WO2014055800A1 - A family of synthetic polynucleotide-binding peptides and uses thereof - Google Patents
A family of synthetic polynucleotide-binding peptides and uses thereof Download PDFInfo
- Publication number
- WO2014055800A1 WO2014055800A1 PCT/US2013/063330 US2013063330W WO2014055800A1 WO 2014055800 A1 WO2014055800 A1 WO 2014055800A1 US 2013063330 W US2013063330 W US 2013063330W WO 2014055800 A1 WO2014055800 A1 WO 2014055800A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- cells
- pura
- tzip
- cancer
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4702—Regulators; Modulating activity
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/02—Muscle relaxants, e.g. for tetanus or cramps
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/02—Drugs for disorders of the nervous system for peripheral neuropathies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/18—Antivirals for RNA viruses for HIV
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- This invention relates to a family of novel synthetic peptides for the treatment of various diseases and methods of treatment using such peptides.
- the invention also relates to methods of generating such peptides.
- Pura also known as Pur-alpha, Pur-a, or Puralpha
- Cyclin Tl Cyclin Tl
- interferon regulatory factors IRFs 3 and 7 are all naturally occurring proteins that are involved in nucleic acid regulatory processes in healthy and unhealthy mammalian cells, including those of humans. They are also involved in the transmission and replication of viral pathogens, including HIV, polyomaviruses and species of bacteria, including those causing Lyme disease and syphilis, as well as protists including those causing malaria.
- Trans-activator of transcription (“Tat”) is a HIV gene which, through the involvement of partner proteins (such as Pura, cyclin Tl, and IRF3 and 7), increases the level of transcription of HIV DNA.
- Pura, Cyclin Tl, and IRFs 3 and 7 The interactions between Pura, Cyclin Tl, and IRFs 3 and 7 with Tat cause HIV transcription and co-opting of cellular functions. There is a need for synthetic agents that will interfere with Tat and these protein binding partners in order to prevent or reduce the spread of HIV infection.
- Pura, Cyclin Tl, and IRFs 3 and 7 are involved in transcription and cellular processes. For example, Pura is involved in regulating both cell growth and cell fate in cancer. Therefore, there is also a need to harness the beneficial properties of the Pura protein in order to provide therapies to treat or prevent cancers.
- the common denominator in Pura function tying together its actions in all organisms, is its ability to bring proteins and nucleic acids together in such a way that these two classes of macromolecules can move relative to each other.
- a value of this invention is that it can inhibit pathological aspects of Pura function while allowing Pura functions necessary for healthy cell activities.
- the polypeptides of the invention are also valuable due to their ability to be delivered.
- Pura is a sequence-specific single-stranded DNA-binding protein that functions in binding both DNA and RNA. It binds to purine-rich ("Pur") elements found in the promoters of genes, and has a great affinity for DNA elements upstream of the c-MYC gene (Bergemann, A.D. and Johnson, E.M. (1992) The HeLa Pur factor binds single-stranded DNA at a specific element conserved in gene flanking regions and origins of DNA replication. Mol. Cell. Biol. 12, 1257- 1265; Bergemann, A.D., Ma, Z.-W. and Johnson, E.M.
- Pura is multifunctional in nature, as it is involved in DNA replication, RNA transcription, RNA transport, viral protein interactions, and regulation of viral replication at low concentrations. More specifically, Pura is involved in regulating both cell growth and cell fate. For example, Pura regulates progression of the cell cycle.
- the cell cycle is a sequence of events, including interphase and the mitotic phase, from the time a eukaryotic cell divides to form two daughter cells to the time the daughter cells divide again.
- the cycle consists of four phases, gap 1 ("Gi"), synthesis ("S"), gap 2 ("G 2 "), and mitosis ("M”).
- Interphase occurs from Gi phase through the G 2 phase.
- G ls the cell increases in size, and increases its supply of proteins and the number of many of its organelles (e.g., mitochondria and ribosomes).
- S phase occurs.
- DNA synthesis (replication) occurs during S phase, and after DNA replication, single chromosomes are present as double chromosome, each consisting of two sister chromatids.
- the third subphase, G 2 spans the time from the completion of DNA synthesis to the beginning of cell division. During this time, proteins that are essential to cell division are made by the cell.
- cytokinesis and mitosis occur. Cytokinesis is the process by which the cytoplasm (cytokinesis) divides and is distributed to form two daughter cells. Mitosis is the process by which the nucleus and its contents, including the duplicated chromosomes, divide and are distributed to form two cells.
- Pura interacts directly with retinoblastoma protein ("Rb”), cyclin-dependent kinase (“Cdk2”), and cell division cycle 6 ("Cdc6") in a dose dependent manner to affect cell determination after oncogenic stress.
- Rb retinoblastoma protein
- Cdk2 cyclin- dependent kinase
- Cdc6 cell division cycle 6
- microinjection of Pura halts deregulated cell growth by arresting cell-cycle progression at the Gi or G 2 /M phases, depending upon the cell cycle phase during which Pura is injected.
- S phase cyclin A must bind with Cdk2 for the cell to progress normally through the S phase.
- Pura co-localizes with cyclin AJ Cdk2 in S and G 2 to interrupt this process. Specifically, Pura recruits Cdk2 to specific Pura binding sites. The interaction of Pura with Cdk2 stimulates histone phosphorylation and displaces the kinase inhibitor, p21, to affect chromatin structure. (Liu, FL, S. M. Barr, C. Chu, D. S. Kohtz, Y. Kinoshita, and E. M. Johnson, Biochem. Biophys. Res. Commun., 328:851-7 (2005)). Pura further alters chromatin structure by binding to Pur elements to cause local unwinding that affects DNA structure upstream and downstream. Thus, Pura has the ability to regulate cell growth by altering chromatin structure.
- the c-MYC gene is an oncogene that participates in the progression of many cancers. Cancers such as small cell lung carcinoma ("SCLC"), prostate cancer, lymphoma, various brain tumors, colon cancer, and cancers of the head and neck have been found to have amplified c-MYC genes. Expression of the Pura peptide has been shown to block proliferation of a variety of oncologically transformed cells, especially those that exhibit amplified c-MYC genes.
- SCLC small cell lung carcinoma
- prostate cancer lymphoma
- various brain tumors colon cancer
- cancers of the head and neck have been found to have amplified c-MYC genes.
- Expression of the Pura peptide has been shown to block proliferation of a variety of oncologically transformed cells, especially those that exhibit amplified c-MYC genes.
- PURA and PURB are two genes encoding functionally cooperative proteins in the Pur family. Concurrent deletions of PURA and PURB occur in MDS at a rate nearly 1.5-fold higher than statistically expected and in AML at a rate .5-fold higher. This novel simultaneous deletion of two closely related gene family may thus have consequences related to progression to AML.
- SCLC is closely associated with smoke inhalation, and is one of the deadliest human cancers. This highly invasive cancer affects epithelial cells of the lungs. By the time SCLC is diagnosed, it is usually widely disseminated in the lungs and inoperable. Treatment for SCLC is limited. Although initially sensitive to radiation, the effects of radiation on SCLC are short lived. Moreover, there is no effective chemotherapeutic treatment for this disease. The average life span following diagnosis of SCLC is about six months.
