutagenesis of TREM-1 antibodies for decreasing viscosity |
| EP4332119A3 (en) * | 2014-07-17 | 2024-05-29 | Novo Nordisk A/S | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| US11072654B2 (en) | 2014-07-17 | 2021-07-27 | Novo Nordisk A/S | Site directed mutagenesis of TREM-1 antibodies for decreasing viscosity |
| US10179814B2 (en) | 2014-07-17 | 2019-01-15 | Novo Nordisk A/S | Site directed mutagenesis of TREM-1 antibodies for decreasing viscosity |
| EP2975056A1 (en) * | 2014-07-17 | 2016-01-20 | Novo Nordisk A/S | Site directed mutagenesis of TREM-1 antibodies for decreasing viscosity |
| KR20240029114A (en) * | 2014-07-17 | 2024-03-05 | 노보 노르디스크 에이/에스 | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| KR102641268B1 (en) | 2014-07-17 | 2024-02-27 | 노보 노르디스크 에이/에스 | Site directed mutagenesis of trem-1 antibodies for decreasing viscosity |
| JP2020188786A (en) * | 2014-07-17 | 2020-11-26 | ノヴォ ノルディスク アクティーゼルスカブ | Site-specific mutagenesis of TREM-1 antibody to reduce viscosity |
| US10087246B2 (en) | 2014-11-10 | 2018-10-02 | Hoffmann-La Roche Inc. | Anti-PDGF-B antibodies and methods of use |
| US10538585B2 (en) | 2014-11-10 | 2020-01-21 | Hoffmann-La Roche Inc. | Anti-ANG2 antibodies and methods of use |
| US10730938B2 (en) | 2014-11-10 | 2020-08-04 | Hoffmann-La Roche Inc. | Bispecific antibodies and methods of use in ophthalmology |
| US10344085B2 (en) | 2014-11-10 | 2019-07-09 | Hoffman-La Roche, Inc. | Anti-IL-1beta antibodies |
| JP2017537896A (en) * | 2014-11-10 | 2017-12-21 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Bispecific antibodies and methods for use in ophthalmology |
| JP2017534645A (en) * | 2014-11-10 | 2017-11-24 | エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft | Anti-PDGF-B antibodies and methods of use |
| CN107148429A (en) * | 2014-11-10 | 2017-09-08 | 豪夫迈·罗氏有限公司 | Anti- PDGF B antibody and application method |
| WO2016075036A1 (en) * | 2014-11-10 | 2016-05-19 | F. Hoffmann-La Roche Ag | Anti-pdgf-b antibodies and methods of use |
| WO2016075037A1 (en) * | 2014-11-10 | 2016-05-19 | F. Hoffmann-La Roche Ag | Bispecific antibodies and methods of use in ophthalmology |
| CN107148429B (en) * | 2014-11-10 | 2021-12-03 | 豪夫迈·罗氏有限公司 | anti-PDGF-B antibodies and methods of use |
| CN105732809B (en) * | 2014-12-31 | 2019-08-06 | 广东众生药业股份有限公司 | Antibodies against platelet derived factor |
| CN105732809A (en) * | 2014-12-31 | 2016-07-06 | 广东众生药业股份有限公司 | Antibodies against platelet-derived factor |
| CN107849126A (en) * | 2015-07-29 | 2018-03-27 | 阿勒根公司 | The only antibody of anti-ANG 2 of heavy chain |
| JP2018527327A (en) * | 2015-07-29 | 2018-09-20 | アラーガン、インコーポレイテッドAllergan,Incorporated | Heavy chain only antibody against ANG-2 |
| US11046756B2 (en) | 2015-07-29 | 2021-06-29 | Allergan, Inc. | Heavy chain only antibodies to ANG-2 |
| CN107849126B (en) * | 2015-07-29 | 2022-04-08 | 阿勒根公司 | Heavy chain-only anti-ANG-2 antibodies |
| EP3792279A2 (en) | 2015-07-29 | 2021-03-17 | Allergan, Inc. | Heavy chain only antibodies to ang-2 |
| US10266589B2 (en) | 2015-07-29 | 2019-04-23 | Allergan, Inc. | Heavy chain only antibodies to ANG-2 |
| US11028163B2 (en) | 2015-08-14 | 2021-06-08 | Allergan, Inc. | Heavy chain only antibodies to PDGF |
| WO2017030909A1 (en) * | 2015-08-14 | 2017-02-23 | Allergan, Inc. | Heavy chain only antibodies to pdgf |
| US10308711B2 (en) | 2015-08-14 | 2019-06-04 | Allergan, Inc. | Heavy chain only antibodies to PDGF |
| JP2018523673A (en) * | 2015-08-14 | 2018-08-23 | アラーガン、インコーポレイテッドAllergan,Incorporated | Heavy chain only antibody against PDGF |
| US12226482B2 (en) | 2016-12-09 | 2025-02-18 | Alector Llc | Anti-SIRP-alpha antibodies and methods of use thereof |
| US11919954B2 (en) | 2018-04-02 | 2024-03-05 | Bristol-Myers Squibb Company | Anti-TREM-1 antibodies and uses thereof |