- Prostate cancer affects about 16% of males in the United States, a percentage which is projected to increase over the next 20 years. Nearly 30% of men with prostate cancer will experience recurrence after local therapy. Recurrent prostate cancer is mostly androgen- dependent, and thus is responsive to androgen deprivation therapy. However, in many survivors, fatal, androgen-independent hormone refractory prostate cancer with metastases develops.
- prostate cancer is generally androgen dependent and can be treated with androgen antagonists. After a period of time, however, the tumor becomes androgen independent in a subset of patients. Treatment of androgen-independent prostate cancer is more difficult to treat and frequently leads to metastases and poor prognosis.
- the switch to the androgen-independent state involves over-expression of the androgen receptor protein due to loss of Pura from the androgen receptor gene transcriptional suppressor ("ARS") complex.
- ARS androgen receptor gene transcriptional suppressor
- An overabundance of androgen receptor protein causes a reduction in androgen specificity. The mechanism by which this occurs, however, is not yet understood.
- Levels of Pura in the nucleus and bound to the androgen receptor gene ARS element are reduced in the androgen-independent state and in hormone-resistant tumor samples. Restoration of Pura levels by transfection reduces androgen receptor protein levels and reverses the androgen-independent state.
- Pura may have a dual role both in the initiation transforming process of prostate cancer cells, acting as a facilitator of viral effects when at high levels, and in the switch to the androgen independent state, acting as a lost suppressor of androgen receptor expression when at reduced levels.
- HIV Human Immunodeficiency Virus
- HIV has multiple steps in its infective pathway. These mechanisms allow it to enter a host cell and replicate, which if untreated will ultimately result in the death of the host cell and further infection of other cells by the replicated HIV virus.
- One primary step in HIV's replication involves the transactivation of HIV-1 transcription. Interfering with and/or stopping this step entirely would minimize the spread of the infection in a particular host animal, or it may allow for a mechanism to prevent transmission between hosts.
- Some particular proteins important for this step include IRF 3 and 7, Cyclin TI and Pura.
- the Tat protein interacts with IRF 3 and 7 to cause relocalization of these IRFs in neural cells.
- Tat also interacts with Pura, the crystal structure of which has been published (Graebsch et al, 2009 X-ray structure of Pur- ⁇ alpha ⁇ reveals Whirley-like fold and an unusual nucleic-acid binding surface. Proc Natl Acad Sci USA, which is incorporated by reference herein in its entirety). Data presented in this application provide additional support of the Tat-Pura interaction. Tat also interacts with Cyclin/Tl and the crystal structure of Tat bound to Cyclin Tl/Cdk9 has also recently been published (David Price and colleagues). The domain of Tat that binds Cyclin Tl, closely resembles that of an active enzyme site. Tat requires for its activities coordination of two Zn ions. Therefore, there is a need to develop proteins which will interfere with Tat's ability to interact with IRF3 and 7, Cyclin Tl, and Pura in order to hinder or prevent HIV transcription.
- Repeat expansion disorders are neurodegenerative diseases which involve short nucleotide sequences being repeated at a certain locus many more times than normal.
- One important disease associated with repeat expansions is amyotrophic lateral sclerosis (ALS), a fatal neurodegenerative disorder that causes progressive damage to motor neurons.
- ALS amyotrophic lateral sclerosis
- a common genetic feature of this disease is the expansion of a GGGGCC repeat. There is currently no treatment for this disease.
- the Pur family of proteins are nucleic acid binding proteins. There are four identified members of the Pur family, all of which share common structural features. The most important of these is the nucleic acid binding region, which consists of a conserved domain repeated three times. This region binds preferentially to G - rich repeated sequences in nucleic acids, suggesting it may be involved in the etiology of ALS.
- the present invention relates to synthetic peptides which are capable of binding to PUR elements.
- the invention also relates to the use of the peptides in the prevention or treatment of cancer, HIV, or nucleotide repeat diseases.
- the present invention provides a synthetic TZIP peptide comprising the amino acid sequence
- the present invention provides a peptide comprising the amino acid sequence
- the invention provides the amino acid sequence
- the invention provides a method for modulating the proliferation of cells that comprises administering a therapeutically effective amount of a therapeutic agent comprising the amino acid sequence
- the invention provides a method for treating a cancer in a subject that includes administering a therapeutically effective amount of a therapeutic agent comprising the amino acid sequence
- the invention further provides a method for treating cancer in a subject, where the cancer is selected from the group consisting of small cell lung carcinoma, brain tumor, acute myelogenous leukemia (AML), malignant melanoma, mesothelioma, prostate, lymphoma, colon, bladder, and head and neck cancer.
- AML acute myelogenous leukemia
- malignant melanoma mesothelioma
- prostate lymphoma
- colon colon
- bladder and head and neck cancer
- the method for treating a cancer in a subject comprises administering a therapeutically effective amount of a therapeutic agent having an amino acid sequence that
- cancer is characterized as having amplified c-MYC genes.
- the cancer is selected from the group consisting of small cell lung carcinoma, brain tumor, AML, malignant melanoma, mesothelioma, prostate, lymphoma, colon, bladder, and head and neck cancer.
- agent used to treat cancer contains the amino acid sequence
- the agent is soluble in aqueous solution.
- the agent has an amino acid sequence comprising an enhanced cell transport sequence capable of allowing the agent entry into cancer cells from the bloodstream.
- the agent does not significantly affect growth of noncancerous primary epithelial cells.
- the agent inhibits cancer cell proliferation.
- the invention is a method of treating HIV by administering a therapeutically effective amount of a peptide comprising the amino acid sequence
- the HIV resides in human cells.
- the human cells are selected from the group consisting of blood cells and bone marrow cells.
- the HIV resides in brain tissue.
- the brain tissue is comprised of glial cells, neurons, astrocytes, or microglial cells.
- nerve damage is prevented.
- the nerve damage is in the peripheral nervous system.
- the nerve damages is in the central nervous system.
- a method of preventing HIV infection comprising administering a peptide comprising the amino acid sequence
- the peptide is administered in a cream.
- the cream is applied to the vaginal or anal region.
- a method of treating an expanded nucleotide repeat disease by administering a peptide comprising the amino acid sequence LASTFVTRDNKRYFMDLKENQRGRFMRVSQVGTRGYR SLTVSYSVAWLEFRTHLCK LIDEYAKLQYARAKRRQARRQIRQQQQQQEE or a variant thereof is provided.
- expanded nucleotide repeat diseases that can be treated with the peptides disclosed herein include, but are not limited to, ALS and fragile X syndrome.
- Figure 1 is an image depicting the structural domains of the Pura protein.
- Figure 2 is a graph which shows the effect on cell fate when Pura is microinjected into NIH3T3 cells at various cell-cycle positions.
- Figure 3 is a graph which shows that Pura retards entry into S phase and progression through S phase in ras-transformed cells.
- Figure 4 is an image which shows the effect of Pura on anchorage independent growth of ras-transformed NIH3T3 cells.
- Figure 5 is an image showing that Pura binds pi 10 RB , the hypophosphorylated form of Rb.
- Figure 6 is a graph which shows the effect of exogenously introduced TZIP peptide on cell counts of H82 cells at various times.
- Figure 7 is a graph which shows the effects of exogenously introduced TZIP peptide on treated and untreated H82 cells measured using dye trypan blue.
- Figure 8 is a graph which shows the effect of exogenously introduced TZIP peptide on HeLa(A) cells.
- Figure 9A shows the crystal structures of a portion of Tat alone, a portion of Tat bound to cyclin Tl and HIV-1 Tat clade B as well as the amino acid sequences of cyclin Tl, TZIP, Pura A and IRF7.
- Figure 9B is a graph which shows the inhibition of Tat transactivation in U-87 MG cells at different concentrations of the TZIP peptide.
- Figure 10 shows the amino acid sequences of Cyclin Tl, IRF7 and examples of peptides of the present invention.
- Figure 11 is the nucleotide sequence used to generate a peptide of the present invention. The synthetic nucleotide cloned and sequenced is highlighted in grey. Primers used for sequencing are double underlined. [0059] Figure 12 provides images of Coomassie Stains and Western Detection of Protein
- Figure 13 shows Electrophoretic Mobility Shift Assays (EMSA) with Pura, PurP, and TZIP on 4% TBE polyacrylamide gels.
- ESA Electrophoretic Mobility Shift Assays
- Figure 13A shows constant Pura with ALS ssDNA alone.
- Figure 13B shows constant PurP with ALS ssDNA alone.
- Figure 13C shows constant TZIP with ALS ssDNA alone.
- Figures 14 A and B provide EMSA with Pura and TZIP combined in a reaction mixture with IR-labeled ssDNA ALS being held constant.
- Figure 15 shows EMSA with PurP and TZIP combined in reaction mixture with
- Figure 16 shows EMSA with Pura and PurP combined in reaction mixture
- Figure 17 shows Electrophoretic mobility shift assay with constant ssDNA FXS expanded repeat and constant Pura protein with increasing amounts of PurP protein.
- Figure 18 shows Electrophoretic mobility shift assays for:
- FIG. 19 shows Electrophoretic mobility shift assays for:
- treatment refers generally to obtaining a desired pharmacological and/or physiological effect.
- the effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete stabilization or cure for a disease and/or adverse effect attributable to the disease.
- Treatment covers any treatment of a disease in a subject, and includes: (a) preventing the disease or symptom from occurring in a subject which may be predisposed to the disease or symptom, may or may not be diagnosed as having it; (b) inhibiting the disease symptom, i.e., arresting its development; or (c) relieving the disease symptom, i.e., causing regression of the disease or symptom.
- pharmaceutically acceptable carrier refers to any and all solvents, dispersion media, coatings, antibacterial and antifungal agent, isotonic and absorption delaying agents for pharmaceutical active substances as are well known in the art.
- pharmaceutically acceptable carrier refers to any and all solvents, dispersion media, coatings, antibacterial and antifungal agent, isotonic and absorption delaying agents for pharmaceutical active substances as are well known in the art.
- pharmaceutical agent includes biological pharmaceuticals such as proteins, peptides, and oligonucleotides. Except insofar as any conventional media or agent is incompatible with the agent, its use in the therapeutic pharmaceutical compositions is contemplated. Supplementary compounds or biological pharmaceuticals can also be incorporated into the pharmaceutical compositions.
- excipient refers to the additives used to convert a synthetic agent into a form suitable for its intended purpose.
- excipient includes those excipients described in the HANDBOOK OF PHARMACEUTICAL EXCIPIENTS, American Pharmaceutical Association, 2nd Ed. (1994), which is herein incorporated in its entirety.
- excipients is meant to include fillers, binders, disintegrating agents, lubricants, solvents, suspending agents, dyes, extenders, surfactants, auxiliaries and the like.
- Liquid excipients can be selected from various oils, including those of petroleum, animal, vegetable or synthetic origin, such as, peanut oil, soybean oil, mineral oil, sesame oil, hydrogenated vegetable oil, cottonseed oil, groundnut oils, corn oil, germ oil, olive oil, or castor oil, and so forth.
- Suitable excipients also include, but are not limited to, fillers such as saccharides, lactose, fructose, sucrose, inositol, mannitol or sorbitol, xylitol, trehalose, cellulose preparations and/or calcium phosphates, tricalcium phosphate or calcium hydrogen phosphate, as well as starch paste, using modified starch, maize starch, wheat starch, rice starch, potato starch, gelatin, tragacanth, ethoxylated isostearyl alcohols, polyoxyethylene sorbitol and sorbitan esters, microcrystalline cellulose, hydroxypropyl cellulose, methyl cellulose, hydroxypropyl methyl cellulose, aluminum metahydroxide, bentonite, sodium carboxymethylcellulose, croscarmellose sodium, crospovidone and sodium starch glycolate, and/or polyvinyl pyrrolidine and mixtures thereof.
- fillers such as saccharides, lacto
- disintegrating agents can be added, such as, the above-mentioned starches and also carboxymethyl-starch, cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof, such as, sodium alginate.
- Auxiliaries include, silica, stearic acid or salts thereof, such as, magnesium stearate, sodium stearyl fumarate, or calcium stearate.
- terapéuticaally effective amount refers to an amount of an agent disclosed herein, that is effective for preventing, ameliorating, treating or delaying the onset of a disease or condition.
- compositions of the inventions can be administered to any animal that can experience the beneficial effects of the agents of the invention.
- animals include humans and non-humans such as primates, pets and farm animals.
- compositions comprising Agents of the Invention
- the present invention also comprises pharmaceutical compositions comprising the agents disclosed herein. Routes of administration and dosages of effective amounts of the pharmaceutical compositions comprising the agents are also disclosed.
- the peptides of the present invention can be administered in combination with other pharmaceutical agents in a variety of protocols for effective treatment of disease.
- compositions of the present invention are administered to a subject in a manner known in the art.
- the dosage administered will be dependent upon the age, health, and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment, and the nature of the effect desired.
- the pharmaceutical compositions of the present invention may further comprise at least one of any suitable auxiliaries including, but not limited to, diluents, binders, stabilizers, buffers, salts, lipophilic solvents, preservatives, adjuvants or the like.
- suitable auxiliaries are preferred. Examples and methods of preparing such sterile solutions are well known in the art and can be found in well known texts such as, but not limited to, REMINGTON'S PHARMACEUTICAL SCIENCES (Gennaro, Ed., 18th Edition, Mack Publishing Co. (1990)).
- Pharmaceutically acceptable carriers can be routinely selected that are suitable for the mode of administration, solubility and/or stability of the agent.
- composition excipients and additives useful in the present invention can also include, but are not limited to, proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in combination in ranges of 1-99.99% by weight or volume.
- Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like.
- Representative amino acid components which can also function in a buffering capacity, include alanine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- Carbohydrate excipients suitable for use in the present invention include
- monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like
- disaccharides such as lactose, sucrose, trehalose, cellobiose, and the like
- polysaccharides such as raffmose, melezitose, maltodextrins, dextrans, starches, and the like
- alditols such as mannitol, xylitol, maltitol, lactitol, xylitol, sorbitol (glucitol), myoinositol and the like.