| US11952420B2 (en) | 2018-04-02 | 2024-04-09 | Bristol-Myers Squibb Company | Nucleic acids encoding anti-TREM-1 antibodies |
| US11155618B2 (en) | 2018-04-02 | 2021-10-26 | Bristol-Myers Squibb Company | Anti-TREM-1 antibodies and uses thereof |
| US11976119B2 (en) | 2018-05-25 | 2024-05-07 | Alector Llc | Anti-SIRPa antibodies and methods of use thereof |
| US12258410B2 (en) | 2018-05-25 | 2025-03-25 | Alector Llc | Anti-SIRPα antibodies and methods of use thereof |
| WO2020262576A1 (en) * | 2019-06-28 | 2020-12-30 | Chugai Seiyaku Kabushiki Kaisha | Antigen binding molecules that bind pdgf-b and pdgf-d and uses thereof |
| US12030935B2 (en) | 2021-01-25 | 2024-07-09 | Regeneron Pharmaceuticals, Inc. | Anti-PDGF-B antibodies and pharmaceutical composition thereof |
| WO2022159875A1 (en) * | 2021-01-25 | 2022-07-28 | Regeneron Pharmaceuticals, Inc. | Anti-pdgf-b antibodies and mehods of use for treating pulmonary arterial hypertension (pah) |
| WO2025150482A1 (en) * | 2024-01-08 | 2025-07-17 | Chugai Seiyaku Kabushiki Kaisha | Antigen-binding molecules that bind pdgf-b and pdgf-d, and methods of use |
Also Published As
| Publication number | Publication date |
|---|---|
| HK1216428A1 (en) | 2016-11-11 |
| MX2015005874A (en) | 2015-09-10 |
| US20140134176A1 (en) | 2014-05-15 |
| SG11201503245PA (en) | 2015-05-28 |
| US9428577B2 (en) | 2016-08-30 |
| BR112015010722A2 (en) | 2017-08-22 |
| EP2917237A1 (en) | 2015-09-16 |
| TWI522364B (en) | 2016-02-21 |
| KR20150082503A (en) | 2015-07-15 |
| AU2013343099A1 (en) | 2015-05-14 |
| CA2890483A1 (en) | 2014-05-15 |
| CN105026426A (en) | 2015-11-04 |
| IL238568A0 (en) | 2015-06-30 |
| TW201431878A (en) | 2014-08-16 |
| JP2015536339A (en) | 2015-12-21 |
| RU2015115956A (en) | 2017-01-10 |
| AR093394A1 (en) | 2015-06-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9428577B2 (en) | Platelet-derived growth factor B specific antibodies and compositions and uses thereof | |
| CA2929784C (en) | Tumor necrosis factor-like ligand 1a specific antibodies and compositions and uses thereof | |
| US20210403600A1 (en) | Antibodies to coagulation factor xia and uses thereof | |
| CA2921578C (en) | Anti-ngf antibodies and methods using same | |
| WO2015109212A1 (en) | Anti-il-2 antibodies and compositions and uses thereof | |
| CA2604443A1 (en) | Use of anti-ngf antibody for improving stiffness in osteoarthritis | |
| AU2014348676A1 (en) | Tumor necrosis factor-like ligand 1A specific antibodies and compositions and uses thereof | |
| US11365253B2 (en) | Anti-ROBO2 antibodies, compositions, methods and uses thereof | |
| WO2016096896A1 (en) | Antibodies for il-17c | |
| AU2011201157C1 (en) | Anti-NGF antibodies and methods using same | |
| HK1227416B (en) | Tumor necrosis factor-like ligand 1a specific antibodies and compositions and uses thereof | |
| HK1255136B (en) | Antibodies to coagulation factor xia and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 201380068100.1 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13820911 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2015541262 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 238568 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2890483 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2015/005874 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2013343099 Country of ref document: AU Date of ref document: 20131028 Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2013820911 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013820911 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112015010722 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20157014869 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015115956 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112015010722 Country of ref document: BR Kind code of ref document: A2 Effective date: 20150511 |