- compositions suitable for parenteral administration include aqueous and non-aqueous sterile injection solutions which may contain anti-oxidants, buffers, bacteriostats and solutes that render the formulation isotonic with the blood of the intended recipient; and aqueous and non-aqueous sterile suspensions which may include suspending agents and thickening agents.
- the pharmaceutical compositions may be presented in unit-dose or multi-dose containers, sealed ampules and vials, and may be stored in a freeze-dried
- parenteral administration sterile suspensions and solutions are desired. Isotonic preparations which generally contain suitable preservatives are employed when intravenous administration is desired.
- the pharmaceutical compositions may be administered parenterally via injection of a pharmaceutical composition comprising an agent dissolved in an inert liquid carrier.
- parenteral includes, but is not limited to, subcutaneous injections, intravenous, intramuscular, intraperitoneal injections, or infusion techniques.
- Acceptable liquid carriers include, vegetable oils such as peanut oil, cotton seed oil, sesame oil and the like, as well as organic solvents such as solketal, glycerol formal and the like.
- the pharmaceutical compositions may be prepared by dissolving or suspending the agent in the liquid carrier such that the final formulation contains from about 0.005% to 30% by weight of a agent.
- composition of the invention can also include additional therapeutic agents such as, but not limited to hydrophilic drugs, hydrophobic drugs, hydrophilic macromolecules, cytokines, peptidomimetics, peptides, proteins, toxoids, sera, antibodies, vaccines, nucleosides, nucleotides, nucleoside analogs, genetic materials and/or combinations thereof.
- additional therapeutic agents such as, but not limited to hydrophilic drugs, hydrophobic drugs, hydrophilic macromolecules, cytokines, peptidomimetics, peptides, proteins, toxoids, sera, antibodies, vaccines, nucleosides, nucleotides, nucleoside analogs, genetic materials and/or combinations thereof.
- the pharmaceutical formulation can also contain suitable pharmaceutically acceptable carriers comprising excipients and auxiliaries that facilitate processing of the active agents into preparations that can be administered to animals, as described herein.
- compositions useful in the present invention can contain a quantity of as agent(s) according to this invention in an amount effective to treat the condition, disorder or disease of the subject being treated.
- the invention is also directed to a kit form useful for administration to patients in need thereof.
- the kit may have a carrier means being compartmentalized in close confinement to receive two or more container means therein, having a first container means containing a therapeutically effective amount of a pharmaceutical composition of the invention and a carrier, excipient or diluent.
- the kit can have additional container mean(s) comprising a therapeutically effective amount of additional agents.
- the kit comprises a container for the separate pharmaceutical compositions such as a divided bottle or a divided foil packet, however, the separate pharmaceutical compositions can also be contained within a single, undivided container.
- the kit contains directions for administration of the separate components.
- the kit form is particularly advantageous when the separate components are preferably administered at different dosage intervals, or when titration of the individual components of the combination is desired by the prescribing physician.
- the kits of the invention include testing and screening kits and methods, to enable practitioners to measure levels of the active ingredients in bodily fluids.
- the kits of the invention also include research-grade reagents and kits available for use and purchase by research entities.
- the invention further relates to the administration of at least one agent disclosed herein by the following routes, including, but not limited to oral, parenteral, subcutaneous, intramuscular, intravenous, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracelebellar, intracerebroventricular, intracolic, intracervical, intragastric, intrahepatic, intramyocardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, bolus, vaginal, rectal, buccal, sublingual, intranasal, iontophoretic means, or transdermal means.
- routes including, but not limited to oral, parenteral, subcutaneous, intramuscular, intravenous, intrarticular, intrabronchial, intra
- Methods of preparing various pharmaceutical compositions with a certain amount of active ingredients are known, or will be apparent in light of this disclosure, to those skilled in the art. Methods of preparing said pharmaceutical compositions can incorporate other suitable pharmaceutical excipients and their formulations as described in Remington's Pharmaceutical Sciences, Martin, E.W., ed., Mack Publishing Company, 19th ed. (1995).
- compositions of the invention can be determined empirically, or by standards currently recognized in the medical arts.
- the agents can be administered to a patient as pharmaceutical compositions in combination with one or more pharmaceutically acceptable excipients. It will be understood that, when administered to a human patient, the total daily usage of the agents of the
- compositions of the present invention will be decided within the scope of sound medical judgment by the attending physician.
- the specific therapeutically effective dose level for any particular patient will depend upon a variety of factors: the type and degree of the cellular response to be achieved; activity of the specific agent or composition employed; the specific agents or composition employed; the age, body weight, general health, gender and diet of the patient; the time of administration, route of administration, and rate of excretion of the agent; the duration of the treatment; drugs used in combination or coincidental with the specific agent; and like factors well known in the medical arts. It is well within the skill of the art to start doses of the agents at levels lower than those required to achieve the desired therapeutic effect and to gradually increase the dosages until the desired effect is achieved.
- Dosaging can also be administered in a patient-specific manner to provide a predetermined concentration of the agents in the blood, as determined by techniques accepted and routine in the art.
- the agents disclosed herein may be used alone or in concert with other therapeutic agents at appropriate dosages defined by routine testing in order to obtain optimal efficacy while minimizing any potential toxicity.
- the dosage regimen utilizing an agent of the present invention may be selected in accordance with a variety of factors including type, species, age, weight, sex, medical condition of the patient; the severity of the condition to be treated; the route of administration; the renal and hepatic function of the patient; and the particular agent employed.
- a physician or veterinarian of ordinary skill can readily determine and prescribe the effective amount of the drug required to prevent, counter, or arrest the progress of the condition.
- TZIP TZIP
- the "TZIP" peptide disclosed herein is a novel synthetic Pura agonist peptide that exhibits anti-cancer activity.
- TZIP is a generic Pur repeat that possesses characteristics of all Pur family members. It reverses deregulated cell growth and can be effective in treating various cancers, including small cell lung carcinoma, prostate cancer, lymphoma, brain tumors, colon cancer, bladder cancer, AML, malignant melanoma, mesothelioma, and cancers of the head and neck.
- the TZIP peptide When used in therapy, the TZIP peptide is designed to modulate the growth of cancer cells by binding to c-MYC genes of these cells to prevent unchecked progression of the cell cycle. Specifically, the TZIP peptide is designed to bind to a sequence upstream of the c-MYC gene to activate a tumor suppressor pathway that causes cancer cells to undergo apoptosis.
- the TZIP peptide is designed to maximize recruitment of cell cycle regulatory proteins to its DNA binding sites to normalize the control of cancer cell proliferation.
- the TZIP peptide does not have any significant effect on the growth of normal, primary epithelial cells.
- the TZIP peptide can be used to treat or prevent SCLC, prostate cancer, cancers of the colon, head and neck, bladder cancer, mesothelioma, lymphoma, various brain tumors, AML, malignant melanomas, and other tumors and cancers with amplified c-MYC genes.
- the TZIP peptide is a novel Pura agonist that contains sequences that bind DNA via Pur elements and protein-protein interacting domains.
- the mimetic peptide contains sequences associated with activities of the Pura protein.
- the structural domains of the Pura protein are shown in Fig. 1.
- the TZIP peptide has the advantage of an incorporated, enhanced cell transport sequence of YARAKR QAR QIR, which allows the TZIP peptide to access all cells, including cancer cells, and cells from the bloodstream.
- the polypeptide disclosed herein is particularly useful when formulated as a cream, such as a cosmetic cream because of the presence of the enhanced cell transport sequence in the peptide which facilitates transport of the peptide into the target cells.
- the TZIP peptide was designed to optimize versions of protein motifs found throughout evolution to allow it to be effective in any animal. Peptide treatments frequently encounter an immune response as a toxic or ablating side effect.
- the TZIP peptide incorporates features that are in proteins normally secreted in humans and are thus unlikely to be highly immunogenic.
- the TZIP peptide works at such low concentrations and with such rapidity that an effective antitumor response may be achieved before any adaptive immune response is mounted.
- the TZIP peptide can be administered as a pharmaceutical composition to treat or prevent cancers, especially cancers that exhibit amplified c-MYC genes.
- a pharmaceutical composition comprises at least one peptide comprising the amino acid sequence of the TZIP peptide:
- a variant amino acid sequence of the given TZIP amino acid sequence is a sequence with the side chains of, for example, one or more altered amino acid residues (for example, the amino acid residues are replaced with the side chain of another amino acid residue or some other side chain) such that the peptide is still able to bind to its Pur element in substantially the same way as a peptide consisting of the given amino acid sequence.
- a peptide may be modified so that it maintains or improves the ability to interact with and bind a suitable Pur element to modulate cell proliferation.
- those amino acid residues that are not essential to interact with the Pur element can be modified by replacement with another amino acid whose incorporation does not substantially affect the peptide's ability to behave as a Pura agonist and does not eliminate binding to the relevant Pur element.
- the peptide of the invention may be any protein or peptide (including oligopeptides or polypeptides) that includes the amino acid sequences, or portion or variants thereof, as disclosed.
- the TZIP peptide and TZIP variants are designed to behave as Pura agonists by recruiting Pura interacting proteins to inhibit cell proliferation. To carry out functions within the cell, the TZIP peptide and TZIP variants are designed to tightly bind to their PUR element. These PUR elements are found within the promoters of genes such as the well characterized Pura target, c-MYC, the protein product of which modulates cell cycle progression. The TZIP peptide and TZIP variants are designed to effectively recruit partner proteins to their PUR DNA-binding element, where Pura binds with high affinity and locally strand separates DNA.
- the TZIP peptide and TZIP variants are designed to inhibit S phase progression and cell growth in abnormal cells (e.g. cancer cells) when introduced in Gl phase of the cell cycle. It is intended that cell cycle progression is modulated when the TZIP peptide and TZIP variants enter the cell nucleus and cytoplasm to directly bind to Rb protein in Gl phase, and will be released when Rb becomes phosphorylated. Rb activates tumor suppressor pathways to steer cancer cells toward programmed cell death.
- the TZIP peptide and TZIP variants are also intended to bind Cdk4 to regulate cell proliferation.
- the TZIP Peptide is a Therapeutic Agent
- the therapeutic peptides of the present invention are based on a generic Pur protein nucleic acid binding repeat and incorporate amino acids that facilitate their use in therapy.
- the proteins are designed to alter the biological pathways of cells, both normal and abnormal, in mammals.
- the TZIP peptide (and TZIP variants) can be administered as therapeutic agents for prevention, prophylaxis, or other therapy of cancerous diseases, such as diseases that exhibit amplified c-MYC genes.
- the TZIP peptide incorporates an enhanced cell transport sequence to allow it to enter cells efficiently.
- the TZIP peptide can be administered intravesicularly to avoid systemic delivery methods that require higher dosages.
- the TZIP peptide (and TZIP variants) can be transfected or co-transfected into cells with a vector, or coupled with monoclonal antibodies for specific tumor types.
- the TZIP peptide (and TZIP variants) can also be microinjected into cells at certain phases to arrest cell-cycle progression.
- the TZIP peptide (and TZIP variants) can be adapted for administration by any appropriate route, for example by the oral, nasal, topical (including buccal, sublingual, or transdermal), or parenteral (including subcutaneous, intracutaneous, intramuscular, intraarticular, intraperitoneal, intrasynovial, intrasternal, intrathecal, intralesional, intravenous, or intradermal injections or infusions) route.
- parenteral including subcutaneous, intracutaneous, intramuscular, intraarticular, intraperitoneal, intrasynovial, intrasternal, intrathecal, intralesional, intravenous, or intradermal injections or infusions
- the formulations preferably meet sterility, pyrogenicity, general safety, and purity as required by FDA Office and Biologies standards.
- Dosage amounts of and modifications to the TZIP peptide (and TZIP variants) may be tissue, cancer, and/or patient specific.
- the exact dosage amount of and/or modification to the TZIP peptide (and TZIP variants) can be guided by expression patterns of the peptide in a given tissue to avoid side effects or to enhance therapeutic effect.
- the selection of a dosage amount or modification of the peptide may be dependent upon the specific type of cancer sought to be treated, or the stage of the disease.
- the selected dosage amount is a therapeutically effective amount, or an amount sufficient to retard or arrest growth of cancerous cells.
- the effect of a certain amount of the pharmaceutical composition can be monitored by observing the growth of the tumor treated or its recurrence. Determining a therapeutically effective amount is well within the skill of a practicing physician. Accordingly, it may be necessary for the therapist to titer the dosage and modify the route of administration as required to obtain the maximal therapeutic effect.
- the TZIP peptide (and TZIP variants) can be used to treat or prevent SCLC, prostate cancer, cancers of the colon, head and neck, bladder cancer, mesothelioma, lymphoma, various brain tumors, bladder cancer, AML, malignant melanoma, and other tumors and cancers with amplified c-MYC genes.
- Synthetic peptide agents mimicking a structural motif common to Tat binding partners Cyclin Tl, Pura and IRFs 3 and 7 can be used to assess the ability of a Tat-binding amino acid motif present in cellular partner proteins to serve as a target for interference with Tat co-opting of cellular functions. These peptide agents can be tested for their ability to abrogate transactivation of HIV- 1 transcription by Tat and to interfere with Tat effects on IRF3 and 7 relocalization in neural cells.
- Tat C22 As is shown in Figure 9A, mutation of either Tat C22 or C27 abolishes Tat transactivation. Two Zn ions are coordinated by two Tat C-rich domains within amino acids 20- 38. Further, Cyclin Tl C261 participates in the binding to Zn2. This alters and stabilizes the folding of Tat, increasing its ability to bind the U-rich bulge in TAR RNA and to bind to Cyclin Tl/Cdk9. Mutation of Tat C22 also abrogates binding to Pura. Pura and IRFs 3, 7 also have a potential Zn-binding region with structural features similar to those of Cyclin Tl, as shown for IRF7 in Fig. 9A.
- a peptide with features resembling those of the region of C261 of Cyclin Tl would bind the Zn2 C-rich domain and disrupt Tat activities.
- This peptide has been synthesized and is shown in Figure in order to minimize potential side effects in vivo.
- the TZIP peptide (and TZIP variants) of the present invention can also be used to treat HIV infection.
- the peptides can be used to treat HIV-infected cells. These peptides can be taken up by the infected cells and stop the transactivation of HIV- 1 transcription.
- the peptides of the present invention may be incorporated into various prophylactic applications that will prevent the transmission of HIV.
- a peptide of the invention can be incorporated into a topical treatment that can be applied to the penile, vaginal, or anal region in order to prevent transmission.
- the peptides can also be incorporated into various birth control devices (e.g. male and female condoms, diaphragms, cervical caps and cervical shields) and/or lubricants used with these devices or lubricants used without these devices.
- the TZIP peptide (and TZIP variants) can also be used to treat nucleotide repeat diseases. More specifically, introducing the TZIP peptide (or TZIP variants) to an affected cell can displace a bound Pur protein, thereby preventing sequestration-related cellular damage. Therefore, overexpression of these Pur proteins could cancel out or lessen developmental and intellectual disabilities that are caused by the expanded G-rich repeats. These Pur proteins include Pura, PurP, and Pury.
- the TZIP peptide can modify the binding of Pur proteins to this expanded repeat. TZIP functions cooperatively at less than 1 ⁇ with Pura to enhance binding to the GGGGCC repeat expanded and implicated in ALS. If Pur proteins are indeed sequestered away, then TZIP can be used to bind to the G-rich repeats instead of Pura, PurP or Pury, freeing up needed Pur proteins to proceed with their normal function.
- Pura was injected into NIH3T3 cells during various cell-cycle transition points to determine the effects of elevated Pura levels at different phases of the cell cycle.
- the clear bar represents dividing cells
- the black bar represents non-dividing cells
- the shaded bar represents rapid cell death.
- a pool of ras -transformed cells were stably transfected or co-trans fected with the following: (a) pBABE, an empty vector; (b) pBABE+pBK, both empty expression vectors; (c) pBABE+pBKPura, to over-express Pura; (d) pBABE+ pBKPura low to express Pura at a level near that of endogenous Pura; (e) pBABE+pBKPura hlgh to express Pura at a level nearly 5 -fold that of endogenous Pura; (f) pEBV, an empty expression vector (g) pEBVPura to over-express Pura. 4N indicates completion of DNA synthesis.
- Pura was shown to bind the hypophosphorylated form of Rb, p 110 RB .
- Rb was detected in extracts of monkey CV-1 cells complexed with Pura. These complexes can be immunoextracted from cell lysates using monoclonal antibodies to either Pura or Rb.
- Proteins expressed in bacteria were bound to glutathione-agarose beads. Unfused GST was prepared in the same manner for use as a control. Beads containing equivalent amounts of each protein were used for each lane. Beads were collected, washed, and bound proteins were subjected to electrophoresis. The proteins were then blotted and probed with anti-Rb monoclonal antibody.
- FIG. 5 shows that both Gst-Pura and Gst-T (+control, a mutant form of SV40 large T-antigen) bind exclusively to the hypophosphorylated forms of pi 10 RB .
- binding of Rb to control GST alone was nil.
- IPP represents Rb immunoprecipitated from WR2E3 cells using rabbit polyclonal anti-Rb antibody.
- the Rb protein existed in several states of phosphorylation, the hypophosphorylated state, pi 10 RB , migrating more rapidly on SDS gels (lane 1).
- the TZIP peptide was shown to inhibit growth of SCLC cells in low concentrations.
- the peptide was tested against SCLC cells in culture.
- the cell lines included H82, HI 46, and controls.
- the H82 cell line has amplified c-MYC genes and HI 46 has increased levels of expression of c-MYC.
- the controls were normal epithelial cells and HeLa cells (a cervical cancer cell line with no known changes in c-MYC).
- H82 SCLC cells were grown in suspension in small cell culture wells in RPMI medium with 10% fetal bovine serum. At time 0, the TZIP peptide was added to the medium at a final concentration of 10 "12 M. Control cells received no peptide. The TZIP peptide was added as a stock solution of 200 ⁇ g in 200 of deionized water. Time points were taken as shown in Figure 6, and cells were counted using a hemocytometer. As shown in Figure 6, inhibitory effects of the peptide were evident at one day post treatment and no further growth of the treated cancer cells was evident after three days.
- H82 cells were treated with the TZIP peptide and the dye trypan blue, which is excluded from live cells.
- the H82 cells were otherwise treated as previously described and H82 cells used as a control were untreated.
- the percentages of living cells are represented by solid lines, and the percentages of dead cells are represented by dotted lines.
- the TZIP peptide killed TZIP-treated H82 cells. In contrast, there were very slight changes over time in percentages of either living or dead cells in the untreated controls.
- the TZIP peptide was shown to have a minor effect on the growth of cervical cancer cell line HeLa. This was expected based on the lack of changes in c-MYC in HeLa cell lines. HeLa cells were grown in suspension and either treated or untreated with the TZIP peptide as described above for the H82 cells. Points were taken at different times post treatment, and cells were counted using a hemocytometer. As shown in Figure 8, the TZIP peptide had little effect on the growth of HeLa cells compared to the significant effect the TZIP peptide had on SCLC cells. This difference was expected, as HeLa cells differ from SCLC cells in many aspects of tumor suppressor gene products and presence of oncogenes.
- a transactivation assay can be used as an initial screen in generating more peptides based on the sequence and structure of the TZIP peptide.
- additional peptides of the present invention (TZIP variants) have been synthesized and cloned as shown in Figure 10. These clones can be tested in the assay used to generate Figure 9B, which will measure each peptide's ability to inhibit Tat transactivation.
- the control will be cells not containing Tat and cells with luciferase expressed under direction of the irrelevant CAGGS promoters.
- the assay is improved by using exogenously added, purified Tat, which shows transactivation at 10 "12 to 10 "9 M. This allows for more direct control over Tat concentration.
- IRFs 3 and 7 can also be examined using the transactivation assay based on Fig. 9B. It is believed that Tat activates the IRFs in glial cells, and that this activation will be inhibited by the TZIP peptide and other peptides of the present invention.
- U-87 MG cells can be transfected with Tat and several mutants thereof to obtain different levels of Tat activity. Wormian, M.J., Krachmarov, CP., Kim, J.H., Gordon, R.G., Chepenik, L.G., Brady, J.N., Gallia, G.L., Khalili, K. and Johnson, E.M (2000).
- GST-Tat can be added at equimolar concentrations to Cyclin Tl in the presence or absence of a peptide inhibitor at various concentrations.
- the amount of protein pulled down by GST-Tat can be quantified by immunoblotting.
- the 3 ⁇ 4 and binding parameters of the peptide can be determined by standard methods. Mutating the peptides will yield valuable information regarding the contribution of each amino acid to the protein-protein binding involving the Cyclin Tl-like domain. Ultimately, the information gained can help in the design of peptidomimetics inhibiting protein binding to that region.
- the nucleotide sequence synthesized and cloned is shown in Fig. 11. This nucleotide coding sequence was designed to incorporate several unique features that enhance therapeutic aspects of the invention. Importantly, prior to the work of the present invention, there was no pre-existing natural coding sequence. The coding sequence in Figure 11, therefore, is novel.
- the peptide coding sequence for 89 amino acids is shown in grey.
- the cloned segment comprises 293 base pairs.
- Primer sequences used for sequencing are double underlined.
- the remaining sequences are from bacterial plasmid vector pIDTSMART (obtained commercially from Integrated DNA Technologies).
- the grey coding sequence was excised and ligated into mammalian expression vector pcDNA3.1-zeo (obtained commercially from
- E. Coli bacteria were transformed with a GST - PURA expression construct, grown in LB - amp media, and induced with 0.1 mM IPTG. The process was repeated with the GST - PURB gene.
- Cell lysates from bacterial inductions were passed through the GSTrap Protein Purification module for Pura, and the GST Microspin Purification module for Purp. SDS - PAGE - Lysates and elutions from isolation of GST - tagged Pura and PurP were subjected to gel electrophoresis using an 8% polyacrylamide gel and Coomassie stained. Eluted fraction of the GST - tagged protein was dialyzed in 3 L lx PBS for 3 hours.
- RNAse buffer Johnson, Edward M, Daniel, Dianne C, and Gordon, Jennifer (2013) The Pur Protein Family: Genetic and Structural Features in Development and Disease. Journal of Cellular Physiology, vol 228 (930 - 937), which is incorporated by reference herein in its entirety).
- the solution was treated with lx RNAse, then put through the GSTrap purification column again to remove the RNAse (Microspin Purification column for PurP).
- RNAse treatment Pura
- PurP pre - RNAse treated elution
- the Pura membrane was treated with a mouse monoclonal antibody (clone 10B12) against Pura developed in the Johnson laboratory.
- the Purp membrane was treated with polyclonal rabbit anti - Purp (Abeam). A secondary antibody treatment was performed, and the membrane was imaged using an autoradiography cassette to detect chemiluminescence .
- Infrared oligonucleotides representing a GGGGCC hexanucleotide repeat expanded at C90RF72 in ALS patients were custom ordered and are referred to as ALS ssDNA.
- 4% polyacrylamide gel electrophoresis was performed using IR - labeled oligonucleotides and imaged using the Li - Cor Odyssey IR imaging instrumentation and software.
- Electrophoretic Mobility Shift Assay Various combinations of Pura, Purp, TZIP, and IR - labeled oligonucleotides were prepared in the 5X Johnson binding buffer (Bergemann, Andrew D and Johnson, Edward M (1992), The HeLa Pur Factor Binds Single - Stranded DNA at a Specific Element conserveed in Gene Flanking Regions and Origins of DNA Replication. Molecular and Cellular Biology, vol 12:3 (1257 - 1265), incorporated by reference herein in its entirety), adjusted to 5 mM DTT, 5 mM EDTA, and 0.5% Tween 20. 4% polyacrylamide gel electrophoresis was performed on samples and imaged with the Li - Cor Odyssey
- Protein purification resulted in strong Coomassie - stained gel bands between 50 and 75 kilodaltons for both Pura and Purp.
- Western procedure showed strong gel bands in the same location when treated with both anti - Pura/PurP and anti - GST. ( Figure 12).
- Silver staining after RNAse treatment confirmed the presence of Pura and Purp in the elution used for EMS A procedures.
- FIG. 13 shows Electrophoretic Mobility Shift Assays (EMSA) with Pura, Purp, and TZIP on 4% TBE polyacrylamide gels.
- Figure 13A shows constant Pura with ALS ssDNA alone.
- Figure 13B shows constant Purp with ALS ssDNA alone.
- Figure 13C shows constant TZIP with ALS ssDNA alone.
- Densitometry revealed a Ka value of 1.6 x 10 8 for Pura to ALS repeat and 5.5 x 10 10 for TZIP to ALS repeat. Purp bound the ALS repeat to a much smaller degree. A Ka value obtained for Purp was complex and not readily interpretable.
- Pura and TZIP mixed demonstrated the ability of TZIP to alter the binding activity of Pura (Fig 14 - A). Increasing the concentrations of TZIP causes the shifted band to migrate more slowly (Fig 14 - B).
- Figure 16 shows EMS A with Pura and PurP combined in reaction mixture and Pura and IR-labeled ssDNA ALS concentrations were held constant while Purp concentrations were varied.
- a GE Microspin GST purification module was used to purify GST-tagged Pura and PurP from bacterial lysate.
- Polyacrylamide gel electrophoresis with SDS-Page gels and molecular markers were used to verify that GST, Pura, and PurP were expressed and purified. Expressed proteins were detected using antibodies against Pura and PurP, including monoclonal mouse anti-Pur antibody developed in Johnson laboratory (clone 10B12) and polyclonal antibody against PurP (Abeam).
- Polyacrylamide gel electrophoresis with TBE buffer was used for gel-mobility shift assay.
- Infrared-labeled oligonucleotides representing G-rich trinucleotide DNA repeats at FMR1 in patients with Fragile X Syndrome (FXS) were custom ordered and are referred to herein as FXS ssDNA.
- polyacrylamide gels were detected through the use of the Odyssey (LICOR) instrumentation and software.
- TZIP works very similarly to Pura in that it moves more ssDNA FXS to the top of the gel as more TZIP is added.
- TZIP enhances the mobility shift of ssDNA FXS in the presence of Pura.
- TZIP tightly binds the FXS trinucleotide expanded repeat and greatly stimulates Pura binding.
- TZIP may work as an agonist to Pura. Less TZIP than Pura is needed to cause the mobility shift. Densitometry revealed a K d value of 1.9 x 10 9 for Pura and 9.5 x 10 10 for TZIP. The order of binding ssDNA FXS in these experiments is, therefore: TZIP>Pura>Purp. If TZIP were to work in a very similar way as Pura and PurP in cells, its addition could take the place of the Pur proteins by binding to the DNA, freeing up the PUR proteins to proceed with their normal functions.
- the disclosed peptide, and variants thereof can be used to treat or prevent cancers, tumors, and diseases with amplified c-MYC genes including, but not limited to, SCLC, prostate cancer, cancers of the colon, head and neck, mesothelioma, lymphoma, various brain tumors, bladder cancer, AML and malignant melanoma.
- the agents are also useful in the treatment of, and prevention of transmission of, HIV and treatment of expanded nucleotide repeat diseases, including certain currently untreatable and debilitating diseases.
- the residues of the disclosed amino acid sequence can be substituted provided that those
- substitutions allow the peptide to be soluble in aqueous solution, bind to RB and sequences upstream of the c-MYC gene, be transported in and out of cells, and recruit cell cycle regulatory proteins. Moreover, equivalent routes of administration that enable the peptide to enter cells can be used to administer the therapeutic agent.
- the scope of the invention is as set forth in the appended claims and equivalents thereof, rather than being limited to the examples contained in the foregoing description. The contents of all of the references disclosed herein are incorporated by reference in their entirety.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Molecular Biology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Neurology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Virology (AREA)
- Oncology (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
- Hematology (AREA)
- Tropical Medicine & Parasitology (AREA)
- AIDS & HIV (AREA)
- Communicable Diseases (AREA)
- Pain & Pain Management (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/433,160 US9896489B2 (en) | 2012-10-05 | 2013-10-03 | Family of synthetic polynucleotide-binding peptides and uses thereof |
JP2015535793A JP2015536909A (en) | 2012-10-05 | 2013-10-03 | Family of synthetic polynucleotide binding peptides and uses thereof |
CA2898148A CA2898148A1 (en) | 2012-10-05 | 2013-10-03 | A family of synthetic polynucleotide-binding peptides and uses thereof |
EP13844132.4A EP2904008A1 (en) | 2012-10-05 | 2013-10-03 | A family of synthetic polynucleotide-binding peptides and uses thereof |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201261710447P | 2012-10-05 | 2012-10-05 | |
US61/710,447 | 2012-10-05 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2014055800A1 true WO2014055800A1 (en) | 2014-04-10 |
Family
ID=50435446
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2013/063330 WO2014055800A1 (en) | 2012-10-05 | 2013-10-03 | A family of synthetic polynucleotide-binding peptides and uses thereof |
Country Status (5)
Country | Link |
---|---|
US (1) | US9896489B2 (en) |
EP (1) | EP2904008A1 (en) |
JP (1) | JP2015536909A (en) |
CA (1) | CA2898148A1 (en) |
WO (1) | WO2014055800A1 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5672479A (en) * | 1992-08-28 | 1997-09-30 | Mount Sinai School Of Medicine | Methods for identifying compounds that bind to PUR protein |
WO2004026120A2 (en) * | 2002-09-23 | 2004-04-01 | The General Hospital Coporation | Methods for diagnosing and treating tumors and suppressing cd promoters |
WO2008063113A1 (en) * | 2006-11-20 | 2008-05-29 | Cepep Iii Ab | Cell -penetrating peptides and constructs containing them consisting 15-25 amino acids of tumor supressor protein p14arf or p19arf |
-
2013
- 2013-10-03 WO PCT/US2013/063330 patent/WO2014055800A1/en active Application Filing
- 2013-10-03 EP EP13844132.4A patent/EP2904008A1/en not_active Withdrawn
- 2013-10-03 US US14/433,160 patent/US9896489B2/en active Active
- 2013-10-03 JP JP2015535793A patent/JP2015536909A/en active Pending
- 2013-10-03 CA CA2898148A patent/CA2898148A1/en not_active Abandoned
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5672479A (en) * | 1992-08-28 | 1997-09-30 | Mount Sinai School Of Medicine | Methods for identifying compounds that bind to PUR protein |
WO2004026120A2 (en) * | 2002-09-23 | 2004-04-01 | The General Hospital Coporation | Methods for diagnosing and treating tumors and suppressing cd promoters |
WO2008063113A1 (en) * | 2006-11-20 | 2008-05-29 | Cepep Iii Ab | Cell -penetrating peptides and constructs containing them consisting 15-25 amino acids of tumor supressor protein p14arf or p19arf |
Non-Patent Citations (4)
Title |
---|
LITTLE ET AL.: "Amplification and expression of the c-myc oncogene in human lung cancer cell lines.", NATURE., vol. 306, no. 5939, 10 November 1983 (1983-11-10), pages 194 - 196, XP055242300 * |
NINDS.: "Neurological Complications of AIDS Fact Sheet", 22 August 2012 (2012-08-22), XP008178666, Retrieved from the Internet <URL:https://web.archive.org/web120120822090243/http:/lwww.ninds.nih.gov/disorders/aids/detailaids.htm> [retrieved on 20140123] * |
WEI ET AL.: "A single stranded DNA-binding protein, ssCRE-BP/Pur alpha, in rat lung and its increase in allergic airway inflammation.", JPN J PHARMACOL, vol. 78, no. 4, December 1998 (1998-12-01), pages 419 - 427, XP055242323 * |
WHITE ET AL.: "Multiple roles for Puralpha in cellular and viral regulation.", CELL CYCLE, vol. 8, no. 3, 1 February 2009 (2009-02-01), pages 414 - 420, XP055242296 * |
Also Published As
Publication number | Publication date |
---|---|
JP2015536909A (en) | 2015-12-24 |
CA2898148A1 (en) | 2014-04-10 |
US9896489B2 (en) | 2018-02-20 |
EP2904008A1 (en) | 2015-08-12 |
US20160052979A1 (en) | 2016-02-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10577406B2 (en) | FKBP-L polypeptides and uses in angiogenesis-mediated disorders | |
EP3963055A1 (en) | Vectorized antibodies (vab) and uses thereof | |
WO2020227515A1 (en) | Compositions and methods for the vectored augmentation of protein destruction, expression and/or regulation | |
WO2010075303A1 (en) | Splicing factors with a puf protein rna-binding domain and a splicing effector domain and uses of same | |
US20130288981A1 (en) | Targeting senescent cells and cancer cells by interference with jnk and/or foxo4 | |
US10259852B2 (en) | Conjugate comprising P21 protein for the treatment of cancer | |
JP7184946B2 (en) | Inhibitors of NF kappa B activity for the treatment of diseases and disorders | |
US10537607B2 (en) | Treatment of autoimmune and/or inflammatory disease using novel caveolin modulators | |
JP2021525283A (en) | A pharmaceutical composition for preventing or treating cancer, which comprises an expression inhibitor or activity inhibitor of CD300c. | |
US9951111B2 (en) | Type I interferon mimetics as therapeutics for cancer, viral infections, and multiple sclerosis | |
CA2458565A1 (en) | New angiogenesis inhibitors based on soluble cd44 receptor hyaluronic acid binding domain | |
Sayas | Tau-based therapies for Alzheimer’s disease: Promising novel neuroprotective approaches | |
US9896489B2 (en) | Family of synthetic polynucleotide-binding peptides and uses thereof | |
KR102127218B1 (en) | Use of compounds in the manufacture of drugs for the treatment of brain glioma | |
US20230058305A1 (en) | Methods and compositions for treating myc-driven cancers | |
JP6397122B2 (en) | Use of peptides to treat angiogenesis-related diseases | |
US11345729B2 (en) | Recombinant fusion protein of BAF57 and uses thereof | |
CA3168560A1 (en) | Improved anti-senescence compounds and uses thereof | |
KR20190080814A (en) | Recombinant fusion protein of BAF57 and uses thereof | |
US5994055A (en) | HIV trans-activator Tat binding to CDK7 and activation of CTD phosphorylation | |
US20210330742A1 (en) | PHARMACEUTICAL COMPOSITION COMPRISING RUNX3 PROTEIN AND CDK4 INHIBITOR OR mTOR INHIBITOR COTREATMENT FOR PREVENTION OR TREATMENT OF CANCER | |
US7329643B2 (en) | Inhibition of HMGB1 release by fetuin | |
WO2017000904A1 (en) | Use of interaction between influenza virus proteins and host protein cpsf30 in inhibition of tumor cells proliferation |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13844132 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2898148 Country of ref document: CA |
|
REEP | Request for entry into the european phase |
Ref document number: 2013844132 Country of ref document: EP |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2013844132 Country of ref document: EP Ref document number: 14433160 Country of ref document: US |
|
ENP | Entry into the national phase |
Ref document number: 2015535793 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |