WO2014023708A1 - Substituted hetero-azepinones - Google Patents

Substituted hetero-azepinones Download PDF

Info

Publication number
WO2014023708A1
WO2014023708A1 PCT/EP2013/066431 EP2013066431W WO2014023708A1 WO 2014023708 A1 WO2014023708 A1 WO 2014023708A1 EP 2013066431 W EP2013066431 W EP 2013066431W WO 2014023708 A1 WO2014023708 A1 WO 2014023708A1
Authority
WO
WIPO (PCT)
Prior art keywords
alkyl
methyl
oxo
methylamino
aryl
Prior art date
Application number
PCT/EP2013/066431
Other languages
French (fr)
Inventor
Andrew F. DONNELL
Xiaochun Han
Robert Francis Kester
Norman Kong
Kang Le
Yan Lou
Christophe Michoud
John Anthony Moliterni
Stacy Remiszewski
Kenneth Carey RUPERT
Weiya Yun
Original Assignee
F. Hoffmann-La Roche Ag
Hoffmann-La Roche Inc.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by F. Hoffmann-La Roche Ag, Hoffmann-La Roche Inc. filed Critical F. Hoffmann-La Roche Ag
Priority to KR20157005929A priority Critical patent/KR20150041647A/en
Priority to BR112015001830A priority patent/BR112015001830A2/en
Priority to JP2015525858A priority patent/JP6266617B2/en
Priority to US14/418,383 priority patent/US9394263B2/en
Priority to CA2877048A priority patent/CA2877048A1/en
Priority to EP13747659.4A priority patent/EP2882725A1/en
Priority to RU2015105561A priority patent/RU2015105561A/en
Priority to CN201380035993.XA priority patent/CN104470905B/en
Priority to MX2015001720A priority patent/MX2015001720A/en
Publication of WO2014023708A1 publication Critical patent/WO2014023708A1/en
Priority to HK15107346.9A priority patent/HK1206740A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D267/00Heterocyclic compounds containing rings of more than six members having one nitrogen atom and one oxygen atom as the only ring hetero atoms
    • C07D267/02Seven-membered rings
    • C07D267/08Seven-membered rings having the hetero atoms in positions 1 and 4
    • C07D267/12Seven-membered rings having the hetero atoms in positions 1 and 4 condensed with carbocyclic rings or ring systems
    • C07D267/14Seven-membered rings having the hetero atoms in positions 1 and 4 condensed with carbocyclic rings or ring systems condensed with one six-membered ring
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/553Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having at least one nitrogen and one oxygen as ring hetero atoms, e.g. loxapine, staurosporine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/554Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having at least one nitrogen and one sulfur as ring hetero atoms, e.g. clothiapine, diltiazem
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D267/00Heterocyclic compounds containing rings of more than six members having one nitrogen atom and one oxygen atom as the only ring hetero atoms
    • C07D267/02Seven-membered rings
    • C07D267/08Seven-membered rings having the hetero atoms in positions 1 and 4
    • C07D267/12Seven-membered rings having the hetero atoms in positions 1 and 4 condensed with carbocyclic rings or ring systems
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D281/00Heterocyclic compounds containing rings of more than six members having one nitrogen atom and one sulfur atom as the only ring hetero atoms
    • C07D281/02Seven-membered rings
    • C07D281/04Seven-membered rings having the hetero atoms in positions 1 and 4
    • C07D281/08Seven-membered rings having the hetero atoms in positions 1 and 4 condensed with carbocyclic rings or ring systems
    • C07D281/10Seven-membered rings having the hetero atoms in positions 1 and 4 condensed with carbocyclic rings or ring systems condensed with one six-membered ring
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/06Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings
    • C07D413/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D413/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D413/14Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and oxygen atoms as the only ring hetero atoms containing three or more hetero rings
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/06Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a carbon chain containing only aliphatic carbon atoms
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D417/00Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00
    • C07D417/02Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings
    • C07D417/12Heterocyclic compounds containing two or more hetero rings, at least one ring having nitrogen and sulfur atoms as the only ring hetero atoms, not provided for by group C07D415/00 containing two hetero rings linked by a chain containing hetero atoms as chain links
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D498/00Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms
    • C07D498/02Heterocyclic compounds containing in the condensed system at least one hetero ring having nitrogen and oxygen atoms as the only ring hetero atoms in which the condensed system contains two hetero rings
    • C07D498/10Spiro-condensed systems

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

There are provided compounds of the formula (1) wherein W, X, Y, Z, R1, R2, R3, R4, R5 and R6 are described herein. These compounds are useful for the treatment of proliferative diseases, including cancer.

Description

SUBSTITUTED HETERO-AZEPINONES
Field of the Invention
The present invention relates to substituted hetero-azepinones and their use to inhibit SMAC protein binding to Inhibitor of Apoptosis Proteins (IAPs) and/or inhibit activated caspase proteins binding to IAPs for the treatment of human diseases such as cancer.
Background of the Invention
Cancer is a disease of uncontrolled cell growth causing local expansion of a tumor and, potentially, distant metastases. One mechanism by which cancer cells grow is by avoidance of apoptosis, or programmed cell death. Alterations in apoptotic pathways have been linked to cancer cells being resistant to standard treatments, e.g., chemotherapeutics or radiation, and to the incidence and progression of cancer.
The two basic pathways for apoptotic cell death are the intrinsic pathway and the extrinsic pathway. The intrinsic apoptotic pathway can be initiated by various mechanisms including cellular stress, drug-induced damage or DNA damage. The extrinsic pathway can be initiated by activation of the death receptors by a chemokine. Initiation of either pathway results in the activation of a family of proteases called caspases. Once activated, the caspases can act to cleave a variety of substrates creating a cascade of events that lead to the activation of the effector caspases 3 and 7 and eventual cell death. The IAP family of proteins can bind to and inhibit the activity of caspases thus inhibiting apoptosis.
The IAPs can contain up to three copies of homologous structural domains called baculoviral IAP repeat (BIR) domains, BIR1, BIR2 and BIR3. The BIR3 domain of the prototypical IAPs, cIAP and XIAP, can bind to and inhibit activated caspase 9. The BIR2 domain, in contrast, binds to and inhibits caspases 3 and 7. The proapoptotic protein Smac (also known as DIABLO) can bind to the BIR2 and BIR3 domains of IAPs competing with activated caspases resulting in release of the activated caspases from the IAPs and completion of the apoptotic program. Peptides and small molecules have been reported to bind to the Bir3 region of XIAP and cIAP, mimicking the action of Smac protein, releasing activated caspased inhibited by IAPs. Targeting the Bir2 region of IAPs, including XIAP, with small molecules has been less explored.
Summary of the Invention
SMU 17.07.2013 The present invention relates to compounds of general Formula 1 or pharmaceutically acceptable salts therof:
Figure imgf000003_0001
wherein:
W, X, Y, Z, Rl , R2, R3, R4, R5 and R6 are described in this application. These compounds bind to the BIR2 and/or BIR3 regions of IAP proteins including XIAP and cIAP resulting in activation or reactivation of the caspase cascade and, as such, are useful for the treatment of proliferative diseases, including cancer.
Detailed Description of the Invention
The present invention is directed to compounds of the formula
Figure imgf000003_0002
wherein:
W and X are the same or different and are independently selected from H, alkyl, arylalkyl, cycloalkylalkyl, alkenylalkyl or alkynylalkyl, or X and W together with the nitrogen to which they are bound can form a C2-9-heterocycle, or W together with the nitrogen to which it is bound and Y together with the carbon to which it is bound can form a C3_9-heterocycle;Y is Ci_6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl; Rl is selected from H, halo, Ci-6-alkyl, aryl-Ci-6-alkyl, C3-7- cycloalkyl-Ci-6-alkyl, acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano or SO2R10; R2 is selected from H, halo, Ci-6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10; R3 is selected from H, halo, Ci_6-alkyl, aryl-Ci_ 6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10; R4 is H or Ci-6-alkyl; R5 and R6 are the same or different and are independently selected from H, Ci_6-alkyl, aryl or C3_7-cycloalkyl, or R5 and R6 together with the carbon to which they are bound can form a C4_7-carbocycle or heterocycle and with the proviso that R5 and R6 are not both hydrogen; V is S or O; Z is selected from aryl, heteroaryl, polycyclic aromatics, polycyclic hetero aromatics, mixed aryl and non-aryl polycycles or mixed aryl and non-aryl polyheterocycles; R7 is Ci_6-alkyl, aryl, heteroaryl or sulfonyl; R8 and R9 are the same or different and independently selected from H, Ci-6-alkyl, aryl, aryl-Ci_6-alkyl or heteroaryl-Ci. 6-alkyl; and RIO is Ci_6-alkyl, aryl, heterocyclyl or aryl-Ci-6-alkyl; or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 where
W and X are the same or different and are independently selected from H, Ci_6-alkyl, hydoxy-Ci-6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, C2-6-alkenyl-Ci_6-alkyl, C2-6- alkynyl-Ci-6-alkyl and heterocycle or
X and W together with the nitrogen to which they are bound can form a C2-9- heterocycle, or W together with the nitrogen to which it is bound and Y together with the carbon to which it is bound can form a C3-9-heterocycle;
Y is Ci-6-alkyl, hydoxy-Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, , halo-Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7- cycloalkyl-Ci-6-alkyl, COOH, C(0)NR8 'R9', acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano and SO2R10;
R2 is selected from H, halo, Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano and SO2R10;
R3 is selected from H, halo, Ci_6-alkyl, halo-Ci-6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl- Ci-6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano and SO2R10;
R4 is H or Ci_6-alkyl;
R5 and R6 are the same or different and are independently selected from H, Ci-6-alkyl, Ci-6-alkyl-S-Ci-6-alkyl, Ci_6-alkyl-0-Ci_6-alkyl, aryl and C3-7-cycloalkyl, or
R5 and R6 together with the carbon to which they are bound can form a C4_7-carbocycle or heterocycle, which is optionally substituted by Ci_6-alkyl-S02; V is S, O or S02
Z is selected from Ci-6-alkyl, aryl, optionally substituted by C3-7-cycloalkyl, Ci-6-alkyl, Ci-6-alkoxy, halo, halo-Ci-6- alkoxy, C(0)N(Ci_6-alkyl,Ci_6-alkyl), C(0)NHS02-Ci_6-alkyl, C(0)N(Ci_6-alkyl,hydroxy-Ci_6- alkyl), C(0)N(Ci_6-alkyl,COOH-Ci_6-alkyl), phenyl optionally substituted by cyano, COO-Ci_6- alkyl or COOH; aryl-Ci_6-alkyl, heteroaryl optionally substituted by cyano, Ci-6-alkoxy or phenyl optionally substituted by C(0)N(H,Ci_6-alkyl), cyano or COOH, polycyclic aromatics, polycyclic hetero aromatics, optionally substituted by halo, S02-phenyl, Ci-6-alkyl-phenyl or phenyl optionally substituted by cyano; mixed aryl and non-aryl polycycles and mixed aryl and non-aryl polyheterocycles; optionally substituted by S02-Ci_6-alkyl, oxo, halo or Ci-6-alkyl;
R7 is Ci-6-alkyl, aryl, heteroaryl or sulfonyl;
R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, whereby the alkyl portion is optionally substituted by oxo; and heteroaryl-Ci-6- alkyl,
R8 ' is selected from H and Ci_6-alkyl
R9' is selected from HOOC-Ci_6-alkyl, hydroxy-Ci-6-alkyl and aryl-Ci_6-alkyl, wherein the aryl portion is substituted by COOH, or R8 ' and R9' form together with the nitrogen to which they are attached a heterocyclyl, substituted by hydroxy-Ci_6-alkyl; and
RIO is Ci-6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl or a pharmaceutically acceptable salt thereof. One aspect of the invention is directed to compounds of formula 1 where
W and X are the same or different and are independently selected from H, Ci_6-alkyl, hydoxy-Ci-6-alkyl, and heterocycle or
Y is Ci-6-alkyl or hydoxy-Ci-6-alkyl;
Rl is H, halo, Ci_6-alkyl, halo-Ci_6-alkyl, COOH, C(0)NR8'R9', NR8R9 , N-acyl or N- sulfonyl;
R2 is H, halo, Ci_6-alkyl or cyano;
R3 is H, or halo-Ci-6-alkyl;
R4 is H or Ci_6-alkyl;
R5 and R6 are the same or different and are H, Ci-6-alkyl, Ci-6-alkyl-S-Ci_6-alkyl, Ci_6- alkyl-O-Ci-6-alkyl or C3-7-cycloalkyl, or
R5 and R6 together with the carbon to which they are bound can form a C4_7-carbocycle or heterocycle, which is optionally substituted by Ci_6-alkyl-S02,
V is S or O; S02
Z is selected from Ci-6-alkyl, aryl, optionally substituted by C3-7-cycloalkyl, Ci-6-alkyl, Ci-6-alkoxy, halo, halo-Ci-6- alkoxy, C(0)N(Ci_6-alkyl,Ci_6-alkyl), C(0)NHS02-Ci_6-alkyl, C(0)N(Ci_6-alkyl,hydroxy-Ci_6- alkyl), C(0)N(Ci_6-alkyl,COOH-Ci_6-alkyl), phenyl optionally substituted by cyano, COO-Ci_6- alkyl or COOH; aryl-Ci_6-alkyl, heteroaryl optionally substituted by cyano, Ci_6-alkoxy or phenyl optionally substituted by C(0)N(H,Ci_6-alkyl), cyano or COOH, polycyclic heteroaromatics, optionally substituted by halo, S02-phenyl, Ci-6-alkyl-phenyl or phenyl optionally substituted by cyano; and mixed aryl and non-aryl polyheterocycles; optionally substituted by S02-Ci_6-alkyl, oxo, halo or Ci-6-alkyl; R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, whereby the alkyl portion is optionally substituted by oxo; and heteroaryl-Ci-6- alkyl,
R8' is selected from H and Ci_6-alkyl;
R9' is selected from HOOC-Ci_6-alkyl, hydroxy-Ci_6-alkyl and aryl-Ci_6-alkyl, wherein the aryl portion is substituted by COOH, or R8' and R9' form together with the nitrogen to which they are attached a heterocyclyl, substituted by hydroxy-Ci_6-alkyl; and
RIO is Ci-6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein W is H.
One aspect of the invention is directed to compounds of formula 1 wherein X is Ci_6- alkyl, in particular methyl
One aspect of the invention is directed to compounds of formula 1 wherein Y is Ci_6- alkyl, in particular methyl.
One aspect of the invention is directed to compounds of formula 1 wherein Rl , R2, R3 and R4 are H.
One aspect of the invention is directed to compounds of formula 1 wherein R5 and R6 are individually selected from H and Ci-6-alkyl or form together a C4_7-carbocycle.
One aspect of the invention is directed to compounds of formula 1 wherein R5 and R6 are individually selected from H, Ci-6-alkyl, in particular methyl.
One aspect of the invention is directed to compounds of formula 1 wherein Z is naphthyl, optionally substituted 0-2 substituents selected from halo, Ci-6-alkyl and Ci_6-alkoxy.
One aspect of the invention is directed to compounds of formula 1 wherein W is H, X and Y are methyl, Rl , R2, R3 and R4 are H, V is O, R5 and R6 are individually selected from H, Ci-6-alkyl, in particular methyl, and Z is naphthyl, optionally substituted 0-2 substituents selected from halo, Ci_6-alkyl and Ci_6-alkoxy. One aspect of the invention is directed to compounds of formula 1 wherein W is H, X and Y are methyl, Rl, R2, R3 and R4 are H, V is S, R5 and R6 are individually selected from H, Ci-6-alkyl, in particular methyl, and Z is naphthyl, optionally substituted 0-2 substituents selected from halo, Ci_6-alkyl and Ci_6-alkoxy.
One aspect of the invention is directed to compounds of formula 1 wherein W is H, X and Y are methyl, Rl, R2, R3 and R4 are H, V is O, R5 and R6 form together C4_7-carbocycle, and Z is naphthyl, optionally substituted 0-2 substituents selected from halo, Ci_6-alkyl and Ci_6- alkoxy.
One aspect of the invention is directed to compounds of formula 1 wherein W is H, X and Y are methyl, Rl, R2, R3 and R4 are H, V is S, R5 and R6 form together C4-7-carbocycle, and Z is naphthyl, optionally substituted 0-2 substituents selected from halo, Ci_6-alkyl and Ci_6- alkoxy.
One aspect of the invention is directed to compounds of formula 1 wherein
W and X are the same or different and are independently selected from H, Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, C2-6-alkenyl-Ci_6-alkyl or C2-6-alkynyl-Ci_6-alkyl, or
X and W together with the nitrogen to which they are bound can form a C2-9- heterocycle, or W together with the nitrogen to which it is bound and Y together with the carbon to which it is bound can form a C3-9-heterocycle;
Y is Ci-6-alkyl, or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano or SO2R10;
R2 is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10;
R3 is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10;
R4 is H or Ci_6-alkyl; R5 and R6 are the same or different and are independently selected from H, Ci_6-alkyl, aryl or C3-7-cycloalkyl, or
R5 and R6 together with the carbon to which they are bound can form a C4_7-carbocycle or heterocycle, with the proviso that R5 and R6 are not both hydrogen;
V is S or O;
Z is selected from aryl, heteroaryl polycyclic aromatics, polycyclic heteroaromatics, mixed aryl and non-aryl polycycles or mixed aryl and non-aryl polyheterocycles; R7 is Ci-6-alkyl, aryl, heteroaryl or sulfonyl;
R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, or heteroaryl-Ci-6-alkyl,
RIO is Ci-6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein
Figure imgf000009_0001
wherein: X is selected from Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, C2-6-alkenyl- Ci-6-alkyl or C2-6-alkynyl-Ci_6-alkyl;
Y is selected from Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano or SO2R10;
R2 is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10;
R3 is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano or SO2R10;
R4 is selected from H or Ci_6-alkyl;
R5 and R6 are the same or different and independently selected from H, Ci_6-alkyl, aryl or C3-7-cycloalkyl-Ci_6-alkyl, or R5 and R6 together with the carbon to which they are bound can form a C3_7-carbocycle or heterocycle with the proviso that R5 and R6 are not both hydrogen;
V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics, polycyclic hetero aromatics, mixed aryl and non-aryl polycycles or mixed aryl and non-aryl polyheterocycles;
R7 is selected from Ci_6-alkyl, aryl, heteroaryl or sulfonyl;
R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl or heteroaryl-Ci-6-alkyl;
RIO is selected from Ci_6-alkyl, aryl, heterocyclyl or aryl-Ci-6-alkyl; or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein
Figure imgf000011_0001
wherein:
X is selected from Ci-6-alkyl, aryl-Ci_6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Y is selected from Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2RIO; R2 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2RIO; R3 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2RIO; R4 is selected from H or Ci_6-alkyl;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics;
R7 is selected from Ci_6-alkyl, aryl, heteroaryl or sulfonyl;
RIO is selected from Ci_6-alkyl, aryl, heterocyclyl or aryl-Ci-6-alkyl; or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein
X is selected from methyl, ethyl, methyl-d3, ethyl-d5, n-propyl; i-propyl, 2-hydroxyethyl, 3-hydroxypropyl, cyclopropyl, cyclobutyl, cyclopentyl or oxetan-3-yl; Y is selected from methyl, ethyl, cyclopropyl, methylcycloproplyl, hydroxymethyl, (S)-l- hydroxyethyl or (R)-l -hydro xyethyl;
Rl is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano;
R2 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano;
R3 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano;
R4 is selected from H or Ci_6-alkyl;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
Y is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; R7 is selected from Ci_6-alkyl, aryl, heteroaryl or sulfonyl; or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein X is selected from methyl, ethyl, methyl-d3, ethyl-d5 or 2-hydro xyethyl;
Y is selected from methyl, ethyl, cyclopropyl, hydroxymethyl or (S)-l -hydroxy ethyl; Rl is selected from H, halo, Ci_6-alkyl, acyl, N-acyl or N-sulfonyl, cyano;
R2 is selected from H, halo, Ci_6-alkyl, acyl, N-acyl or N-sulfonyl, cyano; R3 is selected from H, halo, Ci_6-alkyl, acyl, N-acyl, N-sulfonyl or cyano; R4 is selected from H, methyl or ethyl;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle; V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein X is selected from methyl, ethyl, methyl-d3, ethyl-d5 or 2-hydroxyethyl;
Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R4 is H;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein X is selected from methyl, ethyl, methyl-d3 or ethyl-d5;
Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
V is O;
Z is selected from 2,5-disubstituted phenyl, 2-substituted-naphthalen-l-yl, 2,5- disubstituted-naphthalen-l-yl, 2,6-disubstituted-naphthalen-l-yl, 2,7-disubstituted-naphthalen-l- yl, 5-substituted-naphthalen-l-yl, 1 -substituted- lH-indazol-3-yl, benzo[d]isoxazole-3-yl, 4- quinolinyl, 5-quinolinyl, 3-substituted-quinolin-4-yl, l,2-disubstituted-indol-3-yl, 1,6- disubstituted-lH-indazol-3-yl, 1 -substituted- 1 ,3 -dihydro-indol-2-one-4-yl, 1 ,6-lH-quinolin-2- one-4-yl, 2-substituted-2,3-dihydro-lH-isoindol-4-yl, 2-(4-methyl-indol-l-yl)-benzonitrile or 1- substituted-indol-4-yl; or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5;
Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano;
R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano;
R3 is selected from H, F, CI, Br or cyano;
R4 is H;
R5 and R6 are methyl or H but are not both hydrogen; V is O;
Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difiuoromethoxy-naphthalen- 1 -yl,
Figure imgf000015_0001
or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5;
Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano;
R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; selected from H, F, CI, Br or cyano;
R4 is H;
R5 and R6 together form a ring selected from
Figure imgf000015_0002
V is O;
Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difiuoromethoxy-naphthalen- 1 -yl,
Figure imgf000016_0001
or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5;
Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano;
R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano;
R3 is selected from H, F, CI, Br or cyano;
R4 is H;
* *C H3
R5 is *
Figure imgf000016_0002
V is O;
Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difiuoromethoxy-naphthalen- 1 -yl,
Figure imgf000017_0001
or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5;
Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano;
R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano;
R3 is selected from H, F, CI, Br or cyano;
R4 is H;
R5 is *
ΟΗ3
R6 is * V is O;
Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difiuoromethoxy-naphthalen- 1 -yl,
Figure imgf000018_0001
or a pharmaceutically acceptable salt thereof.
One aspect of the invention is directed to compounds of formula 1 wherein the compound is selected from
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-4,5-dihydro-3H- spiro[benzo[b][l,4]oxazepine-2,r-cyclohexane]-3-yl)-2-(methylamino)propanamide
hydrochloride;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-2-naphthoic acid trifluoroacetate;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-N-(methylsulfonyl)-2-naphthamide trifluoroacetate ;
(R)-N- [(S)-5 -(6 -Bromo-2-methoxy-naphthalen- 1 -ylmethyl)-2 ,2-dimethyl-4-oxo-2 ,3 ,4,5 - tetrahydro-benzo[b][l,4]thiazepin-3-yl]-2-methylamino-propionamide hydrochloride
(S)-N-(5-Benzyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2- methylaminopropanamide hydrochloride ;
N-(5-Benzyl-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride ;
N-(5-(4-Phenyl-butyl)-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride; N-(5-Biphenyl-3-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-yl)-2-(S)- methylamino-propionamide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-8,9-difluoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8,9-difluoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride and
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride .
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride;
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(2- hydroxyethylamino)prop anamide ; (2S)-N-(5-((3-Methoxyquinolin-N-oxide-4-yl)methyl)-(3S)-4-oxo-2',3',5',6'-tetrahydro- 3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'^yran]-3-yl)-2-(methyl-d3-amino)propanami hydrochloride;
(2S)-N-(5-((6-Bromo-2-(methoxy-d3)-naphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'^yran]-3-yl)-2-(methyl-d3-amino)propanamide hydrochloride;
(R)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide ;
(S)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide;
(S)-N-{(R)-9-[2-(2-Methoxy-ethoxy)-acetylamino]-5-naphthalen-l-ylmethyl-4-oxo- 2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3-yl} -2-methylamino-propionamide hydrochloride;
1 -Acetyl-piperidine-4-carboxylic acid [(R)-3-((S)-2-methylamino-propionylamino)-5- naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide and
5- Oxo-hexanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride.
3,4,5-Trimethoxy-N-[(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-benzamide hydrochloride ;
6- Oxo-heptanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride;
(S)-N-((R)-9-Amino-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-yl)-2-methylamino-propionamide hydrochloride;
N-[(R)-3-((S)-2-Methylamino-propionylamino)-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5- tetrahydro-benzo[b][l,4]thiazepin-9-yl]-benzamide hydrochloride ; (S)-N- [(S)-9-(6-Bromo-2-methoxy-naphthalen- 1 -ylmethyl)-8-oxo-6 ,7 ,8 ,9-tetrahydro-5 - oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide trifluoroacetate ;
(S)-N- [(S)-9-(6-Cyclopropyl-2-methoxy-naphthalen- 1 -ylmethyl)-8-oxo-6 ,7 ,8 ,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methyla mino-propionamide trifluoroacetate;
Methyl 6-methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-2-naphthoate trifluoroacetate;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4-dihydrobenzo[b] [l,4]oxazepin-5(2H)-yl)methyl)-2-naphthoic acid trifluoroacetate ;
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid (2-hydroxy-ethyl)-methyl- amide;
4-({6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5- oxa-9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carbonyl}-amino)-butyric acid trifluoroacetate ;
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid dimethylamide trifluoroacetate and
(S)-N-[(S)-9-(7-Bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide trifluoroacetate.
(2S,3R)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8- oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide
trifluoracetate;
(2S,3S)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8- oxo-6,7,8,9-tetrahydro-5-oxa-9-azabenzocyclohepten-7-yl]-3-hydroxy-butyramide
trifluoroacetate ;
(S)-N-((2S,3S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-2,8-dimethyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate; Methyl 5-(((2S,3S)-2,8-dimethyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate trifluoro acetate;
(2S,3S)-2-Amino-N-[(6S,7S)-9-(6-bromo-2-methoxy-naphthalen-l-ylmethyl)-3,6- dimethyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide trifluoro acetate;
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen^
2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
(S)-N-[(6S,7S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-6-methyl-8-oxo-2- trifluoromethyl-6 ,7 ,8 ,9-tetrahydro-5 -oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino- propionamide trifluoroacetate;
(S)-2-Methylamino-N-[(S)-9-(2-methyl-naplitlialen-l-ylrnetliyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-propionamide ;
(S)-N-((S)-5-(2-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-N-((S)-5-(3-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-N-((S)-5-(4-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid trifluoroacetate and
3- {[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- propionic acid trifluoroacetate.
4- ({[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- methyl)-benzoic acid methyl ester; (S)-5-((6-Carboxy-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2^ acid trifluoro acetate ;
5-(((S)-9-((2-Hydroxyethyl)(methyl)carbamoyl)-3-((S)-2-(methylamino)propanamido)-4- oxo-3,4-dihydrobenzo|¾][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoic acid trifluoro acetate;
S)-5-((4-Bromonaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifluoroacetate;
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(2-hydroxyethyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(3-hydroxypropyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((2-Chloro-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo|¾][l ,4]oxazepin-3-yl)-2-(metliylamino)propanamide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indol-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo|¾][l ,4]oxazepin-3-yl)-2-(metliylamino)propanamide;
(S)-N-((S)-5-((2-Chloro-l-(phenylsulfonyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo|¾][l ,4]oxazepin-3-yl)-2-(metliylamino)propanamide;
(S)-N-[(S)-9-(l-Benzenesulfonyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide hydrochloride;
(S)-N-((S)-5-((6-Fluoro-l-methyl-2-oxo-l,2-dihydroquinolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-[(S)-9-(l-Benzyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9-tetrahydro-5-oxa- 9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide and
(S)-N-((S)-5-((l-Ethyl-2-oxoindolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide . (S)-2-Amino-N-((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propan amide;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate ;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(oxetan-3-ylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxy-2 -methylpropylamino)propan amide ;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(2-hydroxyethylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethyl-d5-amino)propanamide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-6-fluoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide;
S)-N-((S)-5-((6-Bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(2S)-N-((2S,3S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide trifluoroacetate;
(S)-N-((R)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2,2-dimethyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]thiazepin-3 -yl)-2-(ethylamino)propanamide and
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide . (S)-N-((2S,3S)-5-((2-Cyano-l -(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide ;
(S)-N-((S)-8-Bromo-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide trifluoroacetate ;
(S)-N-((S)-8-Cyano-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo|¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propanami 2 ,2 ,2 -tri fluoroacetate ;
3-Cyano-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzoic acid trifluoroacetate;
3-Cyano-N-ethyl-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo- 3 ,4-dihydrobenzo [b] [ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzamide trifluoroacetate;
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)butanamide hydrochloride ;
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxyethylamino)butanamide trifluoroacetate ;
(5)-N-((5)-5-(Benzo[ ]isoxazol-3-ylmethyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propanamide hydrochloride;
(5)-N-((5)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(5)-N-((i?)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(S)-N-((S)-5 -((6-Bromo-2-methoxynaphthalen- 1 -yl)methyl)-9-fluoro-4-oxo-2 ,3 ,4,5 - tetrahydrobenzo[¾][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride and (5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide hydrochloride .
(S)-2-(Methylamino)-N-((S)-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-9- (trifluoromethyl)-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propanamide hydrochloride;
(S)-N-((S)-5-(Benzo[d]isoxazol-3-ylmethyl)-4-oxo-9-(trifiuoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(S)-N-((S)-9-Bromo-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(S)-5-((2-Methoxynaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifiuoroacetate and
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide hydrochloride .
One aspect of the invention is directed to compounds of formula 1 where W is H and X is methyl, methyl-d3, ethyl, ethyl-d5, n-propyl, 2-hydroxyethyl, cyclobutyl or oxetan-3-yl.
In another aspect, the invention is directed to compounds of formula 1 where Y is methyl, ethyl, hydro xymethyl, or 1 -hydroxyethyl.
In another aspect, the invention is directed to compounds of formula 1 where Rl is H, Ci_ 6-alkyl, cyano, or halo.
In another aspect, the invention is directed to compounds of formula 1 where R2 is H, Ci_ 6-alkyl, halo, cyano, or alkoxy
In another aspect, the invention is directed to compounds of formula 1 where R3 is H, Ci_ 6-alkyl, halo, cyano, or Ci-6-alkoxy In another aspect, the invention is directed to compounds of formula 1 where R4 is H or Ci-6-alkyl.
In another aspect, the invention is directed to compounds of formula 1 where Z is aryl or aryl-Ci-6-alkyl-bicyclic.
Another aspect of the invention is directed to compounds of the formula II
Figure imgf000027_0001
wherein:
X is selected from Ci-6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, C2-6-alkenylCi_ 6-alkyl or C2-6-alkynylCi_6-alkyl; Y is selected from Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl; Rl is selected from H, halo, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10; R2 is selected from H, halo, Ci_6- alkyl, aryl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N- sulfonyl, cyano or SO2R10; R3 is selected from H, halo, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, C3_7- cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10; R4 is selected from H or Ci_6-alkyl; R5 and R6 are the same or different and independently selected from H, Ci-6-alkyl, aryl or C3_7-cycloalkyl, or R5 and R6 together with the carbon to which they are bound can form a C3_7-carbocycle or heterocycle and with the proviso that R5 and R6 are not both hydrogen; V is selected from S or O; Z is selected from aryl, heteroaryl, polycyclic aromatics, polycyclic hetero aromatics, mixed aryl and non-aryl polycycles or mixed aryl and non-aryl polyheterocycles; R7 is selected from Ci-6-alkyl, aryl, heteroaryl or sulfonyl; R8 and R9 are the same or different and independently selected from H, Ci-6-alkyl, aryl, aryl-Ci_6-alkyl or heteroaryl-Ci-6-alkyl; RIO is selected from Ci_6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl; or a pharmaceutically acceptable salt thereof.
Another aspect of the present invention is compounds of formula III:
Figure imgf000027_0002
wherein: X is selected from Ci_6-alkyl, aryl-Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl; Y is selected from Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl; Rl is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2RIO; R2 is selected from H, halo, Ci-6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2RIO; R3 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N- sulfonyl, cyano or SO2RIO; R4 is selected from H or Ci_6-alkyl; R5 and R6 are the same or different and independently selected from H or Ci-6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3_6-carbocycle or heterocycle V is selected from S or O; Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic hetero aromatics; R7 is selected from Ci-6-alkyl, aryl, heteroaryl or sulfonyl; RIO is selected from Ci-6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl; or a pharmaceutically acceptable salt thereof.
Another aspect of the present invention is the compound of formula III wherein:
X is selected from methyl, ethyl, methyl-d3, ethyl-d5, n-propyl; i-propyl, 2-hydroxyethyl, 3-hydroxypropyl, cyclopropyl, methylcyclopropyl, cyclobutyl, cyclopentyl or oxetan-3-yl;
Y is selected from methyl,ethyl, cyclopropyl, hydroxymethyl, (S)-l -hydroxy ethyl or (R)- 1 -hydro xyethyl; Rl is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano; R2 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano; R3 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano; R4 is selected from H or Ci_6- alkyl; R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are both not hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle; V is selected from S or O; Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; R7 is selected from Ci-6-alkyl, aryl, heteroaryl or sulfonyl; or a pharmaceutically acceptable salt thereof.
Another aspect of the present invention are compounds of formula III wherein:
X is selected from methyl, ethyl, methyl-d3, ethyl-d5 or 2-hydroxyethyl; Y is selected from methyl,ethyl, cyclopropyl, hydroxymethyl or (S)-l -hydro xyethyl; Rl is selected from H, halo, Ci-6-alkyl, acyl, N-acyl, N-sulfonyl or cyano; R2 is selected from H, halo, Ci_6-alkyl, acyl, N-acyl, N-sulfonyl or cyano; R3 is selected from H, halo, Ci_6-alkyl, acyl, N-acyl, N-sulfonyl or cyano; R4 is selected from H, methyl or ethyl; R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are both not hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3_6-carbocycle or heterocycle; V is selected from S or O; Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; or a pharmaceutically acceptable salt thereof.
Another aspect of the present invention relates to compounds of formula III wherein:
X is selected from methyl, ethyl, methyl-d3, ethyl-d5 or 2 -hydroxy ethyl; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N- acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R4 is H; R5 and R6 are the same or different and independently selected from H or Ci-6- alkyl but are both not hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3 - C6 carbocycle or heterocycle; V is selected from S or O; Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; or a pharmaceutically acceptable salt thereof.
Yet another aspect of the present invention relates to compounds of formula III wherein:
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l -hydro xyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H; R5 and R6 are the same or different and independently selected from H or Ci-6-alkyl but are both not hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3_6-carbocycle or heterocycle; V is O; Z is selected from 2,5-disubstituted phenyl, 2-substituted-naphthalen-l-yl, 2,5-disubstituted- naphthalen-l-yl, 2,6-disubstituted-naphthalen-l-yl, 2,7-disubstituted-naphthalen-l-yl, 5- substituted-naphthalen-l-yl, l-substituted-lH-indazol-3-yl, benzo[d]isoxazole-3-yl, 4-quinolinyl, 5-quinolinyl, 3-substituted-quinolin-4-yl, l,2-disubstituted-indol-3-yl, 1,6-disubstituted-lH- indazol-3-yl, 1 -substituted- l,3-dihydro-indol-2-one-4-yl, l,6-lH-quinolin-2-one-4-yl, 2- substituted-2,3-dihydro-lH-isoindol-4-yl, 2-(4-Methyl-indol-l-yl)-benzonitrile or 1 -substituted- indol-4-yl; or a pharmaceutically acceptable salt thereof.
Another aspect of the present invention relates to compounds of formula III wherein:
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l -hydro xyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H; R5 and R6 are methyl or H but are not both hydrogen; V is O; Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3- methoxy)-naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2,2,2-trifluoroethoxy)naphthalen-l-yl, 2-difluoromethoxy-naphthalen-l-yl,
Figure imgf000030_0001
or a pharmaceutically acceptable salt thereof.
Yet another aspect of the present invention relates to compounds of formula III wherein:
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l -hydro xyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selecte F, CI, Br or cyano; R4 is H; R5 and R6 together form a ring selected from °0*
Figure imgf000031_0001
V is O; Z is selected from 5-bromo-2-methoxynaphthalen-l-yl,
6-bromo-2-(d3-methoxy)-naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy- quinolin-4-yl, quinolin-4-yl, 2-(2,2,2-trifluoroethoxy)naphthalen-l-yl, 2-difiuoromethoxy- naphthalen-l-yl,
Figure imgf000031_0002
or a pharmaceutically acceptable salt thereof.
Another aspect of the present invention relates to compounds of formula III wherein:
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l -hydro xyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl,
N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or
CH3 ,,>sn H3 cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H; R5 is ; R6 is V is
O; Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)-naphthalen-
1-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2,2,2- trifiuoroethoxy)naphthalen-l -yl, 2-difiuoromethoxy-naphthalen- 1 -yl,
Figure imgf000032_0001
or a pharmaceutically acceptable salt thereof.
Another aspect of the present invention relates to compounds of formula III wherein:
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l -hydro xyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H; R5 is , R6 is , V is O; Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)-naphthalen-l-yl, 6- bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2,2,2- trifiuoroethoxy)naphthalen-l -yl, 2-difluoromethoxy-naphthalen- 1 -yl,
Figure imgf000032_0002
or a pharmaceutically acceptable salt thereof.
Another aspect of the invention relates to compounds of the formula (2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-4,5-dihydro-3H- spiro[benzo|¾][l,4]oxazepine-2,r-cyclohexane]-3-yl)-2-(methylamino)propanamide
hydrochloride;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-2-naphthoic acid trifluoroacetate;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo|¾][l,4]oxazepine-2,4'^yran]-5(4H)-yl)methyl)-N-(methylsulfonyl)-2-naphthamide trifluoroacetate ;
(R)-N- [(S)-5 -(6 -Bromo-2-methoxy-naphthalen- 1 -ylmethyl)-2 ,2-dimethyl-4-oxo-2 ,3 ,4,5 - tetrahydro-benzo[b][l,4]thiazepin-3-yl]-2-methylamino-propionamide hydrochloride
(S)-N-(5-Benzyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2- methylaminopropanamide hydrochloride ;
N-(5-Benzyl-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride ;
N-(5-(4-Phenyl-butyl)-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride;
N-(5-Biphenyl-3-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-yl)-2-(S)- methylamino-propionamide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-8,9-difluoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8,9-difluoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride; (2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fluoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride;
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(2- hydroxyethylamino)prop anamide ;
(2S)-N-(5-((3-Methoxyquinolin-N-oxide-4-yl)methyl)-(3S)-4-oxo-2',3',5',6'-tetrahydro- 3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methyl-d3-amino)propanamide hydrochloride;
(2S)-N-(5-((6-Bromo-2-(methoxy-d3)-naphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methyl-d3-amino)propanamide hydrochloride;
(R)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide ; (S)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo|¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide;
(S)-N-{(R)-9-[2-(2-Methoxy-ethoxy)-acetylamino]-5-naphthalen-l-ylmethyl-4-oxo- 2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3-yl} -2-methylamino-propionamide hydrochloride;
1 -Acetyl-piperidine-4-carboxylic acid [(R)-3-((S)-2-methylamino-propionylamino)-5- naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide;
5- Oxo-hexanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride;
3,4,5-Trimethoxy-N-[(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-benzamide hydrochloride ;
6- Oxo-heptanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride;
(S)-N-((R)-9-Amino-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-yl)-2-methylamino-propionamide hydrochloride;
N-[(R)-3-((S)-2-Methylamino-propionylamino)-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5- tetrahydro-benzo[b][l,4]thiazepin-9-yl]-benzamide hydrochloride ;
(S)-N- [(S)-9-(6-Bromo-2-methoxy-naphthalen- 1 -ylmethyl)-8-oxo-6 ,7 ,8 ,9-tetrahydro-5 - oxa-9-aza-benzocyclohepten-7-yl] -2-methylamino-propionamide trifluoroacetate ;
(S)-N-[(S)-9-(6-Cyclopropyl-2-methoxy-naphthalen-l-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methyla mino-propionamide trifluoroacetate;
Methyl 6-methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-2-naphthoate trifluoroacetate;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-2-naphthoic acid trifluoroacetate ;
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid (2-hydroxy-ethyl)-methyl- amide; 4-({6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5- oxa-9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carbonyl}-amino)-butyric acid trifluoroacetate ;
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid dimetfrylamide trifluoroacetate;
(S)-N-[(S)-9-(7-Bromo-3-methoxy-naplitlialen-2-ylmetliyl)-3-metliyl-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide trifluoroacetate;
(2S,3R)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl- oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide
trifluoracetate;
(2S,3S)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8 oxo-6,7,8,9-tetrahydro-5-oxa-9-azabenzocyclohepten-7-yl]-3-hydroxy-butyramide
trifluoroacetate ;
(S)-N-((2S,3S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-2,8-dimethyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
Methyl 5-(((2S,3S)-2,8-dimethyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo|¾][l,4]oxazepin-5(2H)-yl)metliyl)-6-metlioxy-2-naplitlioate trifluoroacetate;
(2S,3S)-2-Amino-N-[(6S,7S)-9-(6-bromo-2-methoxy-naplitlialen-l-ylmetliyl)-3,6- dimethyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide trifluoroacetate;
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-7-(trifluorometh^ 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
(S)-N-[(6S,7S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-6-rnethyl-8-oxo-2- trifluoromethyl-6 ,7 ,8 ,9-tetrafrydro-5 -oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino- propionamide trifluoroacetate;
(S)-2-Methylamino-N-[(S)-9-(2-methyl-naphthalen-l-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-propionamide ; (S)-N-((S)-5-(2-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-N-((S)-5-(3-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-N-((S)-5-(4-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid trifluoro acetate;
3- {[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- propionic acid trifluoro acetate;
4- ({[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- methyl)-benzoic acid methyl ester;
(S)-5-((6-Carboxy-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid trifluoro acetate ;
5- (((S)-9-((2-Hydroxyethyl)(methyl)carbamoyl)-3-((S)-2-(methylamino)propanamido)-4- oxo-3,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoic acid trifluoro acetate;
S)-5-((4-Bromonaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifluoroacetate;
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(2-hydroxyethyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(3-hydroxypropyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide; (S)-N-((S)-5-((2-Chloro-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indol-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((2-Chloro-l-(phenylsulfonyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-[(S)-9-(l-Benzenesulfonyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide hydrochloride;
(S)-N-((S)-5-((6-Fluoro-l-methyl-2-oxo-l,2-dihydroquinolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-[(S)-9-(l-Benzyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9-tetrahydro-5-oxa- 9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide;
(S)-N-((S)-5-((l-Ethyl-2-oxoindolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-2-Amino-N-((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propan amide;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate ;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(oxetan-3-ylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxy-2 -methylpropylamino)propan amide ;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(2-hydroxyethylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide; (S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethyl-d5-amino)propanamide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-6-fluoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide;
S)-N-((S)-5-((6-Bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo|¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(2S)-N-((2S,3S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide trifluoroacetate;
(S)-N-((R)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2,2-dimethyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]thiazepin-3 -yl)-2-(ethylamino)propanamide ;
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide ;
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide ;
(S)-N-((S)-8-Bromo-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide trifluoroacetate ;
(S)-N-((S)-8-Cyano-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide 2 ,2 ,2 -tri fluoroacetate ;
3-Cyano-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzoic acid trifluoroacetate;
3-Cyano-N-ethyl-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo- 3 ,4-dihydrobenzo [b] [ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzamide trifluoroacetate; (5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-yl)-2-(methylamino)butanamide hydrochloride;
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxyethylamino)butanamide trifluoroacetate ;
(5)-N-((5)-5-(Benzo[ ]isoxazol-3-ylmethyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propanamide hydrochloride;
(5)-N-((5)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(5)-N-((i?)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(S)-N-((S)-5 -((6-Bromo-2-methoxynaphthalen- 1 -yl)methyl)-9-fluoro-4-oxo-2 ,3 ,4,5 - tetrahydrobenzo[¾][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)- 2,3,4,5-tetrahydrobenzo[¾][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(S)-2-(Methylamino)-N-((S)-5-((2-methylnaphthalen-l -yl)methyl)-4-oxo-9- (trifluoromethyl)-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propanamide hydrochloride;
(S)-N-((S)-5-(Benzo[d]isoxazol-3-ylmethyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(S)-N-((S)-9-Bromo-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(S)-5-((2-Methoxynaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifluoroacetate and
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide hydrochloride . A preferred aspect of the invention are compounds of the formula
(2 S)-N-(5 -((6 -bromo-2 -methoxynaphthalen- 1 -yl)methyl)-2 ,2-dimethyl-4-oxo-2 ,3 ,4 ,5 - tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(2S)-N-(5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-4,5-dihydro-3H- spiro[benzo[b][l,4]oxazepine-2,3'-oxetane]-3-yl)-2-(methylamino)propanamide 2,2,2- trifiuoro acetate;
(2 S)-N-(5 -((6 -bromo-2 -methoxynaphthalen- 1 -yl)methyl)-2-(methoxymethyl)-2 -methyl- 4-0X0-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2 -(methylamino)propan amide
hydrochloride;
(2S,3S)-2-amino-N-(5-((6-bromo-2 -methoxynaphthalen- 1 -yl)methyl)-4-oxo- 2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-3- hydroxybutan amide hydrochloride;
(S)-N-((S)-5-((3-methoxyquinolin-4-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propanamide dihydrochloride;
(S)-2-(methylamino)-N-((S)-4-oxo-5-(quinolin-4-ylmethyl)-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)propanamide dihydrochloride;
(S)-2-(methylamino)-N-((S)-4-oxo-5-((2-(2,2,2-trifluoroethoxy)naphthalen-l-yl)methyl)- 2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)propanamide hydrochloride;
(S)-N-((S)-5-((2-Chloro-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxyethylamino)butanamide trifluoroacetate ;
(S)-N-((S)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride; (S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo|¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(2-hydroxyethylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethyl-d5-amino)propanamide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-6-fluoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(2S)-N-((2S,3S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide trifluoroacetate;
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide ;
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide;
(S)-N-((S)-8-Cyano-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide 2,2,2-trifluoroacetate and
3-Cyano-N-ethyl-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo- 3 ,4-dihydrobenzo [b] [ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzamide trifluoroacetate.
A certain aspect of this invention relates to a compound as defined herein for use as therapeutically active substance.
A certain aspect of this invention relates to a compound according to any one of claims 1 to 20 for use in the treatment or prophylaxis of cancer.
A certain aspect of this invention relates to a pharmaceutical composition comprising a compound as defined herein and a therapeutically inert carrier. A certain aspect of this invention relates to an use of a compound as defined herein for the treatment or prophylaxis of cancer.
A certain aspect of this invention relates to an use of a compound as defined herein for the preparation of a medicament for the treatment or prophylaxis of cancer.
A certain aspect of this invention relates to a method for the treatment or prophylaxis of cancer, which method comprises administering an effective amount of a compound as defined herein.
Definitions
As used herein, the following terms shall have the following definitions.
The term "alkyl" refers to straight- or branched-chain saturated hydrocarbon groups having from 1 to about 12 carbon atoms, including groups having from 1 to about 7 carbon atoms and from 1 to 6 carbons. In certain embodiments, alkyl substituents may be lower alkyl substituents. The term "lower alkyl" refers to alkyl groups having from 1 to 6 carbon atoms (Ci_ 6-alkyl), preferably from 1 to 4 carbon atoms (Ci-4-alkyl). Examples of alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, i-propyl, n-butyl, s-butyl, t-butyl, n-pentyl, and s- pentyl. The alkyl group can be optionally enriched in deuterium, e.g., -CD3, -CD2CD3 and the like.
The term "alkenyl" as used herein means an unsaturated straight-chain or branched aliphatic hydrocarbon group containing at least one double bond and having 2 to 6 (C2_6-alkenyl), preferably 2 to 4 carbon atoms (C2_4-alkenyl). Examples of such "alkenyl group" are vinyl, ethenyl, allyl, isopropenyl, 1 -propenyl, 2-methyl-l -propenyl, 1-butenyl, 2-butenyl, 3-butenyl, 2- ethyl-l-butenyl, 3-methyl-2-butenyl, 1-pentenyl, 2-pentenyl, 3-pentenyl, 4-pentenyl, 4-methyl-3- pentenyl, 1-hexenyl, 2-hexenyl, 3-hexenyl, 4-hexenyl and 5-hexenyl.
"C2-6-alkenyl-Ci_6-alkyl" refers to an Ci_6-alkyl as defined herein linked to an C2_6- alkenyl as defined herein.
"Alkoxy, alkoxyl or lower alkoxy" refers to any of the above lower alkyl groups which is attached to the remainder of the molecule by an oxygen atom (RO-). Ci_6-alkoxy refers to alkoxy groups where the alkyl moiety is having from 1 to 6 carbon atoms Typical lower alkoxy groups include methoxy, ethoxy, isopropoxy or propoxy, butyloxy and the like. Further included within the meaning of alkoxy are multiple alkoxy side chains, e.g. ethoxy ethoxy, methoxy ethoxy, methoxy ethoxy ethoxy and the like and substituted alkoxy side chains, e.g., dimethylamino ethoxy, diethylamino ethoxy, dimethoxy-phosphoryl methoxy and the like.
The term "alkynyl" as used herein means an unsaturated straight-chain or branched aliphatic hydrocarbon group containing one triple bond and having 2 to 6 (C2-6-alkynyl), preferably 2 to 4 carbon atoms (C2-4-alkynyl). Examples of such "alkynyl group" are ethynyl, 1- propynyl, 2-propynyl, 1-butynyl, 2-butynyl, 3-butynyl, 1 -pentynyl, 2-pentynyl, 3-pentynyl, 4- pentynyl, 1-hexynyl, 2-hexynyl, 3-hexynyl, 4-hexynyl and 5-hexynyl.
"C2-6-alkynyl-Ci_6-alkyl" refers to an Ci_6-alkyl as defined herein linked to an C2-6- alkynyl as defined herein.
"Acyl" substituents include groups of the fomula -C(0)Rl l where Rl l is H, alkyl, aryl, arylalkyl, heterocyclyl, for example, acetyl, propionyl, nicotinyl and the like.
"Sulfonyl" substituents include groups of the fomula -S02R11 for example, methanesulfonyl, benzenesulfonyl, tosyl and the like.
Amino means the group -NH2.
"Aryl" means a monocyclic, bicyclic or polycyclic aromatic carbocyclic or heterocyclic radical, preferably a 6 - 14 member aromatic ring system. Preferred aryl groups include, but are not limited to, phenyl, naphthyl, tolyl, xylyl, pyridinyl, quinolinyl, pyrimidinyl, imidazole, thiazole and tetrazolyl. Aryl groups can be optionally substituted by, for example, lower alkyl, cycloalkyl, e.g., cyclopropyl, trihalo-lower alkyl, e.g., trifluoromethyl, hydroxyl, alkoxy. When two or more substituents are present on an aryl or heteroaryl ring they may also be present in the form of a fused ring. Such fused rings include, but are not limited to, 3,4-methylenedioxyphenyl and 3,4-ethylenedioxyphenyl.
"Aryl" means a monovalent, monocyclic or bicyclic, aromatic carboxylic hydrocarbon radical, preferably a 6-10 member aromatic ring system. Preferred aryl groups include, but are not limited to, phenyl, naphthyl, tolyl, and xylyl. A particular aryl is phenyl.
"aryl-Ci-6-alkyl" refers to an Ci_6-alkyl as defined herein linked to an aryl as defined herein.
"C3-7-cycloalkyl-Ci_6-alkyl" refers to an Ci_6-alkyl as defined herein linked to an C3-7- cycloalkyl as defined herein. "carbocycle" or "carbocyclic ring" refers to a ring containing carbon.
"Carboxyl or carboxy" means the monovalent group -COOH. Carboxy lower alkyl means -COOR, wherein R is lower alkyl. "Carboxy lower alkoxy" means -COOROH wherein the R is lower alkyl.
o
c
\
Carbonyl means the group R' R" , where R' and R" independently can be any of a number of chemical groups including alkyl.
The term "cycloalkyl" as used herein means any stable monocyclic or polycyclic system which consists of carbon atoms only, any ring of which being saturated, and the term "cycloalkenyl" is intended to refer to any stable monocyclic or polycyclic system which consists of carbon atoms only, with at least one ring thereof being partially unsaturated. A specific cycloalkyl is "C3_7-cycloalkyl", that is a cycloalkyl with 3 to 7 carbons. Examples of cycloalkyls include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, adamantyl, cyclooctyl, bicycloalkyls, including bicyclooctanes such as [2.2.2]bicyclooctane or [3.3.0]bicyclooctane, bicyclononanes such as [4.3.0]bicyclononane, and bicyclodecanes such as [4.4.0]bicyclodecane (decalin), or spiro compounds. Examples of cycloalkenyls include, but are not limited to, cyclopentenyl or cyclohexenyl.
The term "C3-7-cycloalkyl-Ci-6-alkyl" as used herein refers to a C3-7-cycloalkyl group linked to a Ci-6-alkyl group.
The terms "halogen" or "halo"as used herein means fluoro (F), chloro (CI), bromo (Br), or iodo (I), preferably fluoro and chloro.
"halo-Ci-6-alkyl" refers to a Ci-6-alkyl as defined herein substituded with 1 or 2 halogen groups.
"Heteroaryl" means an aromatic heterocyclic ring system containing up to two rings. Preferred heteroaryl groups include, but are not limited to, thienyl, furyl, indolyl, pyrrolyl, pyridinyl, pyrazinyl, oxazolyl, thiaxolyl, quinolinyl, pyrimidinyl, imidazole substituted or unsubstituted triazolyl and substituted or unsubstituted tetrazolyl.
In the case of aryl or heteroaryl which are bicyclic it should be understood that one ring may be aryl while the other is heteroaryl and both being substituted or unsubstituted. "Hetero atom" means an atom selected from N, O and S.
"Heterocycle", "heterocyclyl" or "heterocyclic ring" means a substituted or unsubstituted 5 to 8 membered, mono- or bicyclic, non-aromatic hydrocarbon, wherein 1 to 3 carbon atoms are replaced by a hetero atom selected from nitrogen, oxygen or sulfur atom. Examples include pyrrolidin-2-yl; pyrrolidin-3-yl; piperidinyl; morpholin-4-yl and the like which in turn can be substituted.
Hydroxy or hydroxyl is a prefix indicating the presence of a monovalent -O-H group.
"hydroxy-Ci-6-alkyl" refers to a Ci-6-alkyl as defined herein substituded with 1 or 2 hydroxy groups.
"Lower" as in "lower alkenyl" means a group having 1 to 6 carbon atoms.
"mixed aryl and non-aryl polycycles" refers to ring systems of 2 rings, wherein one ring is an aryl as defined herein and the other ring is a cycloalkyl as defined herein.
"mixed aryl and non-aryl polyheterocycles" refers to ring systems of 2 rings, wherein one ring is an aryl as defined herein and the other ring is a heterocyclyl as defined herein.
"Nitro" means -N02.
Oxo means the group =0.
"Substituted," as in e.g.substituted alkyl, means that the substitution can occur at one or more positions and, unless otherwise indicated, that the substituents at each substitution site are independently selected from the specified options. The term "optionally substituted" refers to the fact that one or more hydrogen atoms of a chemical group (with one or more hydrogen atoms) can be, but does not necessarily have to be, substituted with another substituent. In the specification where indicated the various groups may be substituted by preferably, 1-3 substituents independently selected from the group consisting of H, carboxyl, amido, hydroxyl, alkoxy, substituted alkoxy, sulfide, sulfone, sulfonamide, sulfoxide, halogen, nitro, amino, substituted amino, lower alkyl, substituted lower alkyl, oxyalkyl, lower cycloalkyl, substituted lower cycloalkyl, lower alkenyl, substituted lower alkenyl, lower cycloalkenyl, substituted lower cycloalkenyl, acyl, acylamino, aryl, substituted aryl, heteroaryl, substituted heteroaryl, heterocycle or substituted heterocycle. "Pharmaceutically acceptable," such as pharmaceutically acceptable carrier, excipient, etc., means pharmacologically acceptable and substantially non-toxic to the subject to which the particular compound is administered.
"Pharmaceutically acceptable salt" refers to conventional acid-addition salts or base- addition salts that retain the biological effectiveness and properties of the compounds of the present invention and are formed from suitable non-toxic organic or inorganic acids or organic or inorganic bases. Sample acid-addition salts include those derived from inorganic acids such as hydrochloric acid, hydrobromic acid, hydroiodic acid, sulfuric acid, sulfamic acid, phosphoric acid and nitric acid, and those derived from organic acids such as p-toluenesulfonic acid, salicylic acid, methanesulfonic acid, oxalic acid, succinic acid, citric acid, malic acid, lactic acid, fumaric acid, trifluoro acetic acid and the like. Sample base-addition salts include those derived from ammonium, potassium, sodium and, quaternary ammonium hydroxides, such as for example, tetramethylammonium hydroxide. Chemical modification of a pharmaceutical compound (i.e. drug) into a salt is a technique well known to pharmaceutical chemists to obtain improved physical and chemical stability, hygroscopicity, fiowability and solubility of compounds. See, e.g., Ansel et al, Pharmaceutical Dosage Forms and Drug Delivery Systems (1995) at pgs. 456-457.
The term "polycyclic aromatics" refers to an aryl as defined herin containing 2 or more aromatic rings.
The term "polycyclic heteroaromatics" refers to an heteroaryl as defined herin containing 2 or more aromatic rings.
The compounds of the invention may be administered by any suitable means, including oral, topical (including buccal and sublingual), rectal, vaginal, transdermal, parenteral, subcutaneous, intraperitoneal, intrapulmonary, intradermal, intrathecal and epidural and intranasal, and, if desired for local treatment, intralesional administration. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal, or subcutaneous administration.
The compounds of the present invention may be administered in any convenient administrative form, e.g., tablets, powders, capsules, solutions, dispersions, suspensions, syrups, sprays, suppositories, gels, emulsions, patches, etc. Such compositions may contain components conventional in pharmaceutical preparations, e.g., diluents, carriers, pH modifiers, sweeteners, bulking agents, and further active agents. A typical formulation is prepared by mixing a compound of the present invention and a carrier or excipient. Suitable carriers and excipients are well known to those skilled in the art and are described in detail in, e.g., Ansel, Howard C, et al., Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems. Philadelphia: Lippincott, Williams & Wilkins, 2004; Gennaro, Alfonso R., et al. Remington: The Science and Practice of Pharmacy. Philadelphia: Lippincott, Williams & Wilkins, 2000; and Rowe, Raymond C. Handbook of Pharmaceutical Excipients. Chicago, Pharmaceutical Press, 2005. The formulations may also include one or more buffers, stabilizing agents, surfactants, wetting agents, lubricating agents, emulsifiers, suspending agents, preservatives, antioxidants, opaquing agents, glidants, processing aids, colorants, sweeteners, perfuming agents, flavoring agents, diluents and other known additives to provide an elegant presentation of the drug (i.e., a compound of the present invention or pharmaceutical composition thereof) or aid in the manufacturing of the pharmaceutical product (i.e., medicament).
The compounds of formula 1 as well as their salts have at least one asymmetric carbon atom and therefore may be present as mixtures of different stereoisomers. The various isomers can be isolated by known separation methods, e.g., chromatography.
An embodiment, therefore, includes a pharmaceutical composition comprising a compound of Formula I, or a stereoisomer or pharmaceutically acceptable salt thereof. In a further embodiment includes a pharmaceutical composition comprising a compound of Formula I, or a stereoisomer or pharmaceutically acceptable salt thereof, together with a pharmaceutically acceptable carrier or excipient.
Another embodiment includes a pharmaceutical composition comprising a compound of Formula I for use in the treatment of a hyperproliferative disease. Another embodiment includes a pharmaceutical composition comprising a compound of Formula I for use in the treatment of cancer.
In general, the nomenclature used in this Application is based on AUTONOM™ v.4.0, a Beilstein Institute computerized system for the generation of IUPAC systematic nomenclature. If there is a discrepancy between a depicted structure and a name given that structure, the depicted structure is to be accorded more weight. In addition, if the stereochemistry of a structure or a portion of a structure is not indicated with, for example, bold or dashed lines, the structure or portion of the structure is to be interpreted as encompassing all stereoisomers of it. "Therapeutically effective amount or effective amount" means an amount of at least one designated compound that significantly inhibits proliferation and/or prevents differentiation of a human tumor cell, including human tumor cell lines.
The compounds of the present invention are useful in the treatment or control of cell proliferative disorders such as, in particular, oncological disorders. These compounds and formulations containing said compounds may be useful in the treatment or control of blood cancers, such as, for example, acute myeloid leukemia, or solid tumors, such as, for example, breast, colon, lung and prostate tumors.
The compounds of the invention preferably bind to BIR domains of an IAP preventing the IAP from binding to other proteins. Examples of Bir binding proteins include, but are not limited to, caspase 3, caspase 7, caspase 9, Smac and the like. Examples of IAPs include, but are not limited to, XIAP, cIAPl, cIAP2 or NAIP. In one aspect, the compound of the invention bind to the BIR2 and/or BIR3 domains of XIAP, cIAPland/or cIAP2. In another aspect, the compounds of the invention bind to the BIR2 domain of XIAP, cIAP land/or cIAP2.
Compounds of the invention are useful for inducing apoptosis in cells or sensitizing cells to apoptotic signals, in particular cancer cells. Apoptotic signals can be induced in cancer cells by, e.g., radiation therapy or antineoplastic chemotherapy. Alternatively, apoptotic signals can be induced in cancer cells by activation of the death receptors by death receptor agonists. Death receptor agonists can be naturally occurring, e.g., tumor necrosis factor a, (TNF-a) or non- naturally occurring, e.g., a synthetic antibody such as a DR4 or DR5 antibody.
Reaction Schemes
The compounds in the present invention (compounds of general formula 1) can be prepared using the general reacton scheme set out in Scheme 1
Scheme 1
Figure imgf000050_0001
Step 1 : A suitably protected 2-amino-3-hydroxypropionic acid or 2-amino-3- thiopropionic acid of general formula 2, where PGl is a group that render the 2-amine N inert to reaction conditions used in the rest of the synthetic sequence and PG2 is an optional group that renders the 2-amine N inert to reaction conditions used in the rest of synthetic sequence and PG3 is an optional group that renders the carboxylic acid inert to rection conditions used in the rest of synthetic sequence, and a substituted or unsubstituted l-fluoro-2 -nitrobenzene of general formula 3 can be reacted with a base in an appropriate solvent and at an appropriate temperature for an amount of time sufficient to provide a product of general formula 4. The base can be inorganic, e.g., NaH, Na2C03 or Cs2C03, or organic, e.g., sodium bis(trimethylsilyl)amide. Solvents are chosen to be compatible with the base and other reaction conditions, such as temperature, and include, but are not limited to, e.g., THF or DMF. Temperatures suitable for this reaction can range from about -40 °C to about 150 °C. Preferred choices for protecting group PGl, PG2 and PG3 may be made by reference to organic chemistry text books (e.g. Protective Groups in Organic Synthesis, Theodora W. Greene et al.), the original chemistry literature, or would be generally known to one knowledgeable in the art of organic synthesis. In particular, when the 2- amine N is mono-protected by PGl , carbamate -based protecting groups, e.g. tert- butyloxycarbonyl and benzyloxycarbonyl, are preferred. When the 2-amine N is di-protected by PG1 and PG2, arylalkyl-based protecting groups, e.g. benzyl or 4-methoxybenzyl, are preferred. Other amine-protecting groups for PG1 alone or PG1 and PG2 together may also be effective. PG3 can be H or can be an alkyl group, e.g., methyl, ethyl, tert-butyl.
Step 2: This step involves the reduction of the nitro group in compounds of general formula 4 to provide compounds of general formula 5. Those skilled in the art will recognize there are several methods to accomplish this reduction including catalytic hydrogenation and chemical reduction. The choice of reduction method will be influenced by the substitution on the phenyl ring indicated by Rl, R2 and R3 and by the protecting groups PG1, PG2 and PG3 so that unwanted side reactions do not occur. For example, compounds of general formula 4 can treated with an appropriate hydrogenation catalyst, e.g., 10% Pd/C in an appropriate solvent, e.g., MeOH and subjected to hydrogenation at pressures ranging from atmospheric pressure to elevated pressure, up to about 60 PSI for an amount of time sufficient to carry out this transformation. Alternatively, compounds of general formula 4 can be treated with an appropriate chemical reducing agent, e.g. Zn or SnCl2, in an appropriate solvent or solvent mixture, e.g., EtOAc or a mixture of EtOAc and EtOH or a mixture of EtOH and HC1, at an appropriate temperature, ranging from about 0 °C to about 80 °C for an amount of time sufficient to carry out this transformation.
Step 3: The optional carboxylic acid protecting group PG3 in compounds of general formula 5 can be removed to afford compounds of general formula 6. As mentioned above, the choice of protecting group PG3 and conditions used during step 3 for removal of PG3 is influenced by what other potentially reactive functional groups are present in compounds of general formula 5 and the requirement of avoiding undesired reactions elsewhere in the starting material or product of the reaction, i.e., compounds of general formulae 5 and 6, respectively. For example, if PG2 is an ester, e.g., methyl or ethyl, compounds of general formula 4 can be treated with a base, e.g., NaOH or LiOH, in an appropriate solvent or solvent mixture, e.g., THF/H20 or MeOH/H20 at an appropriate temperature, ranging from about 0 °C to about 80 °C for an amount of time sufficient to carry out this transformation. Those skilled in the art will recognize that there are a variety of conditions for removing protecting groups from carboxylic acids which may be identified by reference to organic chemistry text books (e.g. Protective Groups in Organic Synthesis, Theodora W. Greene et al.) or the original chemistry literature. It will be recognized that compounds of general formula 5 where PG3 = H are equivalent to compounds of general formula 6. Step 4: This step entails the conversion of compounds of general formula 6 to lactams of general formula 7. Reagents which may be employed to achieve this transformation include diimide based reagents e.g. dicyclohexylcarbodiimide, (3-dimethylamino-propyl)-ethyl- carbodiimide hydrochloride; or uronium based reagents, e.g. O-benzotriazol-l-yl-Ν,Ν,Ν',Ν'- tetramethyluronium hexaflurorophosphate or O-benzotriazol-l-yl-Ν,Ν,Ν',Ν'- bis(tetramethylene)uronium hexaflurorophosphate. Additionally, a catalyst can be optionally added to the reaction, e.g., 1-hydroxybenzotriazole or N-hydroxysuccinimide. Alternative reagents may also effective in performing this conversion whose selection may be made by reference to the original chemistry literature or would be generally known to one knowledgeable in the art of organic synthesis.
Step 5: This step involves the reaction of compounds of general structure 7 with compounds of general structure 8 to form compounds of general structure 9, where Q is a suitable leaving group, e.g., a halogen, such as Br or I, or a sulfonate ester, such as methanesulfonate ester or Q is hydroxyl. In cases where Q is a leaving group, step 5 can be accomplished by treating compounds of general structure 7 with a base and compounds of general structure 9 in a suitable solvent for an amount of time sufficient to carry out this transformation. The base used can be inorganic, e.g., CS2CO3 or organic, e.g., lithium bis(trimethylsilyl)amide. Solvents are chosen to be compatible with the base and other reaction conditions, such as temperature, and include, but are not limited to, e.g., THF or DMF. Temperatures suitable for this reaction can range from -78 °C to 100 °C. Those skilled in the art will recognize that a catalyst can be added to the reaction mixture. Such catalysts can include, but are not limited to, e.g., Nal or tetrabutylammonium iodide.
If, in compounds of general structure 8 Q is hydroxyl, the conversion of compounds general formula 7 to compounds of general formula 9 can be accomplished by means of a Mitsunobu reaction. For example, compounds of general structure 7 and general structure 8, where Q = OH, can be treated with an azodicarboxylate, e.g., diethyl azodicarboxylate or diisopropyl azodicarboxylate, and a phosphine, e.g., triphenylphosphine or another suitable phosphine, in a suitable solvent for an amount of time sufficient to carry out this transformation. Solvents are chosen to be compatible with the reaction conditions, such as temperature, and include, but are not limited to, e.g., THF, toluene, CH2CI2 or DMF. Temperatures suitable for this reaction can range from about 0 °C to 100 °C. Additional methods to achieve this transformation would be generally known to one knowledgeable in the art of organic synthesis and an overview of the Mitsunobu reaction has been described in a recent review: Chem. Rev., 2009, 109 (6), pp 2551-2651. Step 6: This step entails the removal of protecting group PGl and optional protecting group PG2 from compounds of general formula 9 to form amine-containing compounds of general formula 10. As mentioned above, the choice of protecting group PGl and optional PG2 and conditions used during step 6 for removal of PGl and optional PG2 are influenced by what other potentially reactive functional groups are present in compounds of general formula 10 and the requirement of avoiding undesired reactions elsewhere in the starting material or product of the reaction, i.e., compounds of general formulae 9 and 10, respectively. In the case where the amine -protecting group PGl present in compounds of general formula 5 is tert-butyloxycarbonyl, the protecting group can be removed under acidic conditions such as trifluoro acetic acid in dichloromethane or hydrochloric acid in p-dioxane or ether. Removal of the tert- butyloxycarbonyl group under acidic conditions initially liberates the corresponding salt of the compound of general formula 10, from which the free amine of general formula 10 can be optionally liberated after treatment with base. Alternatively, if the 2-amino N is di-protected by protecting group PGl and PG2 and they are, e.g., benzyl, their removal can be accomplished by catalytic hydrogenation using a suitable catalyst, e.g., 10% Pd/C and treating the mixture with a hydrogen source, e.g., H2 or ammonium formate, in an appropriate solvent, e.g., EtOH. Those skilled in the art will recognize that there are a variety of conditions for removing protecting groups from nitrogen atoms which may be identified by reference to organic chemistry text books (e.g. Protective Groups in Organic Synthesis, Theodora W. Greene et al.) or the original chemistry literature.
Step 7: This step entails the coupling of a suitably protected a-amino-acid of general structure 11 to compounds of general structure 10, where PG4 is a group that renders the examine N inert to reaction conditions used in the rest of the synthetic sequence and W is as described above. Preferred choices for protecting group PG4 may be made by reference to organic chemistry text books (e.g. Protective Groups in Organic Synthesis, Theodora W. Greene et al.), the original chemistry literature, or would be generally known to one knowledgeable in the art of organic synthesis. In particular, carbamate-based protecting groups, e.g. tert- butyloxycarbonyl and benzyloxycarbonyl, are preferred but other amine-protecting groups may also be effective. Those skilled in the art will recognize there are several methods using known peptide coupling reaction techniques to convert compounds of general formula 10 and compounds of general formula 1 1 to compounds of general formula 12. Typical peptide coupling reagents which may be employed include diimide based reagents e.g. dicyclohexylcarbodiimide, (3-dimethylamino-propyl)-ethyl-carbodiimide hydrochloride; or uranium based reagents, e.g. O- benzotriazol-l-yl-N,N,N',N'-tetramethyluronium hexaflurorophosphate or O-benzotriazol-l-yl- N,N,N',N'-bis(tetramethylene)uronium hexaflurorophosphate. Additionally, a catalyst can be optionally added to the reaction, e.g., 1-hydroxybenzotriazole or N-hydroxysuccinimide. Alternative peptide coupling reagents may also effective in performing this conversion. Selection of alternative peptide coupling reagents may be made by reference to the original chemistry literature or would be generally known to one knowledgeable in the art of organic synthesis.
Step 8: This step entails the removal of protecting group PG4 from compounds of general formula 12 to provide amine compounds of general formula 13. The conditions and methods used for this step are analogous to those described above for Step 6.
In cases where X in general formula 1 is desired to be H no further reactions are needed as compounds of general formula 13 are equivalent to compounds of general formula 1 , where W = H.
Step 9 involves the introduction of an additional substitution to the nitrogen atom bearing group X in compounds of general structure 13. Those skilled in the art will recognize there are several ways to accomplish this transformation. These include, but are not limited to, reductive amination or alkylation. For example, compounds of general formula 13 can be treated with an aldehyde, e.g., acetaldehyde, benzaldehyde or 3-pyridinecarboxaldehyde and a reducing agent, e.g., NaBH4 or NaBH3CN in a suitable solvent, e.g., MeOH or EtOH at an appropriate temperature, ranging from about -20 °C to about 100 °C for an amount of time sufficient to carry out this transformation. Alternatively, compounds can be treated with an alkylating agent, e.g., methyl iodide, benzyl bromide or allyl bromide, and a base, e.g., pyridine or triethyelamine (TEA), in a suitable solvent, e.g., dichloromethane (DCM) or THF at an appropriate temperature, ranging from about -20 °C to about 100 °C for an amount of time sufficient to carry out this transformation. Those skilled in the art will recognize that a catalyst can be added to the reaction mixture. Such catalysts can include, but are not limited to, e.g., Nal or tetrabutylammonium iodide.
It will be apparent to one knowledgeable in the art of organic synthesis that when one or more of the substituents labeled X, W, Y or Rl through R6, or substituents included in their definitions, in the compounds shown in Scheme 1 are in and of themselves chemically reactive groups, or contains chemically reactive groups, then additional modification of the compounds of general formula 1 through 13 which contain those reactive groups may be possible. The point in the synthetic sequence at which modification of the chemically reactive groups takes place may be chosen such that the newly elaborated group is chemically inert to the reagents to be employed during the remaining steps of the synthetic sequence and does not interfere with the remaining steps in the synthetic sequence shown in Scheme 1. Alternatively, if the newly elaborated group is not chemically inert or can interfere with the remaining steps in the synthetic sequence it may be necessary to temporarily mask the reactive functional group with an appropriate protecting group or to derivatize the functional group into a moiety which is stable to the remaining transformations in the synthetic sequence and will be present in the final product of the reaction sequence. If a protecting group is introduced which is not required in the final compound of general structure 1 then it may either be removed under the conditions remaining in the synthetic sequence shown in Scheme 1 or by introduction of an additional deprotection step into the synthetic sequence depending upon the nature of the protecting group employed.
Scheme 2
Figure imgf000055_0001
1 6
Those skilled in the art will recognize that in certain instances where a suitably protected 2-amino-3-hydroxypropionic acid is not known in the literature or commercially available it would be necessary to synthesize the compound. Scheme 2 illustrates one general synthesis of protected 2-amino-3-hydroxypropionic acids.
Step 10: A suitably protected 2-aminoacetic acid, e.g., Ν,Ν-dibenzylglycine ethyl ester, can be treated with a base and compounds of general structure 15, where R5 and R6 are as described above, in a suitable solvent for an amount of time sufficient to carry out this transformation to give compounds of general structure 2, where V = O. The base used can be organic, e.g., lithium diisopropylamide, or inorganic, e.g., NaH. Solvents are chosen to be compatible with the base and other reaction conditions, such as temperature, and include, but are not limited to, e.g., THF or DMF. Temperatures suitable for this reaction can range from about - 78 °C to about 80 °C.
In some instances, it may be desirable to remove the protecting group PG3 to afford compounds of general structure 16, which is illustrated in Step 11. As mentioned above, the choice of protecting group PG3 and conditions used during step 11 for removal of PG3 is influenced by what other potentially reactive functional groups are present in compounds of general formulae 2 and 16, respectively and the requirement of avoiding undesired reactions elsewhere in the starting material or product of the reaction. In the case where PG3 is an alkyl ester, compounds of general structure 2, where V = O, can be treated with a base, e.g., NaOH, KOH or LiOH»H20 in a suitable solvent or solvent mixtue, e.g., MeOH, MeOH/H20 or THF/H20 at an appropriate temperature, ranging from about 0 °C to about 100 °C for an amount of time sufficient to carry out this transformation. Those skilled in the art will recognize that there are a variety of conditions for removing protecting groups from carboxylic acids which may be identified by reference to organic chemistry text books (e.g. Protective Groups in Organic Synthesis, Theodora W. Greene et al.) or the original chemistry literature. It will be recognized that compounds of general structure 16 are equivalent to compound of general structure 2 where PG3 is optionally absent and V = O.
The reaction conditions for the above reactions can vary to a certain extent. Those skilled in the art will recognize that the sequence of some reaction steps described in Scheme 1 can vary, as shown in Scheme 3.
Scheme 3
Figure imgf000056_0001
Compounds of general structure 7 can be treated above as described for step 6 to provide compounds of general structure 17.
Compounds of general structure 17 can be treated above as described for step 7 to provide compounds of general structure 18.
Compounds of general structure 18 can be treated above as described for step 5 to provide compounds of general structure 12.
Compounds of general structure 12 can be treated above as described for step 8 to provide compounds of general structure 13. Compounds of general structure 13 can be treated above as described for step 9 to provide compounds of general structure 1.
Methods to perform the above described reactions and processes would be apparent to those of ordinary skill in the art based on the present disclosure, or can be deduced in analogy from the examples. Starting materials are commercially available or can be made by methods analogous to those described in the Examples.
The following examples shall illustrate preferred embodiments of the present invention but are not intended to limit the scope of the invention.
Preparation of Intermediates
(S)-tert-Butyl 4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate
Figure imgf000057_0001
Step l :To a suspension of NaH (60 % in mineral oil, 2.88 g, 72 mmol) in DMF (25 mL) at 0 °C was added (S) -2-(tert-butoxycarbonylamino)-3-hydroxypropanoic acid (7 g, 34 mmol) in DMF (25 mL). After 2 h l-fluoro-2-nitrobenzene (5.29 g, 37.5 mmol) in DMF (25 mL) was added and the resulting mixture stirred for 3 h at 0 °C. The mixture was poured into ice/H20 (200 mL), acidified to pH 5.0 with 1 N HC1 and extracted with EtOAc. The combined extracts were dried over Na2S04, concentrated and purified by flash chromatography to give (S)-2-tert- butoxycarbonylamino-3-(2-nitro-phenoxy)-propionic acid (10.9 g, 97 %).
Step 2: A mixture of (S)-2-tert-butoxycarbonylamino-3-(2-nitro-phenoxy)-propionic acid (7.6 g, 23.3 mmol, leq) and 10 % Pd/C (496 mg) in MeOH (215 mL) was hydrogenated at 1 atm for 2 h. After the theoretical uptake of hydrogen, the reaction mixture was filtered through Celite and washed with MeOH. The filtrate was concentrated and the residue was tritrurated with hexanes to give a solid that was filtered and washed with hexanes to give (S)-3-(2-amino- phenoxy)-2-tert-butoxycarbonylamino-propionic acid (3.8 g, 55 %) as a white solid which was used without purification.
Step 3: A mixture of (S)-3-(2-amino-phenoxy)-2-tert-butoxycarbonylamino-propionic acid (3.8 g, 12.8 mmol, 1 eq) and N-(3-dimethylaminopropyl)-N'-ethylcarbodiimide hydrochloride (EDCI, 2.46 g,12.8 mmol, 1 eq) in DMF (56.4 mL) was stirred for 1 h 45 min. The reaction was poured into H20 (250 mL) and extracted with EtOAc. The combined extracts were washed with H20, dried over Na2S04 and concentrated to give the title compound (3.1 g, 87 %) as a tan solid which was used without purification.
(S)-3-Amino-2,3-dihydrobenzo[b][l ,4]oxazepin-4(5H)-one trifluoroacetate
Figure imgf000058_0001
To a solution of (S)-tert-butyl 4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3- ylcarbamate (2 g, 7.19 mmol, Eq: 1.00) in DCM (16.7 mL) at 0 ° C was added trifluoroacetic acid (TFA, 16.4 g, 10.7 mL, 144 mmol, Eq: 20.00). After 1 h the mixture was concentrated, and the residue was triturated with 5 mL of Et2Oand 35 ml of pentaneto give a gum. The solution was removed and this gummy residuematerial was dried to give the title compound (2.1 g) as a pink foam which was used without purification. tert-Butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-
3 -ylamino)prop an-2 -yl)c arbamate
Figure imgf000058_0002
To a mixture of (S)-3-amino-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate (500 mg, 1.71 mmol, Eq: 1.00), (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (348 mg, 1.71 mmol, Eq: 1.00), O-benzotriazol-1- yl-N,N,N'N'-tetramethyluronium hexafluorophosphate (HBTU, 682 mg, 1.8 mmol, Eq: 1.05) and 1-hydroxybenzotriazole hydrate (ΗΟΒΤΉ20, 243 mg, 1.8 mmol, Eq: 1.05) in DMF (5 mL) was added Ν,Ν-diisopropylethylamine (DIEA, 553 mg, 4.28 mmol, Eq: 2.50). The mixture was stirred for 45 min., diluted with 50 mL EtOAc and washed H20, 2 % KHS04, 5 % NaHC03 and 5 % brine. The organic solution was dried over Na2S04, filtered and concentrated to give the title compound (525 mg, 84 %) as a tan foam which was used without purification.
(S)-Methyl 3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4] oxazepine-9-carboxylate
Figure imgf000059_0001
Step 1 : A suspension ofNaH (60 % in mineral oil, 1.48 g, 36.9 mmol, Eq: 2.10) inDMF (15 mL) was cooled to 0 °C and (S)-2-(tert-butoxycarbonylamino)-3-hydroxypropanoic acid (3.61 g, 17.6 mmol, Eq: 1.00) in DMF (15 mL) was added dropwise over 15 min. The mixture was stirred at 0 °C for 30 min. and at room temp. (RT) for 30 min. The mixture was cooled to 0 °C and methyl 2-fluoro-3-nitrobenzoate (3.5 g, 17.6 mmol, Eq: 1.00) in DMF (15 mL) was added dropwise over 10 min. After 2.5 h the mixture was diluted with ice cold H20 and extracted with EtOAc. The combined extracts were dried over Na2S04 filtered and concentrated to give a residue that was purified by chromatography to afford 2-((S)-2-tert-butoxycarbonylamino-2- carboxy-ethoxy)-3-nitrobenzoic acid methyl ester (4.3 g, 50 %) as a yellow foam.
Step 2: In a similar manner to that described for (S)-3-(2-amino-phenoxy)-2-tert- butoxycarbonylamino-propionic acid, except the material obtained after the filtrate was concentrated and not triturated, (S)-3-(2-amino-phenoxy)-2-tert-butoxycarbonylamino-propionic acid (4.3 g, 11.2 mmol) was converted to (S)-3-(2-amino-6-(methoxycarbonyl)phenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (3.9 g, 50 %) as an off-white foam which was used without purification.
Step 3: In a similar manner to that described for the preparation of (S)-tert-butyl 4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate except the crude product was purified by silica gel chromatography, (S)-3-(2-amino-6-(methoxycarbonyl)phenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (3.9 g, 6.6 mmol) was converted to the title compound (1.46 g, 65 %) as a white foam. tert-Butyl (2R,3S)-2-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3- ylcarbamate
Figure imgf000059_0002
Step 1 : In a similar manner to that described for the preparation of (S)-2-tert- butoxycarbonylamino-3-(2-nitro-phenoxy)-propionic acid except the mixture of (2S,3R)-2-tert- butoxycarbonylamino-3-hydroxybutyric acid and NaH (60 % in mineral oil) was stirred at 0 °C for 30 min., room temp, for 1 h and cooled to 0 °C, (2S,3R)-2-tert-butoxycarbonylamino-3- hydroxy-butyric acid (4.99 g) and l-fluoro-2 -nitrobenzene (3.22 g) was converted to (2S,3R)-2- tert-butoxycarbonylamino-3-(2-nitro-phenoxy)-butyric acid (3.6 g, 53 %) as a yellow foam.
Step 2: In a similar manner to that described for the (S)-3-(2-amino-phenoxy)-2-tert- butoxycarbonylamino-propionic acid, except the material obtained after the filtrate was concentrated but not triturated, (2S,3R)-2-tert-butoxycarbonylamino-3-(2-nitro-phenoxy)-butyric acid (3.6 g, 10.6 mmol) was converted to (2S,3R)-3-(2-amino-phenoxy)-2-tert- butoxycarbonylamino-butyric acid (3.4 g, 90 %) as a violet foam which was used without purification.
Step 3: In a similar manner to that described for the preparation of (S)-tert-butyl 4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate except the crude product was purified by silica gel chromatography, (S)-3-(2-amino-6-(methoxycarbonyl)phenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (1.5 g, 4.83 mmol) was converted to the title compound (0.65 g, 46 %) as a white solid.
(6R,7S)-7-Amino-6-methyl-6,7-dihydro-9H-5-oxa-9-aza-benzocyclohept(
Figure imgf000060_0001
To a solution of tert-butyl (2R,3S)-2-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (0.65 g, 2.22 mmol, Eq: 1.00) in DCM (11.2 mL) at 0 °C was added TFA (12.7 g, 8.26 mL, 111 mmol, Eq: 50.00). After 1 h the mixture was concentrated, the residue dissolved in 50 mL DCM and washed with sat. NaHC03. The NaHC03 mixture was extracted with DCM and the combined extracts dried over Na2SC>4, filtered and concentrated to afford the title compound (0.42 g, 96 %) as a yellow foam which was used without purification.
Methyl-[(S)-l-((6R,7S)-6-methyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclo hepten-7-ylcarbamoyl)-ethyl]-carbamic acid tert-butyl ester
Figure imgf000061_0001
In a similar manner to that described for the preparation of tert-butyl methyl((S)-l-oxo-l- ((S)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2-yl)carbamate except the mixture was stirred 1.5 h and the crude product purified by silica gel chromatography, (2R,3S)-3-amino-2-methyl-2,3-dihydrobenzo[b][l,4]-oxazepin-4(5H)-one (420 mg, 2.19 mmol) was converted to the title compound (505 mg, 61 %) as a white foam.
(S)-Methyl 5 -((6 -bromo-2 -methoxynaphthalen- 1 -yl)methyl)-3 -(tert-butoxycarbonyl amino)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo[b] [ 1 ,4]oxazepine-9-carboxylate
Figure imgf000061_0002
Cs2C03 (1.02 g, 3.12 mmol, Eq: 1.05) and Nal (446 mg, 2.97 mmol, Eq: 1.0) were added to a solution of (S)-methyl 3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (1 g, 2.97 mmol, Eq: 1.00) and 6-bromo-l- (chloromethyl)-2-methoxynaphthalene (866 mg, 3.03 mmol, Eq: 1.02) in DMF (20 mL). The mixture was stirred at RT for 30 min. then heated to 50 °C. After 75 min., the mixture was cooled to RT and diluted with 1/1 EtOAc/H20. The aqueous layer was extracted with EtOAc and the combined organic phases were washed with H20, brine, dried over Na2S04 and concentrated. The residue was purified by silica gel chromatography to afford (S)-methyl 5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5-tetrahydro benzo[b][l,4]oxazepine-9-carboxylate (1.35 g, 75 %) as a white foam.
(S)-Methyl 5-((6-bromo-2 -methoxynaphthalen- 1 -yl)methyl)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylate
Figure imgf000062_0001
Step 1 : In a similar manner to that described for the preparation of (S)-3-amino-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate, (S)-methyl 5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (652 mg, 1.11 mmol) was converted to (S)- methyl 3-amino-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate trifluoroacetate (660 mg, 99 %) which was used without purification.
Step 2: DIEA (712 mg, 972 μΐ, 5.51 mmol, Eq: 5.00) was added to a mixture of (S)- methyl 3-amino-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate trifluoroacetate (660 mg, 1.1 mmol, Eq: 1.00), (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (224 mg, 1.1 mmol, Eq: 1.0), HBTU (418 mg, 1.1 mmol, Eq: 1.0) and ΗΟΒΤ·Η20 (149 mg, 1.1 mmol, Eq: 1.0) in DMF (12.5 mL) at 0 °C. The mixture was warmed to RT, stirred for 1 h, diluted with EtOAc, washed with H20, brine and dried over Na2S04. The mixture was filtered and concentrated to afford the title compound (725 mg, 98 %) as an off-white foam which was used without purification.
(S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-3-((S)-2-(tert-butoxycarbonyl (methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid
Figure imgf000062_0002
LiOH»H20 (31.3 mg, 746 μηιοΐ, Eq: 2.5) and H20 (1.00 mL) was added to a solution of (S)-methyl 5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2-(tert-butoxycarbonyl (methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (200 mg, 298 μηιοΐ, Eq: 1.00) in MeOH (6.0 niL) and the mixture heated to 50 °C. After 90 min. the mixture was concentrated, diluted with H20 and extracted with Et20. The combined Et20 extracts were extracted with 5% NaHC03. The combined aqueous mixture was acidified to pH 2.0 with 1 N HCl, extracted with EtOAc and the combined organic extracts washed with brine, dried over Na2S04 and concentrated to afford the title compound (180 mg, 91 %) as an off white foam which was used without purification.
(S)-5-((4-Bromonaphthalen-l-yl)methyl)-3-((S)-2-(tert-butoxycarbonyl(methyl) amino )propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid
Figure imgf000063_0001
Step 1 : In a similar manner to that described for (S)-methyl 5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate except 0.01 eq. Nal was used and the mixture stirred at RT for 2 h 45 min., (S)-methyl 3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (349 mg, 1.04 mmol, Eq: 1.00) and l-bromo-4- (bromomethyl)naphthalene (311 mg, 1.04 mmol, Eq: 1.0) were converted to (S)-methyl 5-((4- bromonaphthalen- 1 -yl)methyl)-3 -(tert-butoxycarbonylamino)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [l,4]oxazepine-9-carboxylate (519 mg, 90 %) as a white foam.
Step 2: In a similar manner to that described for (S)-3-amino-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate, (S)-methyl 5-((4-bromonaphthalen-l- yl)methyl)-3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9- carboxylate (519 mg, 934 μηιοΐ) was converted to (S)-methyl 3-amino-5-((4-bromonaphthalen- l-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylate trifluoroacetate (511 mg, 96 %) as a white solid.
Step 3: In a similar manner to that described for the preparation of (S)-methyl 5-((6- bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylate Step 2 except the product obtained was tritrurated with Et20/pentane, (S)-methyl 3-amino-5-((4-bromonaphthalen-l-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylate 2,2,2-trifluoroacetate (511 mg, 898 μηιοΐ, Eq: 1.00) and (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (182 mg, 898 μηιοΐ, Eq: 1.0) was converted to (S)-methyl 5 -((4-bromonaphthalen- 1 -yl)methyl)-3 -((S)-2-(tert-butoxycarbonyl(methyl) amino )propanamido)-4-oxo-2,3 ,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (568 mg, 99%) obtained as a white solid.
Step 4: A 0.1 M solution of LiOH»H20 (8.87 mL, 887 μιηοΐ, Eq: 1.00) was added to a solution of (S)-methyl 5 -((4-bromonaphthalen- l-yl)methyl)-3 -((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylate (568 mg, 887 μηιοΐ, Eq: 1.00) in MeOH (10 mL) at 0 °C. The mixture was stirred at RT for 20 min. then heated to 40 °C. After 6.5 h the MeOH was removed in vacuo and the aqueous mixture diluted with sat. NaHC03 and extracted with Et20. The aqueous mixture was cooled 0 °C, acidified to pH 3 with 3 N HC1 and extracted with EtOAc. The combined extracts were washed with brine, dried over Na2S04, filtered and concentrated to afford the title compound (433 mg, 78 %) as a white foam which was used without purification.
(S)-3-Amino-8-methyl-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifiuoroacetate
Figure imgf000064_0001
Step 1 : (S)-2-(tert-butoxycarbonylamino)-3-hydroxypropanoic acid (5.5 g, 26.8 mmol, Eq: 1.00) was dissolved in DMF (90 mL) at 0 °C and NaH (60 % in mineral oil, 2.57 g, 64.3 mmol, Eq: 2.4) was added in small portionsThe mixture was stirred for 30 min. and 2-fiuoro-4- methyl-1 -nitrobenzene (4.16 g, 26.8 mmol, Eq: 1.00) in DMF (lOmL) was added dropwise. The resulting mixture was stirred for 60 min., diluted with 1.0 M KHS04 and extracted with EtOAc. The combined organic extracts were washed with water, brine, dried over Na2S04 and concentrated. The residue was purified by silica gel chromatagraphy to afford (S)-2-(tert- butoxycarbonylamino)-3-(5-methyl-2-nitrophenoxy)propanoic acid (7.60 g, 83 %) as red oil.
Step 2: (S)-2-(tert-butoxycarbonylamino)-3-(5-methyl-2-nitrophenoxy)propanoic acid (7.50 g, 22.0 mmol, Eq: 1.00) and 10 % Pd/C (0.75 g, Eq: 0.03) in MeOH (300 mL) were hydrogenated at ambient pressure for 4 h at RT. The mixture was filtered through a pad of silica gel and the filtrate was concentrated to give (S)-3-(2-a mino-5-methylphenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (3.85, 56 %) as a yellow solid which was used without purification.
Step 3: (S)-3-(2-amino-5-methylphenoxy)-2-(tert-butoxycarbonylamino)propanoic acid (3.85 g, 12.4 mmol, Eq: 1.00) and EDCI (2.38 g, 12.4 mmol, Eq: 1.00) were dissolved in DMF (50 niL) and the mixture was stirred at RT for 3 h. The mixture was diluted with EtOAc and washed with water, brine and the organic solution dried over Na2S04. The mixure was filtered, concentrated and the residue was purified by silica gel chromatography to afford (S)-tert-butyl 8- methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (2.51 g, 69 %) as an off white foam.
Step 4: (S)-tert-butyl 8-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3- ylcarbamate (2.50 g, 8.55 mmol, Eq: 1.00) was dissolved in dichloromethane (DCM, 10 mL) at 0 °C and TFA (10 mL) was added. The mixture was stirred at 0 °C for 1.5 h and concentrated to give the title compound (2.69 g, 103 %) which was used without purification.
(2S,3S)-3-Amino-2,8-dimethyl-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoro acetate
Figure imgf000065_0001
Step 1 : In a similar manner to that described for the preparation of (S)-2-(tert- butoxycarbonylamino)-3-(5-methyl-2-nitrophenoxy)propanoic acid except the reaction mixture was stirred at 0 °C for 4 h, (2S,3S)-2-(tert-butoxycarbonylamino)-3-hydroxybutanoic acid DCHA (2.0 g, 5.00 mmol) and 2-fluoro-4-methyl-l -nitrobenzene (1.55 g, 9.99 mmol) were converted to (2S,3S)-2-tert-butoxycarbonylamino-3-(5-methyl-2-nitro-phenoxy)-butyric acid (0.95 g, 53.6 % yield).
Step 2: (2S,3S)-2-tert-butoxycarbonylamino-3-(5-methyl-2-nitro-phenoxy)-butyric acid (0.95 g, 2.68 mmol, Eq: 1.00) and 5 % Pd/C (200 mg, 94.0 μιηοΐ, Eq: 0.0351) in EtOH (100 mL) were hydrogenated overnight at RT and ambient pressure and an additional portion of 10 % Pd/C (100 mg, 47.0 μηιοΐ, Eq: 0.0176) was added. After 2 h the mixture was filtered through Celite, the filtrate was concentrated and the residue was purified by silica gel chromatography to afford (2S,3S)-3-(2-amino-5-methyl-phenoxy)-2-tert-butoxycarbonylamino-butyric acid (294 mg, 34 %) as a solid. Step 3: In a similar manner to that described for the preparation of (S)-tert-butyl 8- methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate, except 1.5 eq. of EDCI was used, (2S,3S)-3-(2-amino-5-methyl-phenoxy)-2-tert-butoxycarbonylamino-butyric acid (290 mg, 894 μηιοΐ) was converted to tert-butyl (2S,3S)-2,8-dimethyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (152 mg, 55.5 % yield) as a solid.
Step 4: In a similar manner to that described for the preparation of (S)-3-amino-8-methyl- 2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifiuoro acetate except the reaction mixture was stirred at 0 °C for 30 min. and at RT for 20 min., tert-butyl (2S,3S)-2,8-dimethyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate was converted to the title compound (175 mg, 112 %) which was used without purification.
(S)-3-Amino-7-trifluormethyl-2,3-dihydrobenzo[b][l ,4]oxazepin-4(5H)-one trifluoro acetate
Figure imgf000066_0001
In a similar manner to that described for the preparation of (S)-3-amino-8-methyl-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate except in Step 3 the reaction mixture was stirred for 4 h and in the material obtained in Step 4 was triturated with hexane, (S)-2-(tert- butoxycarbonylamino)-3-hydroxypropanoic acid (4.1 g, 20.0 mmol) and l-fluoro-2-nitro-4- (trifluoromethyl)benzene (4.18 g, 20.0 mmol) were conveted to the title compound (1.06 g) which was used without purification.
(2S,3S)-3-Amino-2-methyl-7-(trifluoromethyl)-2,3-dihydrobenzo[b][l,4]oxazepin- 4(5H)-one trifluoroacetate
Figure imgf000066_0002
In a similar manner to that described for the preparation of (S)-3-amino-8-methyl-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate except in Step 1 the mixture was stirred overnight and in Step 2 the mixture was stirred 3 h, (2S,3S)-2-(tert- butoxycarbonylamino)-3-hydroxybutanoic acid discyclohexylamine salt (2.0 g, 5.00 mmol) and l-fluoro-2-nitro-4-(trifluoromethyl)benzene (1.04 g, 5.00 mmol) were converted to the title compound (58 mg) which was used without purification.
(S)-3-Amino-8-trifluormethyl-2,3-dihydrobenzo[b][l ,4]oxazepin-4(5H)-one
trifluoro acetate
Figure imgf000067_0001
In a similar manner to that described for the preparation of (S)-3-amino-8-methyl-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoro acetate except in Step 3 1.2 eq. EDCI was used and the reaction mixture was stirred for 2 h and in Step 4 the mixture was stirred for 1 h and the material obtained was tritrurated with Et20/pentane, (S)-2-(tert-butoxycarbonylamino)-3- hydroxypropanoic acid (4.96 g, 24.2 mmol) and 2-fluoro-l-nitro-4-(trifluoromethyl)benzene (5.05 g, 24.2 mmol) were conveted to the title compound (1.6 g) as a pale yellow solid.
((R)-9-Amino-4-oxo-2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3-yl)-carbamic acid tert- butyl ester
Figure imgf000067_0002
Step 1 : To a solution of 2-chloro-l,3-dinitrobenzene (1.0 g, 4.9 mmol) in DMF (25 mL) was added Cs2C03 (4.0 g, 12.3 mmol) followed by L-BOC-Cys-OH (1.1 g, 4.9 mmol) and the resulting mixture was allowed to stir at room temperature for 15 min. The reaction was cooled to 0 °C, acidified with 1.0 N HC1 (15 mL) and extracted with EtOAc. The organic layers were combined, washed with H20, brine, dried over Na2S04, filtered and concentrated to give (R)-2- tert-butoxycarbonylamino-3-(2,6-dinitro-phenylsulfanyl)-propionic acid which was used without purification (1.9 g).
Step 2: To a solution of (R)-2-tert-butoxycarbonylamino-3-(2,6-dinitro-phenylsulfanyl)- propionic acid (1.7 g, 4.4 mmol) in 3:1 v/v Me OH / H20 (80 mL) containing NH4C1 (7.0 g, 130 mmol) was added Zn dust (5.7 g, 87.2 mmol) and the resulting mixture was stirred for 1 h. The mixture was filtered through a pad of Celite, the filtrate volume was reduced in vacuuo and acidified to pH 4 with 1.0 M HCl. The mixture was extracted with EtOAc, the combined extracts washed with H20, brine, dried over Na2S04, filtered and concentrated to give (R)-2-tert- butoxycarbonylamino-3-(2,6-diamino-phenylsulfanyl)-propionic acid (1.0 g) which was used without purification.
Step 3: To a solution of (R)-2-tert-butoxycarbonylamino-3-(2,6-diamino-phenylsulfanyl)- propionic acid (1.0 g, 3.1 mmol) in DMF (12 mL) was added DIEA(1.6 mL, 9.1 mmol), ΗΟΒΤ·Η20 (859 mg, 6.2 mmol) and HBTU (2.3 g, 6.2 mmol). The mixture was stirred under an atmosphere of N2 at room temperature for 3 h. The reaction was poured into H20 and extracted with EtOAc. The organic extracts were combined, washed with 0.5 M HCl, H20, brine, dried over Na2S04, filtered and concentrated. The residue was purified by chromatography by silica gel chromatography to give the title compound (560 mg, 59 %).
[(S)- 1 -((R)-9- Amino-5 -naphthalen- 1 -ylmethyl-4-oxo-2 ,3 ,4,5 -tetrahydro- benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl]-methyl-carbamic acid tert-butyl ester
Figure imgf000068_0001
Step 1 : Hydrogen chloride gas was bubbled for 1 min. into a solution of ((R)-9-amino-4- oxo-2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3-yl)-carbamic acid tert-butyl ester (560 mg, 1.8 mmol) in dioxane (15 mL) at 0 °C and the reaction was warmed to RT. After 1 h the mixture was concentrated and the residue was triturated with Et20. The resulting solid was filtered, washed with hexanes and dried to give (R)-3,9-diamino-2,3-dihydro-5H-benzo[b][l ,4]thiazepin-4-one dihydrochloride (500 mg. 99 %).
Step 2: To a solution of (R)-3,9-diamino-2,3-dihydro-5H-benzo[b][l ,4]thiazepin-4-one dihydrochloride (500 mg, 1.8 mmol) in DMF (10 mL) was added L-BOC-Ala-OH (396 mg, 1.9 mmol), DIEA (1.2 mL, 7.2 mmol), ΗΟΒΤ·Η20 (489 mg, 3.6 mmol) and HBTU (1.3 g, 3.6 mmol). After 3 h, the reaction was diluted with H20 and extracted with EtOAc. The combined extracts were washed with 0.5 M HCl, H20, brine, dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to give (S)-l-((R)-9-amino-4-oxo-2,3,4,5- tetrahydro-benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl-methyl-carbamic acid tert-butyl ester (660 mg, 94 %).
Step 3: To a solution of (S)-l-((R)-9-amino-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl-methyl-carbamic acid tert-butyl ester (1.5 g, 3.9 mmol) in DMF (25 mL) was added K2CO3 (2.6 g, 19.0 mmol) and 1 -bromomethyl-naphthalene (631 mg, 2.9 mmol) in DMF (10 mL) was added dropwise. After 36 h, the mixture was diluted with sat. aq. citric acid and extracted with EtOAc. The combined extracts were washed with H20, brine, dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to give the title compound (1.3 g, 81 %).
1 -Benzyl-2-fiuoro-3-nitro-benzene
Figure imgf000069_0001
To a mixture l-bromo-2-fluoro-3-nitrobenzene (800 mg, 3.6 mmol), potassium benzyltrifluoroborate ( 2.2 g, 10.9 mmol) and CS2CO3 (3.6 g, 10.9 mmol) in dioxane / H20 (10:1, 18 mL) was added [l,r-bis(diphenylphosphino)ferrocene]palladium(II) dichloride (60 mg, 2 mol %) and the mixture was heated to 100 °C for 8 h. The mixture was cooled to RT, diluted with H20 and extracted with EtOAc. The combined extracts were washed with H20, brine, dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to give the title compound (520 mg, 62 %).
2-(Dibenzylamino)-2-(l -hydro xycyclohexyl)acetic acid
Figure imgf000069_0002
Step 1 : Ethyl 2-(dibenzylamino)acetate (4.92 g, 17.4 mmol, Eq: 1.2) in THF (40 mL) was added to a solution of LDA in THF at -40 °C. After 15 min. the mixture was cooled to -78 °C and cyclohexanone (1.42 g, 1.5 mL, 14.5 mmol, Eq: 1.00) in THF (10 mL) was added. After 2 h, 10 mL of sat. NH4C1 was added and the mixture warmed to RT. After 2 h, the mixture was diluted with H20 and extracted with EtOAc. The combined extracts were washed with H20, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to give 2-(dibenzylamino)-2-(l-hydroxycyclohexyl)acetate as a colorless oil (1.63 g, 30 %) MS m/z 382.1 (MH+)
Step 2: KOH (1.44 g, 25.6 mmol, Eq: 6) in H20 (20 mL) was added to as solution of ethyl 2-(dibenzylamino)-2-(l-hydroxycyclohexyl)acetate (1.63 g, 4.27 mmol, Eq: 1.00) in MeOH (60 mL) and the mixture was heated to 60 °C. After 18 h the reaction was cooled to RT and diluted with 100 mL H20. The pH of the reaction was adjusted to about 4 using sat. KHS04, and extracted with EtOAc. The combined extracts were washed with H20, dried over Na2S04 and concentrated the title compound as a white foam (1.44 g, 95 %) which was used without purification. MS m/e 354.1 (MH+).
3-Amino-3H-spiro[benzo[b][l ,4]oxazepine-2, -cyclohexan]-4(5H)-one
Figure imgf000070_0001
Step 1 : 2-(dibenzylamino)-2-(l-hydroxycyclohexyl)acetic acid (0.70 g, 1.98 mmol, Eq: 1.00) and l-fluoro-2 -nitrobenzene (293 mg, 219 μΐ, 2.08 mmol, Eq: 1.05) were dissolved in THF (10 mL) and a solution of potassium bis(trimethylsilyl)amide 0.5 M in toluene (8.71 mL, 4.36 mmol, Eq: 2.2) was added. The mixture was heated to 60 °C. After 1 h the mixture was cooled to RT and 0.2 mL l-fluoro-2-nitrobenzene and an additional 9 mL of potassium bis(trimethylsilyl)amide (0.5 M in toluene) were added and the mixture stirred at 60 °C for 90 min. The mixture was diluted with H20, acidified with sat. KHS04, and extracted with EtOAc. The combined extracts were washed with H20, brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford 2-(l-(2-aminophenoxy)cyclohexyl)-2- (dibenzylamino)acetic acid as a light brown oil (0.80 g, 85 %). MS m/z 475.1 (MH+)
Step 2: 2-(Dibenzylamino)-2-(l-(2-nitrophenoxy)cyclohexyl)acetic acid (0.8 g, 1.69 mmol, Eq: 1.00), NH4C1 (180 mg, 3.37 mmol, Eq: 2) and Zn (1.71 g, 26.1 mmol, Eq: 15.5) were combined with MeOH (35.0 mL) to give a grey suspension, and the mixture was heated to 65 °C for 90 min. The mixture was filtered through Celite, the filtrate was concentrated and partitioned between sat. aq. NaOAc and Et20. The phases were separated and the organic layer washed with H20, brine, dried over Na2S04 and concentrated to afford 2-(l-(2-aminophenoxy)cyclohexyl)-2- (dibenzylamino)acetic acid as light brown solid (0.6365 g, 85 %). MS m/z 475.1 (MH+).
Step 3: A mixture of 2-(l-(2-Aminophenoxy)cyclohexyl)-2-(dibenzylamino)acetic acid (0.6365 g, 1.43 mmol, Eq: 1.00), ΗΟΒΤ·Η20 (307 mg, 2.00 mmol, Eq: 1.4) and EDCI (274 mg, 1.43 mmol, Eq: 1.00) in DMF (12 mL) were stirred at RT for 1 h and the mixture was diluted with EtOAc. The mixture was washed with sat. NaHC03, brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford 3-(dibenzylamino)- 3H-spiro[benzo[b][l,4]oxazepine-2,l'-cyclohexan]-4(5H)-one as an off-white solid (0.387 g, 64 %). MS m/z 427.1 (MH+)
Step 4 : 3 -(Dibenzylamino)-3 H-spiro [benzo [b] [ 1 ,4]oxazepine-2 , 1 '-cyclohexan]-4(5 H)-one (0.3875 g, 908 μιηοΐ, Eq: 1.00) and 20 % Pd(OH)2/C (0.47 g, 3.35 mmol, Eq: 3.68) were combined with MeOH (100 mL) and acetic acid (0.1 mL) and the mixture was hydrogenated at 50 psi. After 18 h, the mixture was filtered through Celite, the filtrate concentrated, the residue dissolved in MeCN/H20 and lyophilized to afford of the title compound as an off-white solid (0.297 g, 100 %) which was used without purification. MS m/z 247.0 (MH+)
The compounds in Table 1 were prepared by analogous methods.
Table 1
Figure imgf000071_0001
Figure imgf000072_0001
Figure imgf000073_0001
Methyl-(tert-butyl)-(2S)-l-oxo-l-((3R)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,r-cyclohexan]-3-ylamino))propan-2-yl carbamate and methyl- (tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b]
[ 1 ,4]oxazepine-2, 1 '-cyclohexan]-3 -ylamino))propan-2-yl carbamate
Figure imgf000073_0002
3-Amino-3H-spiro[benzo[b][l ,4]oxazepine-2, -cyclohexan]-4(5H)-one (0.29 g, 1.18 mmol, Eq: 1.00), BOC-N-Me-Ala-OH (287 mg, 1.41 mmol, Eq: 1.2) and TEA (357 mg, 492 μΐ, 3.53 mmol, Eq: 3) were combined with DMF (10 mL) and a solution of HBTU (536 mg, 1.41 mmol, Eq: 1.2) and ΗΟΒΤ·Η20 (216 mg, 1.41 mmol, Eq: 1.2) in DMF (10 mL) was added. After 1 h, the mixture was diluted with EtOAc, washed with 1 :1 sat NaHCCVbrine, brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford two diastereomers, methyl-(tert-butyl)-(2S)-l-oxo-l-((3R)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,r-cyclohexan]-3-ylamino))propan-2-yl carbamate, which eluted first and methyl-(tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,r-cyclohexan]-3-ylamino))propan-2-yl carbamate, which eluted second. Each diastereomer was separately dissolved in MeCN/H20 and lyophilized to afford each diastereomer as a white solid: methyl-(tert-butyl)-(2S)-l-oxo-l-((3R)-(4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo [b] [ 1 ,4]oxazepine-2, 1 '-cyclohexan]-3 -ylamino))propan-2-yl carbamate (98.2 mg) and methyl-(tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo-2',3',4,5,5',6'-hexahydro- 3H-spiro[benzo[b][l,4]oxazepine-2,r-cyclohexan]-3-ylamino))propan-2-yl carbamate (44.1 mg). tert-butyl methyl((S)- 1 -oxo- 1 -((S)-4-oxo-2',3',4,5 ,5 ',6'-hexahydro-3H- spiro [benzo [b] [ 1 ,4]oxazepine-2 ,4'-pyran] -3 -ylamino)propan-2 -yl)carbamate
Figure imgf000074_0001
A solution of HBTU (43.2 g, 114 mmol, Eq: 1.2) and ΗΟΒΤ·Η20 (17.4 g, 114 mmol, Eq: 1.2) in DMF (300 mL) was added to a mixture of 3-amino-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one hydrochloride (27 g, 94.8 mmol, Eq: 1.00), BOC-N-Me-Ala-OH (23.1 g, 114 mmol, Eq: 1.2) and TEA (38.4 g, 52.9 mL, 379 mmol, Eq: 4) in DMF(300 mL). After 18 h the mixture was poured into brine (750 mL) and the mixture extracted with EtOAc. The combined extracts were washed with 1 :1 sat NaHC03/brine, brine, dried over Na2S04, and concentrated. The residue was purified by flash chromatography to afford a mixture of diastereomers (36.2 g) as a light yellow solid. The diastereomers were separated by supercritical fluid chromatography (SFC) using a Daicel AD column (5X25 cm) eluted with 15 % MeOH/C02 at 200 mL/min and 220 nM detection at 100 bar backpressure and 35 °C oven. The first diastereomer eluted from the column afforded the title compound (15.29 g, 37 %) as an off-white foam. MS m/z 434.1 (MH+).
3 - Amino-2 ,2-dimethyl-2 ,3 -dihydrobenzo [b] [ 1 ,4]thiazepin-4(5 H)-one
Figure imgf000074_0002
Benzyl 2,2-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-ylcarbamate (0.67 g, 1.88 mmol, Eq: 1.00, WO96/11940) and 33 % HBr /HOAc (9 mL, 54.7 mmol, Eq: 29) were combined to give a yellow solution. After 75 min. the mixture was diluted with 100 mL Et20. The resulting precipitate was collected by filtration, washed with Et20 and added to 100 mL of aq. NaHC03. The mixture was extracted with EtOAc and DCM. The combined extracts were dried over Na2S04, filtered and the filtrate concentrated to give the title compound as a white solid (0.3370 g, 81 %) which was used without purification. MS m/z 379.0 (MH+). tert-Butyl (S)- 1 - ((S)-2 ,2-dimethyl-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]thiazepin-3- ylamino)-l-oxopropan-2-yl(methyl)carbamate and tert-butyl (S)-l-((R)-2,2-dimethyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]thiazepin-3 -ylamino)- 1 -oxopropan-2 -yl(methyl)carbamate
Figure imgf000075_0001
3-Amino-2,2-dimethyl-2,3-dihydrobenzo[b][l,4]thiazepin-4(5H)-one (0.337 g, 1.52 mmol, Eq: 1.00), BOC-N-Me-Ala-OH (370 mg, 1.82 mmol, Eq: 1.2) and TEA (460 mg, 634 μΐ, 4.55 mmol, Eq: 3) were combined with DMF (5 mL) and a solution of HBTU (690 mg, 1.82 mmol, Eq: 1.2) and ΗΟΒΤ·Η20 (279 mg, 1.82 mmol, Eq: 1.2) in DMF (5 mL) was added. After 15 h, the mixture was diluted with EtOAc, washed with 1 :1 sat NaHCOs/brine, brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography. Two diastereomers were isolated, tert-butyl (S)-l-((S)-2,2-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin- 3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (eluted first, 0.241g, white foam) and tert-butyl (S)- 1 -((R)-2 ,2 -dimethyl-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]thiazepin-3 -ylamino)- 1 - oxopropan-2-yl(methyl)carbamate (eluted second, 0.207 g, white foam). tert-Butyl (S) - 1 -(4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]thiazepin-3 -ylamino)- 1 - oxoprop an-2 -yl(methyl)c arbamate
Figure imgf000075_0002
3-Amino-2,3-dihydro-l,5-benzothiazepin-4(5H)-one hydrochloride (1.0 g, 5.15 mmol, Eq: 1.00), BOC-N-Me-Ala-OH (1.26 g, 1.62 mmol, Eq: 1.2) and TEA (2.2 mL, 15.45 mmol, Eq: 3.00) were dissolved in DMF (30 mL) and ΗΟΒΤ·Η20 (697 mg, 5.14 mmol, Eq: 1.20) and HBTU (2.34 g, 6.18 mmol, Eq: 1.20) were added. After 1 h 20 min. the mixture was diluted with 1 N HC1 and extracted with EtOAc. The organic extracts were washed with 1 N NaOH, brine, dried over Na2S04 and concentrated to afford the title compound (1.66 g, 85 % yield) which was used without purification.
3-Amino-8,9-difluoro-2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'- pyran]-4(5H)-one
Figure imgf000076_0001
Step 1 : Potassium bis(trimethylsilyl) amide, 1 M solution in THF (4.22 mL, 4.22 mmol, Eq: 3.00), was added to a solution of 2-(dibenzylamino)-2-(4-hydroxytetrahydro-2H-pyran-4-yl)- acetic acid (0.5 g, 1.41 mmol, Eq: 1.00) in THF (10 mL) at RT and the mixture stirred for 15 min. The mixture was cooled to 0 °C, 2,3,4-trifluoronitrobenzene (1.25 g, 0.83 mL, 7 mmol, Eq: 5.00) was added and the mixture stirred at 0 °C for 45 min. The mixture was diluted with H20 at 0 °C and was warmed to RT. The pH was adjusted to ~2-3 with sat KHSO4, the mixture extracted with EtOAc. The combined extracts were washed with brine, dried over Na2S04, concentrated and the residue purified by flash chromatography to afford 2-(dibenzylamino)-2-(4-(5,6-difiuoro- 2-nitrophenoxy)tetrahydro-2H-pyran-4-yl)-acetic acid (0.23g, 32 % yield). MS m/z 513.0 (MH+)
Step 2: NH4C1 (48.0 mg, 0.90 mmol, Eq: 2) and Zn powder (440 mg, 6.73 mmol, Eq: 15) were added to a solution of 2-(dibenzylamino)-2-(4-(2,3-difluoro-6-nitrophenoxy)tetrahydro-2H- pyran-4-yl)-acetic acid (230 mg, 449 μηιοΐ, Eq: 1.00) in MeOH (10 mL) and the mixture was heated to 65 °C. After 2 h the mixture was filtered through Celite. The filtrate was concentrated and partitioned between 1 N NaOAc and EtOAc. The organic layer was dried over Na2S04 then concentrated under reduced pressure to afford [4-(6-amino-2,3-difluoro-phenoxy)-tetrahydro- pyran-4-yl]-dibenzylamino-acetic acid (185 mg) which was used without purification.
Step 3: ΗΟΒΤ·Η20 (70.5 mg, 460 μιηοΐ, Eq: 1.2) and EDCI (88.2 mg, 460 μιηοΐ, Eq: 1.2) were added to a solution of [4-(6-amino-2,3-difiuoro-phenoxy)-tetrahydro-pyran-4-yl]- dibenzylamino-acetic acid (185 mg, 383 μηιοΐ, Eq: 1.00) in DMF (5 mL). The mixture was stirred at RT overnight, diluted with H20 and extracted with EtOAc. The combined extracts were washed with brine, dried over Na2S04 and concentrated under reduced pressure. The residue was purified by flash chromatography to afford 3-(dibenzylamino)-8,9-difiuoro-2',3',5',6'-tetrahydro- 3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one (102 mg, 57 % yield). MS m/z 465.0 (MH+)
Step 4: 3-(Dibenzylamino)-8,9-difiuoro-2',3',5',6'-tetrahydro-3H-spiro[benzo[b] [l,4]oxazepine-2,4'-pyran]-4(5H)-one (100 mg, 215 μιηοΐ, Eq: 1.00) was added to MeOH (10 mL) and the mixture warmed 40 °C to give a light yellow suspension. 20 % Pd(OH)2/C (100 mg, 215 μηιοΐ, Eq: 1.00) was added, the mixture was degassed and stirred at RT under H2 for 6.5 h. The mixture was filtered through Celite and concentrated under reduced pressure to afford 3- amino-8,9-difluoro-2',3^5^6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5 h)-one (60 mg, 98 % yield) as colorless oil which was used without purification. MS m/z 285.0 (MH+) tert-Butyl-(2S)- 1 -oxo- 1 -((3R)-(8 ,9-difiuoro-4-oxo-2',3',4,5 ,5 ',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate and tert-butyl-(2S)- l-oxo-l-((3S)-(8,9-difluoro-4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine- 2,4'-pyran]-3-ylamino))propan-2-yl carbamate
Figure imgf000077_0001
ΗΟΒΤ·Η20 (38.8 mg, 253 μιηοΐ, Eq: 1.2) and HBTU (96.1 mg, 253 μιηοΐ, Eq: 1.2) were added to a mixture of 3-amino-8,9-difiuoro-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5 h)-one (60 mg, 211 μηιοΐ, Eq: 1.00), BOC-N-Me- Ala-OH (51.5 mg, 253 μιηοΐ, Eq: 1.2) and TEA (53.4 mg, 74.2 μΐ, 528 μιηοΐ, Eq: 2.5) in DMF (3 mL). After 2 h, the mixture was diluted with H20/1 N HC1 and extracted with EtOAc. The combined extracts were washed with 1 N NaOH, brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford tert-butyl-(2S)-l-oxo-l-((3R)-(8,9- difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (eluted first, 40 mg, 40 %) and tert-butyl-(2S)-l-oxo-l-((3S)- (8,9-difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (eluted second, 42 mg, 42 % yield).
3-Amino-9-fluoro-2',3^5^6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]- 4(5H)-one
Figure imgf000077_0002
In a similar manner to that described for the preparation of 3-amino-8,9-difiuoro- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one except in step 4 the mixture was hydrogenated overnight, 2,3-difluoronitrobenzene (4.48 g, 2.98 mL, 28.1 mmol) was converted to the title compound as a beige solid (480 mg) which was used without purification. MS m/z 266.9 (MH+) tert-butyl-(2S)-l-oxo-l-((3R)-(9-fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate and tert-butyl-(2S)- l-oxo-l-((3S)-(9-fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'- pyran]-3-ylamino))propan-2-yl carbamate
Figure imgf000078_0001
In a similar manner to that described for the preparation of tert-butyl-(2S)-l-oxo-l-((3R)- (8,9-difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate and tert-butyl-(2S)-l-oxo-l-((3S)-(8,9-difluoro-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate except the mixture was stirred for 1 h, 3-amino-9-fluoro-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one (80 mg, 300 μηιοΐ, Eq: 1.00) and BOC-N- Me-Ala-OH (73.3 mg, 361 μιηοΐ, Eq: 1.2) were converted to tert-butyl-(2S)-l-oxo-l-((3R)-(9- fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (eluted first, 64 mg, 47 %, MS m/z 492.0 (MH+)) and tert-butyl- (2S)-l-oxo-l-((3S)-(9-fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine- 2,4'-pyran]-3-ylamino))propan-2-yl carbamate (eluted second, 49 mg, 36 %, MS m/z 492.0 (MH+)). tert-Butyl-(2S)-l-oxo-l-((3R)-(9-fiuoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))butan-2-yl carbamat and tert-butyl-(2S)-l- oxo-l-((3S)-(9-fluoro-4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'- pyran]-3-ylamino))butan-2-yl carbamate
Figure imgf000079_0001
In a similar manner to that described for the preparation of tert-butyl-(2S)-l-oxo-l-((3R)- (8,9-difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate and tert-butyl-(2S)-l-oxo-l-((3S)-(8,9-difluoro-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate except the mixture was stirred for 1 h, 3-amino-9-fiuoro-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one (80 mg, 300 μηιοΐ, Eq: 1.00) and (S)-2- (tert-butoxycarbonyl(methyl)amino)butanoic acid (78 mg, 361 μηιοΐ, Eq: 1.20) were converted to tert-butyl-(2S)-l-oxo-l-((3R)-(9-fiuoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))butan-2-yl carbamate (eluted first, 50 mg, 36 %, MS m/z 488.0 (MH+)) and tert-butyl-(2S)-l-oxo-l-((3S)-(9-fiuoro-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))butan-2-yl carbamate (eluted second, 40 mg, 36 %, MS m/z 488.0 (MH+)).
3-Amino-8-fluoro-2',3^5^6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]- 4(5H)-one
Figure imgf000079_0002
In a similar manner to that described for the preparation of 3-amino-8,9-difiuoro- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one except in step 2 2.5 eq. of NH4C1 and 12 eq. of Zn were used, in step 3 the mixture was stirred for 6 h and in step 4 the mixture was hydrogenated overnight, 2,4-difiuoronitrobenzene (2.69 g, 1.79 mL, 16.9 mmol) was converted to the title compound as a beige solid (110 mg) which was used without purification. tert-Butyl-(2S)-l-oxo-l-((3R)-(8-fiuoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate and tert-butyl-(2S)- l-oxo-l-((3S)-(8-fluoro-4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'- pyran]-3-ylamino))propan-2-yl carbamate
Figure imgf000080_0001
In a similar manner to that described for the preparation of tert-butyl-(2S)-l-oxo-l-((3R)- (8,9-difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate and tert-butyl-(2S)-l-oxo-l-((3S)-(8,9-difluoro-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate except the mixture was stirred for 1.5 h, 3-amino-8-fiuoro-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one (59 mg, 222 μιηοΐ, Eq: 1.00), BOC-N-Me- Ala-OH (54.0 mg, 266 μιηοΐ, Eq: 1.2) were converted to tert-butyl-(2S)-l-oxo-l-((3R)-(8-fiuoro- 4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan- 2-yl carbamate (eluted first, 42 mg, 42 %, MS m/z 474.0 (M+Na+)) and tert-butyl-(2S)-l-oxo-l- ((3S)-(8-fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (eluted second, 42 mg, 42 %, MS m/z 474.0 (M+Na+)). tert-Butyl-(2S)-l-oxo-l-((3R)-(8-fiuoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))butan-2-yl carbamate and tert-butyl-(2S)- l-oxo-l-((3S)-(8-fluoro-4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'- pyran]-3-ylamino))butan-2-yl carbamate
Figure imgf000080_0002
In a similar manner to that described for the preparation of tert-butyl-(2S)-l-oxo-l-((3R)- (8,9-difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate and tert-butyl-(2S)-l-oxo-l-((3S)-(8,9-difluoro-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate except the mixture was stirred for 1.5 h, 3-amino-8-fiuoro-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one (54 mg, 203 μηιοΐ, Eq: 1.00), (S)-2-(tert- butoxycarbonyl(methyl)amino)butanoic acid (52.9 mg, 243 μηιοΐ, Eq: 1.2) were converted to tert-butyl-(2S)-l-oxo-l-((3R)-(8-fiuoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))butan-2-yl carbamate (eluted first, 40 mg, 42 %, MS m/z 488.0 (M+Na+)) and tert-butyl-(2S)-l-oxo-l-((3S)-(8-fluoro-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))butan-2-yl carbamate (eluted second, 42 mg, 44 %, MS m/z 488.0 (M+Na+).
BOC-N-(methyl-d3)-Ala-OH
Figure imgf000081_0001
Sodium hydride (1.27 g, 31.7 mmol, Eq: 3.00) was added to a mixture of (S)-2-(tert- butoxycarbonylamino)propanoic acid (2 g, 10.6 mmol, Eq: 1.00) and iodomethane-d3 (12.3 g, 5.26 mL, 84.6 mmol, Eq: 8.00) in THF (40 mL) at 0 °C and the mixture stirred for 5 min then at RT. After 4 h the mixture was diluted with water and extracted with Et20. The pH of the aqueous mixture was adjusted to ~2 and extracted with Et20 and these combined extract were washed with brine, dried over Na2S04 and concentrated to afford the title compound as colorless oil which solidified upon standing (2.1 g, 96 % yield) and was used without purification.
Methyl-d3-(tert-butyl)-(2S)-l-oxo-l-((3R)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate and methyl-d3- (tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate
Figure imgf000081_0002
In a similar manner to that described for the preparation of tert-butyl-(2S)-l-oxo-l-((3R)- (8,9-difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate and tert-butyl-(2S)-l-oxo-l-((3S)-(8,9-difluoro-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'^yran]-3-ylamino))propan-2-yl carbamate except the mixture was stirred for 2.5 h, 3-amino-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one hydrochloride (80 mg, 281 μηιοΐ, Eq: 1.00), BOC-N-(methyl-d3)-Ala-OH (69.5 mg, 337 μηιοΐ, Eq: 1.2) were converted to methyl-d3-(tert- butyl)-(2S)-l-oxo-l-((3R)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine- 2,4'-pyran]-3-ylamino))propan-2-yl carbamate (eluted first, 41 mg, 33 %, MS m/z 459.1 (M+Na+)) and methyl-d3-(tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate (eluted second, 50 mg, 41 %, MS m/z 459.1 (M+Na+)).
6-Bromo- 1 -chloromethyl-2-(methoxy-d3)-naphthalene
Figure imgf000082_0001
Step 1 : Iodomethane-d3 (3.9 g, 1.67 mL, 26.9 mmol, Eq: 1.2) was added to a mixture of 6-bromo-2-naphthol (5 g, 22.4 mmol, Eq: 1.00) and K2C03 (4.65 g, 33.6 mmol, Eq: 1.5) in DMF (100 mL) and the mixture stirred overnight. The mixture was diluted with H20, the resulting precipitate was filtered, dissolved in EtOAc and successively washed with 1 N NaOH and brine. The organic solution was dried over Na2S04 and concentrated to afford 6-bromo-2-(d3- methoxy)-naphthol as a beige solid (5 g, 93 %) which was used without purification.
Step 2: Titanium tetrachloride, 1.0 M in DCM (18.3 mL, 18.3 mmol, Eq: 2.2) and dichloromethyl methyl ether (1.05 g, 817 μΐ, 9.16 mmol, Eq: 1.1) were combined with DCM (70 mL) and the solution cooled to 0 °C. 6-Bromo-2-(d3-methoxy)-naphthol (2 g, 8.33 mmol, Eq: 1.00) in DCM (10 mL) was added, the mixture warmed to RT. After 2.5 h the mixture was diluted with 1 N HCl (150 mL) and extracted with DCM. The combined extracts were washed with brine, dried over Na2S04 and concentrated to afford 6-bromo-2-(d3-methoxy)-naphthalene- 1-carbaldehyde (2.11 g, 95 %) which was used without purification.
Step 3: Sodium borohydride (1.19 g, 31.3 mmol, Eq: 4.00) was added in 3 portions to 6- bromo-2-(d3-methoxy)-naphthalene-l-carbaldehyde (2.1 g, 7.83 mmol, Eq: 1.00) in MeOH (50 mL) at RT. After 10 min., the mixture was diluted with 1 N HCl and H20, the resulting precipitate was filtered and purified by flash chromatography to afford the (6-bromo-2-(d3- methoxy)-naphthalene-l-yl)-methanol (1.38 g, 65 %). MS m/z 253.9 (M-H20+H)+ Step 4: Pyridine (606 mg, 618 μΐ, 7.66 mmol, Eq: 1.5) and thionyl chloride (912 mg, 559 μΐ, 7.66 mmol, Eq: 1.5) were added to (6-bromo-2-(d3-methoxy)-naphthalene-l-yl)-methanol (1.38 g, 5.11 mmol, Eq: 1.00) in DCM (30 mL) and the mixture was stirred at RT overnight. The mixture was diluted with sat. NaHC03, extracted with DCM, the organic extracts were dried over Na2S04 and concentrated to afford the desired compound as a beige solid (1.4 g, 95 % yield).
2-(2-Chloro-3 -(hydro xymethyl)- 1 H-indol- 1 -yl)benzonitrile
Figure imgf000083_0001
Step 1 : NaH (60 % in mineral oil, 223 mg, 5.57 mmol, Eq: 1.00) was added to a solution of 2-chloro-lH-indole-3-carbaldehyde (lg, 5.57 mmol, Eq: 1.00) in l-methyl-2-pyrrolidinone (NMP, 5 mL) in a microwave vial. After 10 min., 2-fiuorobenzonitrile (3.37 g, 3.02 mL, 27.8 mmol, Eq: 5) was added. The reaction was sealed and heated at 150 °C. After 16 h. the mixture was diluted with sat. NH4C1 solution, extracted with EtOAc and the combined extracts concentrated to give a residue that was purified by silica gel chromatography to afford 2-(2- chloro-3-formyl-lH-indol-l-yl)benzonitrile (120 mg, 8 %) as a light brown solid.
Step 2: NaBH4 (6 mg, 159 μηιοΐ, Eq: 0.387) was added to a solution of 2-(2-chloro-3- formyl-1 H-indol- l-yl)benzonitrile (115 mg, 410 μηιοΐ, Eq: 1.00) in DCM (3 mL) and MeOH (3.00 mL) at 0 °C and the mixture brought to RT. After 2 h 15 min. the mixture was diluted with sat. NH4C1 and extracted with DCM and the extracts concentrated to afford the title compound (116 mg, 100%) which was used without purification.
2-(4-(Hydroxymethyl)- 1 H-indol- 1 -yl)benzonitrile
Figure imgf000083_0002
Step 1 : NaH (60% in mineral oil, 303 mg, 7.58 mmol, Eq: 1.1) was added to a solution of lH-indole-4-carbaldehyde (1 g, 6.89 mmol, Eq: 1.00) in DMF (12 mL) at 0 °C. After 10 min., the mixture was warmed to RT and treated with sonication for 2 min. 2-Fluorobenzonitrile (918 mg, 822 μΐ, 7.58 mmol, Eq: 1.1) was added and the mixture was treated with sonication for 3 min. After 3 h the mixture was diluted with sat. NH4C1, extracted with EtOAc, the combined extracts washed with H20 and concentrated. The residue was tritrurated with Hexane/Et20 to give 2-(4-formyl-lH-indol-l-yl)benzonitrile (1.2g, 70.7%) as a grey solid.
Step 2: NaBH4 (50 mg, 1.35 mmol Eq: 0.4) was added to a solution of 2-(4-formyl-lH- indol-l-yl)benzonitrile (810 mg, 3.29 mmol, Eq: 1.00) in EtOH (30 mL) and DCM (15 mL) at 0 °C and the mixture warmed to RT. After 3 h., the mixture was concentrated to remove the DCM. The resulting mixture was diluted with sat. NH4C1, extracted with DCM and and the combined extracts concentrated. The residue was purified by silica gel chromatography to afford the title compound (810 mg, 99 %>) as a white solid.
(2-Chloro-l-(phenylsulfonyl)-lH-indol-3-yl)methanol
Figure imgf000084_0001
Step 1 : Cs2C03 (996 mg, 3.06 mmol) was added to a solution of 2-chloro-lH-indole-3- carbaldehyde (0.5g, 2.78 mmol) and benzene sulfonyl chloride (0.39 mL, 3.06 mmol) in DMF (5 mL) and the mixture heated to 60 °C. After 3 h the mixture was diluted with brine and extracted with EtOAc. The combined extracts were dried over MgS04, filtered and concentrated. The residue was purified by silica gel chromatography to afford 2-chloro-l-(phenylsulfonyl)-lH- indole-3-carbaldehyde (33 mg, 5 %>) as a white solid.
Step 2: NaBH4 (7.81 mg, 0.206 mmol) was added to a solution of 2-chloro-l- (phenylsulfonyl)-lH-indole-3-carbaldehyde (33 mg, 0.103 mmol) in DCM/MeOH 1 :1 (10 mL). After 16 h the mixture was diluted with sat. NH4C1 and EtOAc, the organic layer separated and washed with H20, dried over MgS04, filtered and the filtrate concentrated to give the title compound (33 mg, 99 %>) which was used without purification.
(2-(Methylsulfonyl)isoindolin-4-yl)methanol
Figure imgf000085_0001
Step 1 : DIEA (0.438 g, 3.39 mmol) was added to a solution of methyl isoindoline-4- carboxylate (0.5 g, 2.82 mmol) and mesyl chloride (0.36 g, 3.1 mmol) in DCM (10 mL). After 12 h the mixture was concentrated and the residue purified by silica gel chromatography to afford methyl 2-(methylsulfonyl)isoindoline-4-carboxylate (0.37 g 52 %) as an off white solid.
Step 2: Lithium aluminum hydride (LAH, 1 M in THF, 2 mL, 2.0 mmol) was added to solution of methyl 2-(methylsulfonyl)isoindoline-4-carboxylate in THF (15 mL). After 10 h the mixture was diluted with 5 % NaOH solution and extracted with EtOAc. The combined organic extracts were dried over MgS04 and concentrated. The residue was recrystallized from DCM to give the title compound (200 mg, 61 %) as a grey solid.
4-(Bromomethyl)-6-fluoro-l-methylquinolin-2(lH)-one
Figure imgf000085_0002
Step 1 : Mel (130 mg, 0.914 mmol) was added into a suspension of 6-fluoro-4- methylquinolin-2(lH)-one (135 mg, 0.762 mmol) and CS2CO3 (248 mg, 0.762 mmol) in DMF (10 mL). The reaction mixture was stirred overnight and partitioned between Na2C03 solution and EtOAc. The organic layer was washed with brine, dried over MgS04 and concentrated.The resulting solid was washed with hexanes and dried to give 6-fluoro-l ,4-dimethylquinolin-2(lH)- one (100 mg, 68 %) as a white solid which was used without purification.
Step 2: 2,2'-Azobis(2-methylpropionitrile) (AIBN, 17.2 mg, 0.105 mmol) and N- bromosuccinimide (NBS, 97.7 mg, 0.549 mmol) were added to a suspension of 6-fluoro-l,4- dimethylquinolin-2(lH)-one (100 mg, 0.523 mmol) in CCI4 (10 mL) at 70 °C. After 1 h an additional 2 eq. of NBS and 0.4 eq. of AIBN were added and the mixture heated at 70 °C for 1 h. The mixture was concentrated and the residue purified by preparative TLC to give desired the title compound (55 mg, 31 %) as white solid. l-Benzyl-2-chloro-lH-indole-3-carbaldehyde
Figure imgf000086_0001
NaBH4 (71.5 mg, 1.89 mmol) was added to a solution of l-benzyl-2-chloro-lH-indole-3- carbaldehyde (0.51g, 1.89 mmol) in MeOH (10 mL). After 12 h the mixture was diluted with sat. NH4CI and extracted with EtOAc. The combined extracts were washed with H20, dried over MgS04,filtered and concentrated to afford the title ompound (350 mg, 68 %) as white solid which was used without purification.
( 1 -Ethyl- 1 H-indol-4-yl)methanol
Figure imgf000086_0002
NaBH4 (49.8 mg, 1.32 mmol, Eq: 0.3) was added to a solution of 1 -ethyl- lH-indole-4- carbaldehyde (800 mg, 4.39 mmol, Eq: 1.00) in EtOH (30 mL) and DCM (15 mL) at 0 °C and the mixture was warmed to RT and stirred overnight. The mixture concentrated to remove DCM and the resulting mixture diluted with NH4CI, extracted with DCM and concentrated. The residue was purified by silica gel chromatography to give the title compound (700 mg, 91 %) as a yellow oil.
2-(3 -(Bromomethyl)- 1 H-indazol- 1 -yl)benzonitrile
Figure imgf000086_0003
Step 1 : CS2CO3 (1.56 g, 4.8 mmol) was added to a solution of 3-methyl indazole (0.634 g, 4.8 mmol) and 2-fiuorobenzonitrile (1 mL, 9.6 mmol) in DMF (20 mL) and the mixture stirred at RT for 12 h. The mixture was diluted with sat. NH4C1 and a precipitate formed. The solid was filtered, washed with H20, hexane and dried under vacuum to give 2-(3-methyl-lH-indazol-l- yl)benzonitrile (1 g, 89 %) which was used without purification.
Step 2: AIBN (141 mg, 0.857 mmol) and NBS (839 mg, 4.72 mmol) were added to a suspension of 2-(3-methyl-lH-indazol-l-yl)benzonitrile (lg, 4.29 mmol) in CC14 (20 mL) and the mixture heated to reflux for 2 h. The mixture was concentrated and the residue was purified by silica gel chromatography to give the title compound (1.25g, 93 %) as an off white solid.
3-(Bromomethyl)-l-(2-cyanophenyl)-lH-indole-2-carbonitrile
Figure imgf000087_0001
Step 1 : A mixture of 3-methyl-lH-indole-2-carbonitrile (500 mg, 3.2 mmol), 2- fluorobenzonitrile (388 mg, 3.2 mmol) and CS2CO3 (1.05g, 3.2 mmol) in DMF (10 mL) was heated at 60 °C overnight. The mixture was poured into H20 and a precipitate formed. The solid was collected by filtration, washed with H20 and hexane, and dried under vacuum to give l-(2- cyanophenyl)-3-methyl-lH-indole-2-carbonitrile (780 mg, 94.6 %) as an off white solid that was used without purification.
Step 2: In a similar manner to that described for the preparation of 3-(bromomethyl)-l-(2- cyanophenyl)-lH-indole-2-carbonitrile Step 2 except the mixture heated to reflux for 1.5 h, l-(2- cyanophenyl)-3-methyl-lH-indole-2-carbonitrile was converted to the title compound (1.0 g, 98 %) as an off white solid.
(S)-2-(Benzyloxycarbonyl-ethyl(d5)-amino)-propionic acid
Figure imgf000087_0002
NaH (60 % in mineral oil, 480 mg, 12 mmol) was added to (S)-2- (benzyloxycarbonylamino)propanoic acid (0.892g, 4 mmol) and d5-ethyl iodide (5.15g, 2.64 mL, 32 mmol) in THF (20 mL) and the mixture heated to 60 °C overnight. The mixture was partitioned between EtOAc and H20 and the organic layer was washed with H20. The combined aqueous mixture was acidified to pH of 4 with citric acid solution, extracted with EtOAc, the combined organic extracts dried over MgSC>4 filterd and the filtrate concentrated to afford the title compound 440 mg, 40 %) as a colorless oil which was used without purification.
2-(3 -(Bromomethyl)-6-fluoro- 1 H-indazol- 1 -yl)benzonitrile
Figure imgf000088_0001
In a similar manner to that described for the preparation of 2-(3-(bromomethyl)-lH- indazol-l-yl)benzonitrile except in Step 1 the mixture was diluted with H20 and in Step 2 the mixture was heated at reflux overnight, 6-fluoro-3-methyl-lH-indazole (2 g, 13.3 mmol) and 2- fluorobenzonitrile (1.73 mL, 16 mmol) were converted to the title compound (800 mg, 61 %) as an off white solid.
2-(3 -(Bromomethyl)-6-bromo- 1 H-indazol- 1 -yl)benzonitrile
Figure imgf000088_0002
In a similar manner to that described for the preparation of 2-(3-(bromomethyl)-lH- indazol-l-yl)benzonitrile except in Step 1 the mixture was diluted with H20 and in Step 2 the mixture was heated at reflux overnight, 6-bromo-3-methyl-lH-indazole (1 g, 4.74 mmol) and 2- fluorobenzonitrile (0.617 mL, 5.69 mmol) were converted to the title compound (800 mg, 64%) as an off white solid.
(R)-3 - Amino-2 ,2-dimethyl-2 ,3 -dihydrobenzo [b] [ 1 ,4]thiazepin-4(5 H)-one
Figure imgf000089_0001
Step 1 : NaHC03 (14.5 g, 172 mmol, Eq: 2.5) and H20 (210 mL) were added to a slurry of (R)-2-(benzyloxycarbonylamino)-3-mercapto-3-methylbutanoic acid (19.5 g, 68.8 mmol, Eq: 1.00) in EtOH (70.0 mL). After 20 min. the mixture became homogeneous, l-fluoro-2- nitrobenzene (9.71 g, 7.00 mL, 68.8 mmol, Eq: 1.00) was added and the mixture heated to reflux for 6 h. The mixture was cooled to RT, poured into H20 (300 mL) and extracted with MTBE. The aqueous layer was acidified to pH 5 with 1 N HCl and extracted with Et20. The combined organic extracts were dried over Na2S04 filtered and concentrated to give (R)-2- (benzyloxycarbonylamino)-3-methyl-3-(2-nitrophenylthio)butanoic acid (18.7 g, 67.2 %) as a light yellow oil which was used without purification.
Step 2: A mixture of (R)-2-(benzyloxycarbonylamino)-3-methyl-3-(2- nitrophenylthio)butanoic acid (18.3 g, 45.2 mmol, Eq: 1.00), NH4C1 (4.84 g, 90.5 mmol, Eq: 2) and Zn (45.9 g, 701 mmol, Eq: 15.5) in MeOH (500 mL) was heated at reflux for 6 h and the mixture was filtered through Celite. The filter cake was washed with hot MeOH. The filtrate was concentrated, the residue was tritrurated with H20, 1 :3 Et20/Hexane and azeotroped with toluene. The resulting material was dried under vacuum to give (R)-3-(2-aminophenylthio)-2- (benzyloxycarbonylamino)-3-methylbutanoic acid (16.9 g, 100 %) which was used without purification.
Step 3: DIEA (4.14 g, 5.6 mL, 32.0 mmol, Eq: 2) and (benzotriazol-1- yloxy)tripyrrolidinophosphonium hexafluorophosphate (PyBOP, 12.5 g, 24.0 mmol, Eq: 1.5) were added to (R)-3-(2-aminophenylthio)-2-(benzyloxycarbonylamino)-3-methylbutanoic acid (6 g, 16.0 mmol, Eq: 1.00) in DMF (200 mL). The mixture was stirred at RT overnight then heated to 80 °C for 3 h. The mixture was poured onto sat. NH4C1 and extracted with EtOAc. The combined extracts were washed with H20, concentrated and the residue was purified by silica gel chromatography to give (R)-benzyl 2,2-dimethyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]thiazepin-3-ylcarbamate (3 g, 52 %).
Step 4: (R)-Benzyl 2,2-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]thiazepin-3- ylcarbamate (0.67 g, 1.88 mmol, Eq: 1.00) was added to 33 % HBr in AcOH (13.4 g, 9 mL, 54.7 mmol, Eq: 29.1). The mixture was stirred at RT for 75 min. and poured into 100 mL Et20 resulting in a precipitate which was filtered and washed with Et20. The solid material was added to sat. NaHC03, the mixture extracted with DCM and the combined extracts concentrated to give the title compound (343 mg, 82.2 %) as an oil which was used without purification.
Methyl 3-cyano-4-(3-(bromomethyl)-lH-indazol-l-yl)benzoate
Figure imgf000090_0001
In a similar manner to that described for the preparation of 2-(3-(bromomethyl)-lH- indazol-l-yl)benzonitrile except in Step 1 the mixture was diluted with H20 and the procuct recrystallized from MeOH and in Step 2 1,2-dichoroethane was used in place of CCI4, 3-methyl- lH-indazole (lg, 7.57 mmol)) and methyl 3-cyano-4-fluorobenzoate (1.36g, 7.57 mmol) as a white solid.
(S)-tert-Butyl 4-oxo-9-(trifluoromethyl)-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3- ylcarbamate
Figure imgf000090_0002
Step 1 : A solution of BOC-Ser-OH (981 mg, 4.78 mmol) in DMF (5.00 mL) was added to a suspension of NaH (60 % in mineral oil, 402 mg, 10.0 mmol) in DMF (5 mL). The mixture was stirred at 0 °C for 1 h and a solution of 2-fluoro-l-nitro-3-(trifluoromethyl)benzene (1 g, 4.78 mmol) in DMF (5 mL) was added. After 2 h the mixture was diluted with H20 and acidified to pH 3 with 1 N HCl. The mixture was extracted with EtOAc, the combined extracts dried over MgS04, filtered and the filtrate concentrated to give a residue that was purified by silica gel chromatography to afford (S)-2-(tert-butoxycarbonylamino)-3-(2-nitro-6-
(trifluoromethyl)phenoxy)propanoic acid (1.53 g, 81 %) as a light yellow solid. MS m/z 417 (M+Na)+ Step 2: 10 % Pd/C (150 mg) was added to a solution of (S)-2-(tert- butoxycarbonylamino)-3-(2-nitro-6-(trifluoromethyl)phenoxy)propanoic acid (1.5 g, 3.8 mmol) in MeOH and the mixture stirred under H2. After 4 h the mixture was filtered through Celite, the filter cake washed with MeOH and the filtrate concentrated to afford (S)-3-(2-amino-6- (trifluoromethyl)phenoxy)-2-(tert-butoxycarbonylamino)propanoic acid (1.23g, 89 %) which was used without purification.
Step 3: A solution of (S)-3-(2-amino-6-(trifiuoromethyl)phenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (1.23 g, 3.38 mmol) and EDCI (803 mg, 4.19 mmol) in DMF (25mL) was stirred at RT for 6 h, diluted with EtOAc and washed with H20. The combined aqueous washes were extracted with EtOAc and the combined organic solutions were dried over MgS04, filtered. The filtrate was concentrated to give a residue that was purified by silica gel chromatography to afford the title compound (1.04 g, 89 %) as a light brown oil. MS m/z 369 (M+Na)+
(2-(Difluoromethoxy)naphthalen- 1 -yl)methyl methanesulfonate
Figure imgf000091_0001
Step 1 : NaBH4 (255 mg, 6.73 mmol) was added to a suspension of 2-(difiuoromethoxy)- 1-naphthaldehyde (0.997 g, 4.49 mmol) in EtOH (29.9 mL). After 3 h the mixture was diluted with H20, extracted with EtOAc, the combined extracts were washed with brine (200 mL), dried over Na2S04, filtered, and the filtrate concentrated to give a residue that was purified by silica gel chromatography to provide (2-(difiuoromethoxy)naphthalen-l-yl)methanol (387 mg, 39 %) as an orange solid.
Step 2: Methanesulfonyl chloride (160 μί, 2.07 mmol) was added to a mixture of (2- (difluoromethoxy)naphthalen-l-yl)methanol (387 mg, 1.73 mmol) in CH2C12 (8.63 mL) and TEA (505 μί, 3.62 mmol). After 20 h the mixture was diluted with CH2C12, washed with H20, brine, dried over Na2S04, filtered and the filtrate was concentrated to provide (2- (difluoromethoxy)naphthalen-l-yl)methyl methanesulfonate (342 mg) as a brown oil that was used without further purification. Examples
Example 1
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-4,5-dihydro spiro[benzo[b][l,4]oxazepine-2,r-cyclohexane]-3-yl)-2-(methylamino)propanamide
hydrochloride
Figure imgf000092_0001
Step 1 : A mixture of methyl-(tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo [b] [ 1 ,4]oxazepine-2, 1 '-cyclohexan]-3 -ylamino))propan-2-yl carbamate (44.1 mg, 102 μηιοΐ, Eq: 1.00), 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (43.8 mg, 153 μιηοΐ, Eq: 1.5) Nal (23.0 mg, 153 μιηοΐ, Eq: 1.5) and Cs2C03 (49.9 mg, 153 μιηοΐ, Eq: 1.5) in DMF (2 mL) was heated to 65 °C. After 18 h the mixture was diluted with EtOAc, washed with sat. NaCl, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford tert-butyl (2S)-l-(5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)- (3S)-4-oxo-4,5-dihydro-3H-spiro[benzo[b][l,4]oxazepine-2,r-cyclohexane]-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (33.7 mg, 48 %) as a white foam. MS m/z 682.0 (MH+)
Step 2: tert-Butyl (2S)-l-(5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo- 4,5-dihydro-3H-spiro[benzo[b][l,4]oxazepine-2,r-cyclohexane]-3-ylamino)-l-oxopropan-2- yl(methyl)carbamate (33.7 mg, 49.5 μηιοΐ, Eq: 1.00) and 2 M HCl in Et20 (2 mL, 4.00 mmol, Eq: 80.8) were combined with MeOH (0.5 mL) to give a colorless solution. After 90 min the mixture was concentrated, the residue dissolved in MeCN/H20, and lyophilized to afford the title compound (26.0 mg, white solid, 85 %). MS m/z 582.0 (MH+).
Following analogous procedures described for the preparation of methyl-(tert-butyl)- (2S)-l-oxo-l-((3R)-(4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,l'- cyclohexan]-3-ylamino))propan-2-yl carbamate, methyl-(tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,r-cyclohexan]-3-ylamino))propan- 2-yl carbamate and in Example 1 for the preparation of (2S)-N-(5-((6-bromo-2- methoxynaphthalen- 1 -yl)methyl)-(3 S)-4-oxo-4,5-dihydro-3H-spiro[benzo [b] [ 1 ,4]oxazepine-2, 1 '- cyclohexane]-3-yl)-2-(methylamino)propanamide hydrochloride the compounds in Table 2 were prepared.
Table 2.
Figure imgf000093_0001
Figure imgf000094_0001
Figure imgf000095_0001
Figure imgf000096_0001
Figure imgf000097_0001
Intermediates obtained in the course of preparing the products listed in Table 2 can be derivatized further to afford additional compounds, as exemplified below.
Example 2
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-2-naphthoic acid trifluoroacetate
Figure imgf000097_0002
Step 1 : tert-butyl (S)-l-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan- 2-yl(methyl)carbamate (0.17 g, 249 μιηοΐ, Eq: 1.00), Pd(OAc)2 (2.24 mg, 9.96 μιηοΐ, Eq: 0.04) and 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene (Xantphos) (11.5 mg, 19.9 μηιοΐ, Eq: 0.08) were combined in a 5 mL microwave tube, the vessel was evacuated and purged with N2. MeOH (79.8 mg, 101 μΐ, 2.49 mmol, Eq: 10) and TEA (0.5 mL) were added, the vessel was purged with CO gas for approximately 30 sec and placed in an oil bath heated to 70 °C. After 18 h, the mixture was cooled, diluted with EtOAc, washed with 1 N HCl, H20, and brine. The organic mixture was dried over Na2S04, concentrated and the residue purified by flash chromatography to afford methyl 5-(((S)-3-((S)-2-(tert-butoxycarbonyl
(methyl)amino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'- pyran]-5(4H)-yl)methyl)-6-methoxy-2-naphthoate (1 10.5 mg, 67 % as a light yellow foam.) MS m/z 662.3 (MH+) Step 2: A solution of LiOH»H20 (35.0 mg, 835 μηιοΐ, Eq: 5) in H20 (4 niL) was added to a solution of methyl 5-(((S)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-6-methoxy- 2-naphthoate (110.5 mg, 167 μηιοΐ, Eq: 1.00) in THF (3 mL). After 18 h, the mixture was poured into 1 M HC1 (20 mL) and extracted with EtOAc. The combined organic extracts were washed with H20, brine, dried over Na2S04 and concentrated. The residue was dissolved in MeCN/H20, and lyophilized to afford 5-(((S)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-4- oxo-2',3^5^6'-tetrahydro-3H-spiro|¾enzo|¾][l ,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-6- methoxy-2-naphthoic acid (95.2 mg, 88 %) of white solid which was used without purification. MS m/z 648.2 (MH+)
Step 3: TFA (0.2 mL, 56.4 μιηοΐ, Eq: 1.00) was added to a solution of 5-(((S)-3-((S)-2- (tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-6-methoxy-2-naphthoic acid (36.5 mg, 56.4 μηιοΐ, Eq: 1.00) in DCM (1 mL). After 1 h, the mixture was concentrated, the residue dissolved in MeCN/H20, and lyophilized to afford the title compound (31.0 mg, 83 %) as an off- white solid. MS m/z 548.4 (MH+)
Example 3
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-N-(methylsulfonyl)-2-naphthamide trifiuoro acetate
Figure imgf000098_0001
Methanesulfonamide (10.9 mg, 115 μηιοΐ, Eq: 1.25) was added to a mixture of 5-(((S)-3- ((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-6-methoxy-2-naphthoic acid (59.4 mg, 91.7 μιηοΐ, Eq: 1.00), EDCI (22.0 mg, 115 μιηοΐ, Eq: 1.25) and DMAP (14.0 mg, 115 μιηοΐ, Eq: 1.25) in DCM (5 niL). After 2 h, the mixture was diluted with DCM, washed with 1 M HC1, brine, dried over Na2S04 and concentrated to afford 5-(((S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-6-methoxy-N-(methylsulfonyl)-2- naphthamide (65.4 mg) as a white foam which was used without purification.
Step 2 : 5-(((S)-3-((S)-2-(tert-Butoxycarbonyl(methyl)amino)propanamido)-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-6-methoxy- N-(methylsulfonyl)-2-naphthamide dissolved in DCM (1 mL) and 0.25 mL TFA was added. After 90 min the mixture was concentrated, the residue was dissolved in MeCN/H20, and lyophilized to afford the title compound (45.4 mg, 67 %) as a white solid. MS m/z 625.4 (MH+)
Example 4
(R)-N-[(S)-5-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-2,2-dimethyl-4-oxo-:
tetrahydro-benzo[b][l,4]thiazepin-3-yl]-2-methylamino-propionamide hydrochloride
Figure imgf000099_0001
In a similar manner to that described for Example 1, except in step 1 the mixture was heated for 15 h and in step 2 the mixture was stirred for 2 h, tert -butyl (S)-l-((R)-2,2-dimethyl-4- oxo-2,3,4,5-tetrahydrobenzo[b][l,4]thiazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (0.2067 g, 507 μηιοΐ, Eq: 1.00) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (217 mg, 761 μηιοΐ, Eq: 1.5) were converted to the title compound (49.0 mg) as a yellow solid. MS m/z 557.7 (MH+)
Example 5
(S)-N-(5-Benzyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2- methylaminopropanamide hydrochloride
Figure imgf000100_0001
Step 1 : NaH (60 % in mineral oil,16 mg, 0.40 mmol, Eq: 1.50) was added to a solution of tert-butyl (S)-l-(4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-ylamino)-l-oxopropan-2- yl(methyl)carbamate (100 mg, 0.26 mmol, Eq: 1.00) in DMF at RT. After 5 min. benzyl bromide (35 μί, 0.29mmol, Eq: 1.10) was added, the mixture was stirred for 35 min., diluted with 1 N HC1 and extracted with EtOAc. The organic extracts were washed with sat. NaHC03, brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford tert-butyl (S)-l-(5-benzyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (96 mg, 77 %).
Step 2: 1 M HC1 in Et20 (2 mL, 2.00 mmol, Eq: 26.7) was added to a solution of tert- butyl (S)-l-(5-benzyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylamino)-l-oxopropan- 2-yl(methyl)carbamate (35 mg, 75 μηιοΐ, Eq: 1.00) in MeOH (1 mL). After 2 h at RT, the mixture was stored in a freezer overnight, removed from the freezer and stirred an additional 2 h at RT. The mixture was concentrated, the residue dissolved in MeCN/H20, and lyophilized to afford the title compound (25 mg, 83 %). MS m/z 370.0 (MH+)
Example 6
N-(5-Benzyl-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride
Figure imgf000100_0002
Step 1 : 77 % 3-Chloroperoxybenzoic acid (mCPBA, 72 mg, 319 μηιοΐ, Eq: 2.50) was added to a solution of tert-butyl (S)-l-(5-benzyl-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (60 mg, 128 μηιοΐ, Eq: 1.00) in DCM (1.5 mL). After 45 min., the reaction was diluted with 1 N NaOH, extracted with EtOAc. The organic extracts were dried over Na2S04 and concentrated to afford tert-butyl (S)-l- (5-benzyl-l ,1 ,4-trioxo-2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3- ylamino)-! -oxopropan-2- yl(methyl)carbamate (52 mg, 81 % yield) as a colorless oil which solidified upon standing and was used without purification.
Step 2: 1 M HC1 in Et20 (4 mL, 4.00 mmol, Eq: 40) was added to a solution of tert-butyl (S)-l -(5 -benzyl- 1 ,1 ,4-trioxo-2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3- ylamino)-l- oxopropan-2-yl(methyl)carbamate in MeOH (1.5 mL). After 3 h, the mixture was concentrated, the residue dissolved in MeCN/H20, and lyophilized to afford the title compound (45 mg, 100 %). MS m/z 402.0 (MH+)
Example 7
N-(5-(4-Phenyl-butyl)-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride
Figure imgf000101_0001
Step 1 : 77 % mCPBA (62 mg, 274 μηιοΐ, Eq: 2.50) was added to a solution of tert-butyl (S)-l-(4-oxo-5-(4-phenyl-butyl)-2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (56 mg, 109 μηιοΐ, Eq: 1.00) in DCM (1.5 mL). and the mixture was stirred overnight. The mixture was diluted with 1 N NaOH and extracted with EtOAc. The combined extracts were washed with brine, dried over Na2S04, filtered and concentrated to afford tert-butyl (S)-l-(5-(4-phenyl-butyl)-l,l,4-trioxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (56 mg, 95 %) which was used without purification.
Step 2: In a similar manner to that described for Example 1 Step 2, except the mixture was stirred for 2 h, tert-butyl (S)-l-(5-(4-phenyl-butyl)-l,l,4-trioxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (56 mg, 103 μηιοΐ) was converted to the title compound (48 mg, 85 %). MS m/z 440.0 (MH+)
Example 8
N-(5-Biphenyl-3-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-yl)-2-(S)- methylamino-propionamide hydrochloride
Figure imgf000102_0001
Step 1 : A mixture of tert-butyl (S)-l-(4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]thiazepin-3- ylamino)-l-oxopropan-2-yl(methyl)carbamate (200 mg, 527 μηιοΐ, Eq: 1.00), 3-bromomethyl- biphenyl (195 mg, 0.79 mmol, Eq: 1.5) and Cs2C03 (49.9 mg, 153 μιηοΐ, Eq: 1.5) in DMF (6 mL) was heated to 60 °C. After 1 h the mixture was diluted with 1 N HCl and extracted with EtOAc. The combined extracts were dried over Na2S04, filtered and concentrated. The residue was purified by flash chromatography to afford tert-butyl (S)-l-((5-biphenyl-3-ylmethyl)-4-oxo- 2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (264 mg, 92 %).
Step 2: In a similar manner to that described for Example 1 Step 2, except the mixture was stirred for 3 h, tert-butyl (S)-l-((5-biphenyl-3-ylmethyl)-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (44 mg, 80 μηιοΐ) was converted to the title compound (38 mg, 100 %). MS m/z 445.9 (MH+)
Example 9
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-8,9-difiuoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride
Figure imgf000102_0002
In a similar manner to that described for Example 1, except in Step 1 the mixture was heated at 60 °C and in Step 2 the mixture was stirred for 6 h, tert-butyl-(2S)-l-oxo-l-((3R)-(8,9- difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (40 mg, 85.2 μηιοΐ) was converted to the title compound (40 mg). MS m/z 619.8 (MH+)
Example 10
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8,9-difluoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride
Figure imgf000103_0001
In a similar manner to that described for Example 1, except in Step 1 the mixture was heated at 60 °C and in Step 2 the mixture was stirred for 6 h, tert-butyl-(2S)-l-oxo-l-((3S)-(8,9- difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (42 mg, 89.5 μηιοΐ) was converted to the title compound (36 mg). MS m/z 619.8 (MH+)
Example 11
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fiuoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride
Figure imgf000103_0002
In a similar manner to that described for Example 1, except in Step 1 the mixture was stirred for 4.5 h and in Step 2 the mixture was stirred overnight, tert-butyl-(2S)-l-oxo-l-((3R)- (9-fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (64 mg, 142 μηιοΐ) was converted to the title compound (63 mg). MS m/z 601.9 (MH+)
Example 12
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fiuoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride
Figure imgf000104_0001
In a similar manner to that described for Example 1, except in Step 1 the mixture was stirred for 4.5 h and in Step 2 the mixture was stirred overnight, tert-butyl-(2S)-l-oxo-l-((3S)-(9- difluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (49 mg, 109 μηιοΐ) was converted to the title compound (49 mg). MS m/z 601.9 (MH+)
Example 13
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fiuoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride
Figure imgf000105_0001
In a similar manner to that described for Example 1, except in Step 1 the mixture was stirred for 4 h and in Step 2 the mixture was stirred overnight, methyl-(tert-butyl)-(2S)-l-oxo-l- ((3R)-(9-fluoro-4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino))butan-2-yl carbamate (50 mg, 107 μηιοΐ) was converted to the title compound (57 mg). MS m/z 616.0 (MH+)
Example 14
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fiuoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride
Figure imgf000105_0002
In a similar manner to that described for Example 1, except in Step 1 the mixture was stirred for 4 h and in Step 2 the mixture was stirred overnight, methyl-(tert-butyl)-(2S)-l-oxo-l- ((3S)-(9-fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))butan-2-yl carbamate (51.5 mg, 180 μηιοΐ) was converted to the title compound (58 mg). MS m/z 615.9 (MH+)
Example 15 (2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fiuoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride
Figure imgf000106_0001
In a similar manner to that described for Example 1, except in Step 1 the mixture was stirred for 4 h and in Step 2 the mixture was stirred for 4 h, tert-butyl-(2S)-l-oxo-l-((3S)-(8- fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (39.8 mg, 140 μηιοΐ) was converted to the title compound (30 mg). MS m/z 601.9 (MH+)
Example 16
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fiuoro-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride
Figure imgf000106_0002
In a similar manner to that described for Example 1, except in Step 1 the mixture was stirred for 4 h and in Step 2 the mixture was stirred for 4 h, methyl-(tert-butyl)-(2S)-l-oxo-l- ((3S)-(8-fluoro-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))butan-2-yl carbamate (38.6 mg, 135 μηιοΐ) was converted to the title compound (29 mg). MS m/z 616.0 (MH+) Example 17
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(2- hydroxyethylamino)propanamide
Figure imgf000107_0001
Sodium cyanoborohydride (5.14 mg, 81.8 μηιοΐ, Eq: 1.50) was added to a solution of (S)- N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-amino-propanamide (31 mg, 54.5 μmol, Eq: 1.00), glycolaldehyde dimer (3.6 mg, 30.0 μηιοΐ, Eq: 0.55) and acetic acid (3.27 mg, 3.15 μΐ, 54.5 μηιοΐ, Eq: 1.00) in MeOH (1 mL) and the mixture was stirred at RT overnight. The mixture was diluted with 1 N HC1 and H20/1 N NaOH was added to adjust the pH to ~ 8 - 9. The mixture was extracted with EtOAc, the combined extracts were washed with brine, dried over Na2S04 and concentrated. The resulting material was purified by flash chromatography to afford the title compound (30 mg, 90 % yield). MS m/z 613.8 (MH+).
Example 18
(2S)-N-(5-((3-Methoxyquinolin-N-oxide-4-yl)methyl)-(3S)-4-oxo-2',3',5',6'-tetrahydro- 3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide
Figure imgf000107_0002
Step 1 : 77 % mCPBA (23.3 mg, 104 μηιοΐ, Eq: 2.1) was added to a solution of tert-butyl (S)-l-((S)-5-((3-methoxyquinolin-4-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (30 mg, 49.6 μηιοΐ, Eq: 1.00) in DCM (1 niL) and the mixture was stirred at RT overnight. The mixture was diluted with 0.1 N NaOH, extracted with EtOAc and the combined extracts washed with brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford tert-butyl (S)-l-((S)-5-((3-methoxyquinolin-N-oxide-4-yl)methyl)-4- oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (22 mg, 71 %). MS m/z 621.1 (MH+)
Step 2: 2 M HC1 in ether (403 μΐ, 806 μηιοΐ, Eq: 25) was added to a solution of tert-butyl (S)-l-((S)-5-((3-methoxyquinolin-N-oxide-4-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (20 mg, 32.2 μηιοΐ, Eq: 1.00) in MeOH (0.5 mL). After 2.5 h, the mixture was concentrated, the residue dissolved in MeCN/H20 and the solution lyophilized. The resulting material was partitioned between EtOAc and 1 N HC1, the layers separated and the aqueous layer was made basic with 10 N NaOH and extracted with EtOAc. The combined organic layers were washed with brine, dried over Na2S04 and concentrated under reduced pressure give a substance which was lyophilized from MeCN/H20 to afford the title compound (14 mg, 84 %). MS m/z 521.1 (MH+)
Example 19
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methyl-d3-amino)propanamide hydrochloride
Figure imgf000108_0001
Step 1 : CS2CO3 (56.0 mg, 172 μηιοΐ, Eq: 1.5) and Nal (25.8 mg, 172 μηιοΐ, Eq: 1.5) were added to a solution of methyl-d3-(tert-butyl)-(2S)-l-oxo-l-((3S)-(4-oxo-2',3',4,5,5',6'-hexahydro- 3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino))propan-2-yl carbamate (50 mg, 115 μηιοΐ, Eq: 1.00) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (49.1 mg, 172 μηιοΐ, Eq: 1.5) and the mixture was stirred at 65 °C overnight. The mixture was diluted with H20 and extracted with EtOAc, the combined extracts were washed with brine, dried over Na2S04 and concentrated under reduced pressure. The resulting material was purified by flash chromatography to afford tert-butyl (S)-l-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)- 4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l- oxopropan-2-yl(methyl-d3)carbamate (57 mg, 73 %). MS m/z 687.0 (MH+)
Step 2: In a similar manner to that described for Example 1 Step 2 except the mixture was stirred 3 h, tert-butyl (S)-l-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan- 2-yl(methyl-d3)carbamate (57 mg, 83.1 μηιοΐ) was converted to the title compound (42 mg, 81 %). MS m/z 587.0 (MH+)
Example 20
(2S)-N-(5-((6-Bromo-2-(methoxy-d3)-naphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methyl-d3-amino)propanamide hydrochloride
Figure imgf000109_0001
In a similar manner to that described for Example 19 except in Step 1 the Nal was omitted and in Step 2 the mixture was stirred for 2 h, methyl-d3-(tert-butyl)-(2S)-l-oxo-l-((3S)- (4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino))propan-2-yl carbamate (65 mg, 149 μηιοΐ, Eq: 1.00) and 6-bromo-l-chloromethyl-2- (methoxy-d3)-naphthalene (64.5 mg, 223 μηιοΐ, Eq: 1.5) were converted to the title compound (35 mg). MS m/z 589.8 (MH+)
Example 21
(R)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide and (S)-N- ((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide
Figure imgf000110_0001
Step 1 : A solution of HBTU (550 mg, 1.45 mmol, Eq: 1.2) and ΗΟΒΤ·Η20 (222 mg, 1.45 mmol, Eq: 1.2) in DMF (8 mL) were added to a solution of 3-amino-2',3',5',6'-tetrahydro- 3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-4(5H)-one (0.3 g, 1.21 mmol, Eq: 1.00), BOC-Ala- OH (229 mg, 1.21 mmol, Eq: 1.00) and TEA (367 mg, 505 μΐ, 3.62 mmol, Eq: 3) in DMF (8 mL). After 2 d, the mixture was poured into EtOAc, washed with 1 :1 sat NaHCC^/sat NaCl, brine, dried over Na2S04 and concentrated. The residue was purified by flash chromatography to afford tert-butyl (2S)-l-oxo-l-(4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine- 2,4'-pyran]-3-ylamino)propan-2-ylcarbamate (0.46 g, 91 %) as a white foam. MS m/z 420.0 (MH+)
Step 2: In a similar manner to that described for Example 1 Step 1 except the mixture was heated at 60 °C for 6 h, tert-butyl (2S)-l-oxo-l-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)propan-2-ylcarbamate (0.46 g, 1.1 mmol, Eq: 1.00) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (470 mg, 1.64 mmol, Eq: 1.5) were converted to tert-butyl (2S)-l-(5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan- 2-ylcarbamate (0.5222 g, 71.2%) as a white foam. MS m/z 669.9 (MH+)
Step 3: 2.0 M HC1 in Et20 (25 mL, 50.0 mmol, Eq: 64.0) was added to a solution of tert- butyl (2S)-l-(5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro- 3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-ylcarbamate (0.5222 g, 781 μηιοΐ, Eq: 1.00) in MeOH (5 mL). After 90 min. the reaction was concentrated to remove the Et20, the resulting solution poured into 1 M NaOH and the mixture extracted with DCM. The combined organic extracts were washed with H20, brine, dried over Na2S04 and concentrated to afford a diastereomeric mixture of compounds (0.4186 g) as a white solid. The diastereomers were separated by chiral SFC to afford (R)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l- yl)methyl)-4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- aminopropanamide (47.5 mg) which eluted first (MS m/z 569.9 (MH+)) and (S)-N-((S)-5-((6- bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide (42.7mg) which eluted second. MS m/z 569.9 (MH+)
Example 22
(S)-N-{(R)-9-[2-(2-Methoxy-ethoxy)-acetylamino]-5-naphthalen-l-ylmethyl-4-oxo- 2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3-yl} -2-methylamino-propionamide hydrochloride
Figure imgf000111_0001
Step 1 : (2-Methoxy-ethoxy)-acetyl chloride (29.8 μΐ,, 224 μmol) was added to a solution of [(S)- 1 -((R)-9-amino-5 -naphthalen- 1 -ylmethyl-4-oxo-2,3 ,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl]-methyl-carbamic acid tert-butyl ester (100 mg, 187 μιηοΐ), DMAP (1.1 mg, 9.4 μιηοΐ) and TEA (104 μΐ,, 748 μιηοΐ) in pyridine (2 mL). After 6 h the mixture was poured into 0.5 M HCl (5 mL) and extracted with EtOAc. The combined extracts were washed with H20, brine, dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography ((S)-l-{(R)-9-[2-(2-methoxy-ethoxy)-acetylamino]-5- naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylcarbamoyl} -ethyl)- methyl-carbamic acid tert-butyl ester (80 mg, 66 %)
Step 2: Hydrogen chloride gas was bubbled into a solution of ((S)-l-{(R)-9-[2-(2- methoxy-ethoxy)-acetylamino]-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-ylcarbamoyl}-ethyl)-methyl-carbamic acid tert-butyl ester (70 mg, 108 μηιοΐ) in dioxane (5 mL) at 0 °C for 1 min, the mixture was warmed to RT and stirred for 1 h. The mixture was concentrated, the residue was triturated with Et20 and the resulting solid was filtered, washed with Et20 and dried to give the title compound (25 mg, 40 %). HR-MS: calcd for C29H34N405S (MH+) 551.2326, found 551.2323.
Following the procedures described for the preparation of Example 22 the compounds in Table 3 were prepared. Table 3
Figure imgf000112_0001
- Ill -
Figure imgf000113_0001
Example 23
1 -Acetyl-piperidine-4-carboxylic acid [(R)-3-((S)-2-methylamino-propionylamino)-5- naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide
Figure imgf000113_0002
In a similar manner to that described for Example 22, [(S)-l-((R)-9-amino-5-naphthalen- l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl]-methyl- carbamic acid tert-butyl ester and l-acetyl-piperidine-4-carbonyl chloride were converted to 1- acetyl-piperidine-4-carboxylic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride. The material obtained after trituration was purified by reverse phase HPLC to give 1-acetyl- piperidine-4-carboxylic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide trifluoroacetate and this material was partitioned between EtOAc (10 mL) and a saturated solution of NaHC03 (5 mL). The organic layer was washed with H20, brine, dried over Na2S04, filtered and concentrated to give the title compound. HRMS: calcd. for C32H37N504S (MH+) 588.2639, found 588.2639
Example 24
5-Oxo-hexanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride
Figure imgf000114_0001
Phosphorus oxychloride (34.4 mg, 0.22 mmol) was added to a solution of [(S)-l-((R)-9- amino-5 -naphthalen- 1 -ylmethyl-4-oxo-2,3 ,4,5-tetrahydro-benzo [b][ 1 ,4]thiazepin-3 - ylcarbamoyl)-ethyl]-methyl-carbamic acid tert-butyl ester (80 mg, 0.15 mmol) and 5-oxo- hexanoic acid (29.2 mg, 0.22 mmol) in pyridine (1.0 mL). After 2 h, the mixture was poured into 0.5 M HC1 (5 mL) and extracted with EtOAc, the combined extracts were washed with water, brine, dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to afford the title compound. HR-MS: calcd. for C30H34N4O4S (MH+) 547.2374, found 547.2374
Example 25
3,4,5-Trimethoxy-N-[(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-benzamide hydrochloride
Figure imgf000115_0001
In a similar manner to that described for Example 24, [(S)-l-((R)-9-amino-5-naphthalen- l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl]-methyl- carbamic acid tert-butyl ester and 3,4,5-trimethoxy-benzoic acid were converted to the title compound. HR-MS: calcd. for C34H36N4O6S (MH+) 629.2429, found 629.2428
Example 26
6-Oxo-heptanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride
Figure imgf000115_0002
In a similar manner to that described for Example 24, [(S)-l-((R)-9-amino-5-naphthalen- l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl]-methyl- carbamic acid tert-butyl ester and 6-oxo-heptanoic acid were converted to the title compound. HR-MS: calcd. for C31H36N4O4S (MH+) 561.2530, found 561.2530
Example 27
(S)-N-((R)-9-Amino-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-yl)-2-methylamino-propionamide hydrochloride
Figure imgf000116_0001
In a similar manner to that described for Example 22 Step 2, [(S)-l-((R)-9-amino-5- naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl]- methyl-carbamic acid tert-butyl ester was converted to the title compound. HR-MS: calcd. for C24H26N4O2S (MH+) 435.1849, found 435.1850
Example 28
N-[(R)-3-((S)-2-Methylamino-propionylamino)-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5- tetrahydro-benzo[b][l ,4]thiazepin-9-yl]-benzamide hydrochloride
Figure imgf000116_0002
In a similar manner to that described for Example 22, [(S)-l-((R)-9-amino-5-naphthalen- l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-ylcarbamoyl)-ethyl]-methyl- carbamic acid tert-butyl ester and benzoyl chloride were converted to the title compound. MS m/z 539 (MH+)
Example 29
(S)-N- [(S)-9-(6-Bromo-2-methoxy-naphthalen- 1 -ylmethyl)-8-oxo-6 ,7 ,8 ,9-tetrahydro-5 - oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide trifiuoroacetate
Figure imgf000117_0001
Step 1 : A mixture of tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2-yl)carbamate (1.1 g, 3.03 mmol, Eq: 1.00) (Example 1), 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (951 mg, 3.33 mmol, Eq: 1.10), Cs2C03 (1.08 g, 3.33 mmol, Eq: 1.10), and Nal (499 mg, 3.33 mmol, Eq: 1.1) in DMF (20 mL) was stirred for 3.5 at RT then heated at 50 °C for 1 h then at 60 °C for 30 min. The mixture was cooled, diluted with EtOAc, washed with water and brine. The organic solution was dried over Na2S04 and concentrated. The residue was purified by silica gel chromatography to afford tert- butyl (S)- 1 -((S)-5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (1.00 g, 1.63 mmol, 53.9 %) as a light yellow foam.
Step 2: TFA (1.48 g, 1 mL, 13.0 mmol, Eq: 153) was added to a solution of tert-butyl (S)- l-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)-l-oxopropan-2-yl(methyl)carbamate (52 mg, 84.9 μηιοΐ, Eq: 1.00) in DCM and at 0 °C. After lh the mixture was concentrated and the residue was triturated with Et20 to afford the title compound (30 mg, 58.5 μηιοΐ, 69.0 %) as a light brown solid. MS m/z (MH+) 363.0
In a similar manner to that described for Example 29, the conditions can be varied so that the temperature can range from 50 °C - 70 °C and the reaction time can range from 2 - 24 h and 1 - 3 eq. of Nal can be optionally added tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)propan-2-yl)carbamate can be converted the compounds shown in Table 4.
Table 4
m/z
Entry Final Product
(MH+)
Figure imgf000118_0001
Example 30
(S)-N-[(S)-9-(6-Cyclopropyl-2-methoxy-naphthalen-l-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methyla mino-propionamide trifluoroacetate
Figure imgf000118_0002
Step 1 : For a duration of 5 min., N2 was bubbled through a mixture of tert-butyl (S)-l- ((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (200 mg, 327 μηιοΐ, Eq: 1.00), cyclopropylboronic acid (33.7 mg, 392 μηιοΐ, Eq: 1.20), Na2C03 (408 μΐ, 816 μηιοΐ, Eq: 2.50) in 1,4-dioxane (2 mL) then Pd(Ph3P)4 (18.9 mg, 16.3 μηιοΐ, Eq: 0.05) was added. The mixture was heated to reflux overnight, cooled and diluted with EtOAc. The mixture was washed with water, brine, dried over Na2S04 and concentrated to give tert-butyl (S)-l-((S)-5-((6- cyclopropyl-2-methoxynaphthalen- 1 -yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin- 3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (24 mg, 41.8 μηιοΐ, 12.8 %) which was used without purification.
Step 2: In a similar manner to that described for Example 29 Step 2 except the mixture was stirred at 0 °C for 1 h and at RT for 1 h, tert-butyl (S)-l-((S)-5-((6-cyclopropyl-2- methoxynaphthalen- 1 -yl)methyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 - oxopropan-2-yl(methyl)carbamate (24 mg, 41.8 μηιοΐ) was converted to the title compound (23 mg, 96 %). MS m/z (MH+) 474.1
Example 31
Methyl 6-methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-2-naphthoate trifluoroacetate
Figure imgf000119_0001
Step 1 : A mixture of tert-butyl (S)-l-((S)-5-((6-bromo-2-methoxynaphthalen-l- yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 -oxopropan-2- yl(methyl)carbamate (1.8 g, 2.94 mmol, Eq: 1.00), Pd(OAc)2 (33.0 mg, 147 μηιοΐ, Eq: 0.05) and 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene (Xantphos) (170 mg, 294 μηιοΐ, Eq: 0.10) in a microwave tube was evacuated and purged with N2. MeOH (1.43 g, 1.8 mL, 44.5 mmol, Eq: 15.1) and TEA were added, the vessel was purged with CO and heated at 70 °C under CO overnight. The mixture was concentrated and the residue was purified by silica gel chromatography to afford methyl 5-(((S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)- yl)methyl)-6-methoxy-2-naphthoate (1.24 g, 2.1 mmol, 71.3 %).
Step 2: In a similar manner to that described for Example 29 Step 2, methyl 5-(((S)-3- ((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate (100 mg, 169 μηιοΐ) was converted to the title compound (75 mg, 124 μηιοΐ, 73.3 %). MS m/z (MH+) 492.2 Example 32
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-2-naphthoic acid trifluoroacetate
Figure imgf000120_0001
Step 1 : LiOH»H20 (24.0 mg, 573 μηιοΐ, Eq: 3) was dissolved in water and the solution was added to a solution of methyl 5-(((S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)- yl)methyl)-6-methoxy-2-naphthoate (113 mg, 191 μηιοΐ, Eq: 1.00) in MeOH (3 mL) and the mixture was heated to 50 °C for 1 h and then to 60 °C for 1 h. The mixture was cooled, KHS04 solution was added and the mixture extracted with EtOAc. The combined extracts were concentrated and the residue purified by silica gel chromatography to afford 5-(((S)-3-((S)-2- (tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-3,4-dihydrobenzo[b][l,4]oxazepin- 5(2H)-yl)methyl)-6-methoxy-2 -naphthoic acid (103 mg, 93 %) as a white powder.
Step 2: In a similar manner to that described for Example 29 Step 2, 5-(((S)-3-((S)-2- (tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-3,4-dihydrobenzo[b][l,4]oxazepin- 5(2H)-yl)methyl)-6-methoxy-2 -naphthoic acid (102 mg, 177 μηιοΐ) was converted to the title compound (73 mg, 58 %). MS m/z (MH+) 478.2
Example 33
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid (2-hydroxy-ethyl)-methyl- amide
Figure imgf000121_0001
Step 1 : A mixture of 5-(((S)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)- 4-0X0-3 ,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoic acid (100 mg, 173 μηιοΐ, Eq: 1.00), 2-(methylamino)ethanol (26.0 mg, 27.8 μΐ, 346 μηιοΐ, Eq: 2.00), ΗΟΒΤ·Η20 (31.8 mg, 208 μιηοΐ, Eq: 1.20), HBTU (78.8 mg, 208 μιηοΐ, Eq: 1.2), DIEA (67.1 mg, 90.5 μΐ, 519 μηιοΐ, Eq: 3.00) in DMF was stirred at 0 °C for 2 h. The mixture was diluted with EtOAc, washed with water, brine, dried over Na2S04 and concentrated. The residue was purified by silica gel chromatography to afford tert-butyl (S)-l-((S)-5-((6-((2- hydroxyethyl)(methyl)carbamoyl)-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (94 mg, 85 % yield) as an oil.
Step 2: TFA (1.48 g, lmL, 13.0 mmol, Eq: 88.6) was added to a solution of tert-butyl (S)- l-((S)-5-((6-((2-hydroxyethyl)(methyl)carbamoyl)-2-methoxynaphthalen-l-yl)methyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (93 mg, 147 μηιοΐ, Eq: 1.00) in DCM at 0 °C. After 1 h, the mixture was concentrated and the residue tritrurated with Et20. The resulting material was dissolved in DCM, washed with sat. NaHC03 solution and the organic layer concentrated. The residue was purified by silica gel chromatography to afford the title compound as a white powder. MS m/z (MH+) 535.2
Example 34
4-({6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5- oxa-9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carbonyl}-amino)-butyric acid trifiuoro acetate
Figure imgf000122_0001
Step 1 : A mixture of 5-(((S)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)- 4-0X0-3 ,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoic acid (100 mg, 173 μιηοΐ, Eq: 1.00), DIEA (90.5 μΐ, 519 μιηοΐ, Eq: 3.00), ΗΟΒΤ·Η20 (31.8 mg, 208 μιηοΐ, Eq: 1.20), HBTU (78.8 mg, 208 μηιοΐ, Eq: 1.2), tert-butyl 3-aminopropanoate hydrochloride (31.6 mg, 173 μηιοΐ, Eq: 1.00) in DMF was stirred at 0 °C for 2 h. The mixture was diluted with EtOAc, washed with water and brine. The organic solution was dried over Na2S04, filtered, concentrated and the residue purified by silica gel chromatography to afford 3-[(5-{(S)-7-[(S)-2- (tert-butoxycarbonyl-methyl-amino)-propionylamino]-8-oxo-7,8-dihydro-6H-5-oxa-9-aza- benzocyclohepten-9-ylmethyl} -6-methoxy-naphthalene-2-carbonyl)-amino]-propionic acid tert- butyl ester (93 mg, 76 %).
Step 2: In a similar manner to that described for Example 29 Step 2, 3-[(5-{(S)-7-[(S)-2- (tert-butoxycarbonyl-methyl-amino)-propionylamino]-8-oxo-7,8-dihydro-6H-5-oxa-9-aza- benzocyclohepten-9-ylmethyl} -6-methoxy-naphthalene-2-carbonyl)-amino]-propionic acid tert- butyl ester (91mg, 129 μηιοΐ) was converted to the title compound. MS m/z (MH+) 549.5
Example 35
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid dimethylamide trifiuoro acetate
Figure imgf000122_0002
In a similar manner to that described for Example 33 except in Step 1 DIEA was omitted, THF was used in place of DMF and the material was not purified, 5-(((S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)- yl)methyl)-6-methoxy-2-naphthoic acid (96 mg, 166 μηιοΐ, Eq: 1.00) and dimethylamine (249 μΐ, 499 μηιοΐ, Eq: 3.00) was converted to the title compound (99 mg). MS m/z (MH+) 505.2
Example 36
(S)-N-[(S)-9-(7-Bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide trifiuoroacetate
Figure imgf000123_0001
Step 1 : A mixture of (S)-3-amino-8-methyl-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifiuoroacetate (1.60 g, 5.23 mmol, Eq: 1.00), (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (1.06 g, 5.23 mmol, Eq: 1.00), HOBT (801 mg, 5.23 mmol, Eq: 1.00), HBTU (1.98 g, 5.23 mmol, Eq: 1.00) at 0 °C and DIEA (2.03 g, 2.73 mL, 15.7 mmol, Eq: 3.00) in DMF (50 mL) was stirred at 0 °C for 1 h, diluted with EtOAc, washed with water, brine, dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to afford methyl-[(S)-l-((S)-3-methyl-8-oxo-6,7,8,9-tetrahydro-5-oxa- 9-aza-benzocyclohepten-7-ylcarbamoyl)-ethyl]-carbamic acid tert-butyl ester (2.04 g) which was used without purification.
Step 2: A mixture of methyl-[(S)-l-((S)-3-methyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza- benzocyclohepten-7-ylcarbamoyl)-ethyl]-carbamic acid tert-butyl ester (241 mg, 639 μηιοΐ, Eq: 1.00), Nal (95.7 mg, 639 μιηοΐ, Eq: 1.00), Cs2C03 (312 mg, 958 μιηοΐ, Eq: 1.50), 6-bromo-l- (chloromethyl)-2-methoxynaphthalene (219 mg, 766 μηιοΐ, Eq: 1.20) in DMF (3 mL) was stirred at RT for 1 h and at 50 °C for 1 h. The mixture was diluted with EtOAc, washed with water, brine, dried over Na2S04, filtered and concentrated. The resulting material was purified by silica gel chromatography to afford {(S)-l-[(S)-9-(6-bromo-2-methoxy-naphthalen-l-ylmethyl)-3- methyl-8-oxo-6 ,7,8 ,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-ylcarbamoyl]-ethyl} -methyl- carbamic acid tert-butyl ester (63 mg, 16 %) as an oil.
Step 3: In a similar manner to that described for Example 29 Step 2, {(S)-l-[(S)-9-(6- bromo-2-methoxy-naphthalen-l-ylmethyl)-3-methyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza- benzocyclohepten-7-ylcarbamoyl]-ethyl}-methyl-carbamic acid tert-butyl ester (60 mg, 95.8 μηιοΐ) was converted to the title compound (37 mg). MS m/z MH+ 527.8
Example 37
(2S,3R)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8- oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide
trifiuoracetate
Figure imgf000124_0001
Step 1 : In a similar manner to that described for Example 36 Step 1 except 4 equivalents of DIEA were used and the mixture was stirred at 0 °C for 2 h, (S)-3-amino-8-methyl-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoro acetate (0.50 g, 1.63 mmol) and (2S,3R)-2- (tert-butoxycarbonylamino)-3-hydroxybutanoic acid (358 mg, 1.63 mmol) were converted to tert-butyl (2S,3R)-3-hydroxy-l-((S)-8-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3- ylamino)-l-oxobutan-2-ylcarbamate (500 mg, 78 %) as a light yellow foam.
Step 2: In a similar manner to that described for Example 36 Step 2 except the mixture was heated at 50 °C for 2 h, tert-butyl (2S,3R)-3-hydroxy-l-((S)-8-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)-l-oxobutan-2-ylcarbamate (160 mg, 407 μηιοΐ, Eq: 1.00) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (174 mg, 610 μηιοΐ, Eq: 1.50) were converted to tert-butyl (2S,3R)-l-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-8- methyl-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)-3 -hydroxy- 1 -oxobutan-2 - ylcarbamate (128 mg, 49 %) as white powder. Step 3: In a similar manner to that described for Example 29 Step 2, tert-butyl (2S,3R)-1- ((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-8-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)-3 -hydroxy- l-oxobutan-2-ylcarbamate (80 mg, 125 μηιοΐ) was converted to the title compound (54 mg, 66 %). MS m/z MH+ 543.9
Example 38
(2S,3S)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8- oxo-6,7,8,9-tetrahydro-5-oxa-9-azabenzocyclohepten-7-yl]-3-hydroxy-butyramide
trifiuoro acetate
Figure imgf000125_0001
Step 1 : In a similar manner to that described for Example 36 Step 1 except 4 equivalents of DIEA were used and the mixture was stirred at 0 °C for 2 h, (S)-3-amino-8-methyl-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate (0.3 g, 980 μηιοΐ) and (2S,3S)-2-(tert- butoxycarbonylamino)-3-hydroxybutanoic acid dicyclohexylamine salt (0.39 mg, 980 μηιοΐ, Eq: 1.00) were converted to [(lS,2S)-2-hydroxy-l-((S)-3-methyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9- aza-benzocyclohepten-7-ylcarbamoyl)-propyl]-carbamic acid tert-butyl ester (0.37 g, 99 %).
Step 2: In a similar manner to that described for Example 36 Step 2 the mixture was heated at 50 °C for 2 h, [(lS,2S)-2-hydroxy-l-((S)-3-methyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9- aza-benzocyclohepten-7-ylcarbamoyl)-propyl]-carbamic acid tert-butyl ester (280 mg, 712 μηιοΐ) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (244 mg, 854 μηιοΐ) were converted to {(l S,2S)-l-[(S)-9-(6-bromo-2-methoxy-naphthalen-l-ylmethyl)-3-methyl-8-oxo- 6,7, 8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-ylcarbamoyl]-2 -hydroxy-propyl} -carbamic acid tert-butyl ester (190 mg, 42 %).
Step 3: In a similar manner to that described for Example 29 Step 2, {(lS,2S)-l-[(S)-9- (6-bromo-2-methoxy-naphthalen- 1 -ylmethyl)-3 -methyl-8-oxo-6 ,7 ,8 ,9-tetrahydro-5 -oxa-9-aza- benzocyclohepten-7-ylcarbamoyl]-2 -hydroxy-propyl} -carbamic acid tert-butyl ester (185mg, 288 μηιοΐ) was converted to the title compound (180 mg, 274 μηιοΐ). MS m/z MH+ 544.1 Example 39
(S)-N-((2S,3S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-2,8-dimethyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide trifluoroacetate
Figure imgf000126_0001
Step 1 : In a similar manner to that described for Example 36 Step 1 except 4 equivalents of DIEA were used, (2S,3S)-3-amino-2,8-dimethyl-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)- one trifluoroacetate (100 mg, 278 μηιοΐ) and (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (56.5 mg, 278 μηιοΐ) were converted to tert-butyl (S)-l-((2S,3S)-2,8-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (95 mg, 87 %).
Step 2: In a similar manner to that described for Example 36 Step 2 the mixture was heated at 60 °C for 1 h and Nal was omitted, tert-butyl (S)-l-((2S,3S)-2,8-dimethyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (92 mg, 235 μηιοΐ) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (101 mg, 352 μηιοΐ) were converted to tert-butyl (S)-l-((2S,3S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-2,8- dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)-l-oxopropan-2- yl(methyl)carbamate (89 mg, 59 %).
Step 3: In a similar manner to that described for Example 29 Step 2 except the product was not triturated, tert-butyl (S)-l-((2S,3S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-2,8- dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)-l-oxopropan-2- yl(methyl)carbamate (15mg, 23.4 μηιοΐ) was converted to the title compound (12.4 mg, 81 %) MS m/z MH+ 542.2
Example 40
Methyl 5-(((2S,3S)-2,8-dimethyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate trifluoroacetate
Figure imgf000127_0001
Step 1 : A mixture of tert-butyl (S)-l-((2S,3S)-5-((6-bromo-2-methoxynaphthalen-l- yl)methyl)-2,8-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)-l- oxopropan-2-yl(methyl)carbamate (70mg, 109 μηιοΐ, Eq: 1.00), Pd(OAc)2 (2.45 mg, 10.9 μηιοΐ, Eq: 0.1), Xantphos (12.6 mg, 21.9 μιηοΐ, Eq: 0.2), MeOH (35.0 mg, 44.2 μΐ, 1.09 mmol, Eq: 10), and TEA in a microwave tube was purged with CO and heated at 70 °C under CO overnight. The mixture was diluted with EtOAc, water, brine, dried over Na2S04 and concentrated. The residue was purified by silica gel chromatography to afford methyl 5-(((2S,3S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-2 ,8 -dimethyl-4-oxo-3 ,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate (43 mg, 63 %)
Step 2: In a similar manner to that described for Example 29 Step 2, methyl 5-(((2S,3S)- 3-((S)-2-(tert-butoxycarbonyl(methyl)a mino)propanamido)-2,8-dimethyl-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate (41 mg, 66.2 μηιοΐ) was converted to the title compound (35 mg, 83 %). MS m/z MH+ 520.2
Example 41
(2S,3S)-2-Amino-N-[(6S,7S)-9-(6-bromo-2-methoxy-naphthalen-l-ylmethyl)-3,6- dimethyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide trifluoro acetate
Figure imgf000127_0002
Step 1 : In a similar manner to that described for Example 36 Step 1 except 4 equivalents of DIEA were used and the mixture was stirred at 0 °C for 2 h, (2S,3S)-3-amino-2,8-dimethyl- 2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate (75 mg, 208 μηιοΐ) and (2S,3S)-2- (tert-butoxycarbonylamino)-3-hydroxybutanoic acid dicyclohexylamine salt (83.4 mg, 208 μηιοΐ, Eq: 1.00) were converted to tert-butyl (2S,3S)-l-((2S,3S)-2,8-dimethyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-3-hydroxy-l-oxobutan-2-ylcarbamate (72mg,
85 %).
Step 2: In a similar manner to that described for Example 36 Step 2 except the mixture was heated at 60 °C for 2 h and Nal was omitted, tert-butyl (2S,3S)-l-((2S,3S)-2,8-dimethyl-4- oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)-3-hydroxy-l-oxobutan-2-ylcarbamate (70 mg, 172 μηιοΐ, Eq: 1.00) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (73.6 mg, 258 μηιοΐ, Eq: 1.50) were converted to tert-butyl (2S,3S)-l-((2S,3S)-5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-2,8-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin- 3-ylamino)-3-hydroxy-l-oxobutan-2-ylcarbamate (3.5 mg, 3 %).
Step 3: In a similar manner to that described for Example 29 Step 2 except the product was not triturated, tert-butyl (2S,3S)-l-((2S,3S)-5-((6-bromo-2-methoxynaphthalen-l- yl)methyl)-2,8-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)-3-hydroxy- l-oxobutan-2-ylcarbamate (3.5 mg, 5.33 μηιοΐ) was converted to the title compound (3.1 mg,
86 %). MS m/z MH+558.1
Example 42
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-7-(trifluoromethyl)- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide trifluoroacetate
Figure imgf000128_0001
Step 1 : In a similar manner to that described for Example 36 Step 1 except 6 equivalents of DIEA were used, the mixture was stirred at 0 °C for 30 min. and the product was used without purification, (S)-3 -amino-8 -trifluormethyl-2 ,3 -dihydrobenzo [b] [ 1 ,4]oxazepin-4(5H)-one trifluoroacetate (0.70 g, 1.97 mmol, Eq: 1.00) and (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (0.40 g, 1.97 mmol, Eq: 1.00) was converted to tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-7-(trifluoiomethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2-yl)carbamate (0.90 g).
Step 2: In a similar manner to that described for Example 36 Step 2 except 1 equivalent of CS2CO3 was used, tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-7-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)propan-2-yl)carbamate (863 mg, 2 mmol) and 6- bromo-l-(chloromethyl)-2-methoxynaphthalene (571 mg, 2.00 mmol) were converted to tert- butyl (S)-l-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-7-(trifluoromethyl)- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (0.51 g, 38 %) as a yellow foam.
Step 3: In a similar manner to that described for Example 29 Step 2, tert-butyl (S)-1-((S)- 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-7-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)-l-oxopropan-2-yl(methyl)carbamate (0.50 g, 735 μηιοΐ) was converted to the title compound (245 mg, 48 %). MS m/z MH+ 582.0
Example 43
(S)-N-[(6S,7S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-6-methyl-8-oxo-2- trifiuoromethyl-6 ,7 ,8 ,9-tetrahydro-5 -oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino- propionamide trifluoroacetate
Figure imgf000129_0001
Step 1 : In a similar manner to that described for Example 36 Step 1 except 4 equivalents of DIEA were used, (2S,3S)-3-a mino-2-methyl-7-(trifluoromethyl)-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate (58 mg, 0.155 mmol) and (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (31.5 mg, 155 μηιοΐ) were converted to a material which was purified by silica gel chromatography to afford methyl-[(S)-l-((6S,7S)-6-methyl-8- oxo-2^rifluoromethyl-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-ylcarbamoyl)-ethyl]- carbamic acid tert-butyl ester (52 mg, 75 %)
Step 2: In a similar manner to that described for Example 36 Step 2 except 2 equivalents of CS2CO3 was used and the mixture was heated at 50 °C for 2 h, methyl-[(S)-l-((6S,7S)-6- methyl-8-oxo-2-trifluoromethyl-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7- ylcarbamoyl)-ethyl]-carbamic acid tert-butyl ester (52 mg, 0.1 17 mmol) and 6-bromo-l- (chloromethyl)-2-methoxynaphthalene (66.7 mg, 0.233 mmol) were converted to tert-butyl (S)- 1 -((2S,3 S)-5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-2-methyl-4-oxo-7-(trifluoromethyl)- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (72 mg, 88%).
Step 3: In a similar manner to that described for Example 29 Step 2, tert-butyl (S)-l- ((2S,3 S)-5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-2-methyl-4-oxo-7-(trifluoromethyl)- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yla mino)-l -oxopropan-2-yl(methyl)carbamate (70 mg, 101 μηιοΐ) was converted to the title compound (55 mg, 77 %). MS m/z MH+596.2
Example 44
(S)-2-Methylamino-N-[(S)-9-(2-methyl-naphthalen-l-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-propionamide
Figure imgf000130_0001
Step 1 : 1 M lithium bis(trimethylsilyl) amide in THF (3.07 mL, 1 eq) was added to a solution of ((S)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl)-carbamic acid-t- butyl ester (855 mg, 3.07 mmol, 1.0 eq) in THF (10 mL) at -78 °C. After 30 min. 1- (chloromethyl)-2-methylnaphthalene (586 mg, 3.07 mmol, 1 eq) and Nal (461 mg, 3.07 mmol, 1 eq) were added and the mixture warmed to RT over 2 h. The solvent was removed and the residue was suspened in EtOAc and washed with H20. The aqueous extracts were extracted with EtOAc and the combined organic layers were dried over Na2S04, filtered and concentrated. The residue was purified by silica chromatography to afford (S)-tert-butyl 5-((2-methylnaphthalen-l- yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (1.01 g, 75 %) as a yellow foam.
Step 2: TFA (7.68 g, 67.3 mmol, Eq: 28.8) was added to a solution of (S)-tert-butyl 5-((2- methylnaphthalen-l-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (1.01 g, 2.34 mmol, Eq: 1.00) and the mixture was stirred 2 h and the solvent removed. The residue was treated with sat. NaHC03 and the aqueous mixture extracted with EtOAc. The combined organic extracts were dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to afford (S)-3-amino-5-((2-methylnaphthalen-l- yl)methyl)-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one (606 mg, 76 %) as a white foam.
Step 3: DIEA (146 mg, 1.13 mmol, Eq: 2.50) was added to a mixture of (S)-3-amino-5- ((2-methylnaphthalen-l-yl)methyl)-2,3-dihydrobenzo[b][l ,4]oxazepin-4(5H)-one (150 mg, 451 μηιοΐ, Eq: 1.00), (S)-2-(methylamino)propanoic acid (46.5 mg, 451 μηιοΐ, Eq: 1.00), HBTU (180 mg, 474 μηιοΐ, Eq: 1.05) and ΗΟΒΤ·Η20 (64.0 mg, 474 μηιοΐ, Eq: 1.05) in DMF. After 2 h at RT the mixture was diluted with EtOAc and washed with H20, 2 % KHS04, 5% NaHC03 and 5% brine. The organic mixture was dried over Na2S04, filtered and concentrated to give a residue which was combined with a second batch of material prepared following the same procedure. This material was purified by silica gel chromatography to give a substance that was tritrurated in Et20/pentane to afford the title compound (51 mg). HRMS: calcd. for C2sH27N303 (MH+) 418.2124, found 418.2125
Example 45
(S)-N-((S)-5-(2-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)propanamide
Figure imgf000131_0001
Step 1 : Cs2C03 (229 mg, 702 μηιοΐ, Eq: 1.50) was added to a solution of tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2- yl)carbamate (170 mg, 468 μηιοΐ, Eq: 1.00) and l-(bromomethyl)-2-chlorobenzene (144 mg, 702 μηιοΐ, Eq: 1.50) in DMF and the mixture stirred at RT overnight. The mixture was poured into H20 and extracted with EtOAc. The combined extracts were dried over Na2S04, filtered and concentrated. The residue was purified by silica chromatography to afford tert-butyl (S)-l-((S)-5- (2-chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2- yl(methyl)carbamate (170 mg, 75 %) as a yellow foam.
Step 2: TFA (794 mg, 6.97 mmol, Eq: 20.00) was added to a solution of tert-butyl (S)-l- ((S)-5 -(2-chlorobenzyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 - oxopropan-2-yl(methyl)carbamate (170 mg, 348 μηιοΐ, Eq: 1.00) in DCM (1.42 mL) at 0 °C. After 30 min. the solvent was removed, the residue slurried in 1/1 mix DCM/5% NaHC03 and the layers separated. The aqueous layer was extracted with DCM, the combined extracts were dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to give a material which was triturated with Et20/pentane to afford the title compound (118 mg, 87%) as a pale yellow foam. 1H NMR (DMSO-d6) δ: 8.21 (d, J = 7.8 Hz, 1H), 7.47 - 7.56 (m, 1H), 7.38 - 7.45 (m, 1H),7.17 - 7.36 (m, 6H), 5.30 (d, J = 16.8 Hz, 1H), 5.00 (d, J = 16.8 Hz, 1H), 4.83 (dt, J =11.1, 8.2 Hz, 1H), 4.33 - 4.50 (m, 2H), 2.93 (q, J = 6.9 Hz, 1H), 2.18 (s, 3H), 2.06 (br. s.,lH), 1.08 (d, J = 6.9 Hz, 3H)
Example 46
(S)-N-((S)-5-(3-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)propanamide
Figure imgf000132_0001
In a similar manner to that described for Example 45 except in Step 1 the mixture was stirred at RT for 2 h, tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2-yl)carbamate (175 mg, 482 μηιοΐ) and 1- (bromomethyl)-3-chlorobenzene (104 mg, 506 μηιοΐ) were converted to the title compound (125 mg) as an off-white foam. HRMS: calcd. for C20H22 3O3CI: (MH+) 388.1421 , found 388.1423
Example 47
(S)-N-((S)-5-(4-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)propanamide
Figure imgf000133_0001
In a similar manner to that described for Example 45 except in Step 2 the material obtained after chromatography was not triturated, tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2-yl)carbamate (173 mg, 476 μηιοΐ) and l-(bromomethyl)-4-chlorobenzene (103 mg, 500 μηιοΐ) were converted to the title compound (113 mg) as an off-white foam. HRMS: calcd. for C20H22 3O3CI: (MH+) 388.1422, found 388.1423
Example 48
(S)-5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid trifiuoro acetate
Figure imgf000133_0002
In a similar manner to that described for Example 45 Step 2, (S)-5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-4- oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid (68 mg, 104 μηιοΐ) was converted to the title compound (51 mg, 73 %) as an off white solid. !H NMR (300 MHz, DMSO- e) δ ppm 13.09 (br. s., 1 H) 9.08 (d, J=7.8 Hz, 1 H) 8.77 (br.s., 2 H) 8.02 - 8.09 (m, 2 H) 7.82 (d, J=9.4 Hz, 1 H) 7.77 (d, J=8.2 Hz, 1 H) 7.52 (ddJ=9.1, 2.1 Hz, 1 H) 7.45 (dd, J=7.8, 1.5 Hz, 1 H) 7.36 (d, J=9.1 Hz, 1 H) 7.25 (t, J=8.0 Hz, 1 H) 5.91 (d, J=14.8 Hz, 1 H) 5.26 (d, J=14.8 Hz, 1 H) 4.69 - 4.86 (m, 1 H) 4.46 (dd,J=9.8, 7.4 Hz, 1 H) 4.20 (dd, J=11.6, 9.8 Hz, 1 H) 3.81 - 3.95 (m, 1 H) 3.80 (s, 3 H) 2.512.53 (m, 3 H) 1.42 (d, J=6.9 Hz, 3 H)
Example 49 (S)-5-((2-Methoxynaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifluoroacetate
Figure imgf000134_0001
Step 1 : A mixture of (S)-methyl 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-3-((S)- 2-(tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (100 mg, 149 μηιοΐ, Eq: 1.00) and 10 % Pd/C (5.22 mg, 4.92 μηιοΐ, Eq: 0.033) in MeOH (5 mL) was hydrogenated at RT overnight. The mixture was filtered through Celite and the filtrate concentrated to afford (S)-methyl 3-((S)-2- (tert-butoxycarbonyl(methyl)amino)propanamido)-5-((2-methoxynaphthalen-l-yl)methyl)-4- oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylate (95 mg, 97 %) as a tan foam.
Step 2: LiOH»H20 (9.1 mg, 217 μηιοΐ, Eq: 1.5) and H20 (1 mL) were added to a solution of (S)-methyl 3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-5-((2- methoxynaphthalen- 1 -yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepine-9-carboxylate (95 mg, 145 μηιοΐ, Eq: 1.00) in MeOH (4 mL). The mixture was heated to 50 °C. After 2 h, LiOH»H20 (18 mg, 429 μηιοΐ, Eq: 2.95) was added and the temperature was increased to 60 °C. After 4 h, the mixture was concentrated to a volume of approximately 1.5 mL. This mixture was acidified to pH 2 with 1 N HC1 and extracted with EtOAc. The combined extracts were washed with brine, dried over Na2S04 filtered and concentrated to give a material that was purified by silica gel chromatography to afford (S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-5-((2-methoxynaphthalen-l-yl)methyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid (31 mg, 37 %) as an off-white foam.
Step 3: TFA (1.22 g, 797 μΐ,, 10.7 mmol, Eq: 200.00) was added to a solution of (S)-3- ((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-5-((2-methoxynaphthalen-l- yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid (31 mg, 53.7 μηιοΐ, Eq: 1.00) in DCM (806 μί) at 0 °C. After 45 min. the mixture was concentrated. The residue was dissolved in a minimum of DCM and Et20 was added which resulted in the formation of a white solid. Pentane was added, the supernatant was decanted and the resulting material was dried in vacuo to afford the title compound (29 mg, 91 %). !H NMR (300 MHz, DMSO-d6) δρρηι 13.06 (br. s., 1 H) 9.09 (d, J=8.8 Hz, 1 H) 8.75 (br. s., 2 H) 8.10 (d, J=8.8 Hz, 1 H) 7.79 (t, J=8.0 Hz, 3 H) 7.40 - 7.47 (m, 2 H) 7.16 - 7.37 (m, 3 H) 5.94 (d, J=14.5 Hz, 1 H) 5.28 (d, J=14.5 Hz, 1 H) 4.75 (br. s., 1 H) 4.45 (t, J=8.6 Hz, 1 H) 4.13 - 4.26 (m, 1 H) 3.82 - 3.90 (m, 1 H) 3.80 (s, 3 H) 2.51 - 2.52 (m, 3 H) 1.42 (d, J=6.9 Hz, 3 H)
Example 50
3-{[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- propionic acid trifluoro acetate
Figure imgf000135_0001
Step 1 : DIEA (177 mg, 242 μΐ, 1.37 mmol, Eq: 5.00) was added to a mixture of (S)-5-((6- bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylic acid (180 mg, 274 μηιοΐ, Eq: 1.00), tert-butyl 3-aminopropanoate hydrochloride (49.8 mg, 274 μηιοΐ, Eq: 1.00), HBTU (104 mg, 274 μηιοΐ, Eq: 1.0) and ΗΟΒΤ·Η20 (37.0 mg, 274 μηιοΐ, Eq: 1.0) in DMF (3.41 mL) at 0 °C and the mixture was warmed to RT. After 45 min. the mixture was diluted with EtOAc, washed with H20, brine, dried over Na2S04, filtered and concentrated. The residue was purified by silica gel chromatography to afford 3-({(S)-9-(6- bromo-2-methoxy-naphthalen-l-ylmethyl)-7-[(S)-2-(tert-butoxycarbonyl-methyl-amino)- propionylamino]-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl}-amino)- propionic acid tert-butyl ester (150 mg, 69 %) as an off-white foam.
Step 2: In a similar manner to that described Example 49 step 3, ({(S)-9-(6-bromo-2- methoxy-naphthalen-l-ylmethyl)-7-[(S)-2-(tert-butoxycarbonyl-methyl-amino)- propionylamino]-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl}-amino)- propionic acid tert-butyl ester (60 mg, 76.6 μηιοΐ) was converted to the title compound (54 mg, 95 %) as an off white solid. 1H NMR (300 MHz, DMSO-d6) δ ppm 12.23 (br. s., 1 H) 9.06 (d, J=6.9 Hz, 1 H) 8.77 (br. s., 2 H) 8.31 (br. s., 1 H) 8.02 - 8.12 (m, 2 H) 7.82 (d, J=9.4 Hz, 1 H) 7.68 (d, J=7.5 Hz, 1 H) 7.52 (d, J=9.4 Hz, 1 H) 7.37 (d, J=9.1 Hz, 1 H) 7.16 - 7.32 (m, 2 H) 5.89 (d, J=14.8 Hz, 1 H) 5.26 (d, J=14.8 Hz, 1 H) 4.77 (br. s., 1 H) 4.37 - 4.50 (m, 1 H) 4.14 - 4.28 (m, 1 H) 3.83 (br. s., 1 H) 3.79 (s, 3 H) 3.23 - 3.36 (m, 2 H) 2.41 (t, J=6.8 Hz, 2 H) 1.44 (d, J=6.6 Hz, 3 H)
Example 51
4-({[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- methyl)-benzoic acid methyl ester
Figure imgf000136_0001
Step 1 : In a similar manner to that described for Example 50 Step 1 except the reaction mixture was stirred 1 h 15 min., (S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-3-((S)-2- (tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid (80 mg, 122 μηιοΐ) and methyl 4- (aminomethyl)benzoate hydrochloride (25 mg, 122 μηιοΐ) were converted to 4-[({(S)-9-(6- bromo-2-methoxy-naphthalen-l-ylmethyl)-7-[(S)-2-(tert-butoxycarbonyl-methyl-amino)- propionylamino]-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl}-amino)- methylj-benzoic acid methyl ester (67 mg, 68 %) as an off white foam.
Step 2: TFA (340 mg, 222 μΐ, 2.99 mmol, Eq: 200.00) was added to a solution of 4- [({(S)-9-(6-bromo-2-methoxy-naphthalen-l-ylmethyl)-7-[(S)-2-(tert-butoxycarbonyl-methyl- amino)-propionylamino]-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl}- amino)-methyl]-benzoic acid methyl ester (12 mg, 14.9 μηιοΐ, Eq: 1.00) in DCM (300 μΐ) at 0 °C. After 1 h the mixture was concentrated and the residue dissolved in DCM. The solution was washed with sat. NaHC03 and the NaHC03 solution back extracted with DCM. The combined organic extracts were dried over Na2S04, filtered and concentrated. The residue was dissolved in a minimum of DCM. Et20 was added followed by pentane which resulted in a precipitate. The supernatant was decanted , the residue was washed with pentane and dried in vacuo to afford the title compound (10 mg, 95 %) as a white solid. !H NMR (DMSO-d6) δ: 8.81 (br. s., 1H), 8.22 (d, J = 8.2 Hz, 1H), 8.03 - 8.12 (m, 2H), 7.87 (d, J = 8.5 Hz, 2H), 7.79 (d, J = 9.1 Hz, 1H), 7.65 (d, J = 7.8 Hz, 1H), 7.53 (dd, J = 9.2, 2.0 Hz, 1H), 7.32 - 7.40 (m, 3H), 7.25 - 7.31 (m, 1H), 7.16 - 7.25 (m, 1H), 5.87 (d, J = 14.8 Hz, 1H), 5.24 (d, J = 14.8 Hz, 1H), 4.66 - 4.82 (m, 1H), 4.13 - 4.52 (m, 4H), 3.78 (s, 3H), 2.94 (d, J = 6.9 Hz, 1H), 2.20 (s, 3H), 1.08 (d, J = 6.9 Hz, 3H)
Example 52
(S)-5-((6-Carboxy-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid trifiuoro acetate
Figure imgf000137_0001
Step 1 : N2 was bubbled through a mixture of (S)-methyl 5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (100 mg, 171 μηιοΐ, Eq: 1.00), Pd(OAc)2 (1.53 mg, 6.83 μηιοΐ, Eq: .04), and 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene (7.91 mg, 13.7 μιηοΐ, Eq: 0.08), TEA (0.7 mL) and MeOH (82.1 mg, 104 μΐ, 2.56 mmol, Eq: 15.00) in a microwave tube for 5 min. CO was then bubbled through the mixture for 5 min. and the mixture was heated at 70 °C overnight. The mixture was diluted with EtOAc, then washed with 0.5 N HCl, H20 and brine. The organic mixture was dried over Na2S04 filtered and concentrated to give a residue that was purified by silica gel chromatography to afford (S)-methyl 3-(tert- butoxycarbonylamino)-5-((2-methoxy-6-(methoxycarbonyl)naphthalen-l-yl)methyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (90 mg, 90 %).
Step 2: In a similar manner to that described Example 49 step 3, (S)-methyl 3-(tert- butoxycarbonylamino)-5-((2-methoxy-6-(methoxycarbonyl)naphthalen-l-yl)methyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (169 mg, 299 μηιοΐ) was converted to (S)-methyl 3-amino-5-((2-methoxy-6-(methoxycarbonyl)naphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate trifluoroacetate (173 mg, 99%) which was used without purification.
Step 3: DIEA (193 mg, 264 μΐ, 1.5 mmol, Eq: 5.00) was added to a mixture of (S)-methyl
3- amino-5-((2-methoxy-6-(methoxycarbonyl)naphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate trifluoroacetate (173 mg, 299 μηιοΐ, Eq: 1.00), (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (60.8 mg, 299 μηιοΐ, Eq: 1.0), HBTU (113 mg, 299 μιηοΐ, Eq: 1.0) and ΗΟΒΤ·Η20 (40.4 mg, 299 μιηοΐ, Eq: 1.0) in , DMF (4 mL) at 0 °C. The mixture was warmed to RT, stirred for 1.5 h and diluted with EtOAc. The resulting mixture was washed with H20 and brine, then dried over Na2S04. The mixture was filtered and concentrated to give a residue that was purified by silica gel chromatography to afford (S)- methyl 3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-5-((2-methoxy-6- (methoxycarbonyl)naphthalen-l-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9- carboxylate (169 mg, 87 %) as a white foam.
Step 4: LiOH»H20 (22.0 mg, 523 μιηοΐ, Eq: 2.00) and H20 (0.5 mL) was added to a solution of (S)-methyl 3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-5-((2- methoxy-6-(methoxycarbonyl)naphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (170 mg, 262 μηιοΐ, Eq: 1.00) in MeOH (5 mL). The mixture was heated to 50 °C. After 3.5 h, LiOH»H20 (44 mg, 1.04 mmol) was added and temperature increased to 60 °C. After 1.5 h, the MeOH was removed under vacuum, the aqueous mixture diluted with water and extracted with Et20. The aqueous mixture was acidified to pH 2.0 with 1 N HCl and extracted with EtOAc. The combined organic extracts were washed brine and concentrated to give a residue that was triturated with Et20 to afford (S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-5-((6-carboxy-2-methoxynaphthalen-l-yl)methyl)-
4- oxo-2,3,4 ,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid (47 mg) as a white solid.
Step 5: In a similar manner to that described for Example 49 step 3, (S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-5-((6-carboxy-2-methoxynaphthalen-l-yl)methyl)- 4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid (47 mg, 75.6 μηιοΐ) was converted to the title compound (48 mg, 99 %) as an off white solid. MS m/z 522.4 (MH+)
Example 53 5-(((S)-9-((2-Hydroxyethyl)(methyl)carbamoyl)-3-((S)-2-(methylamino)propanamido)-4- oxo-3,4-dihydrobenzo|¾][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoic acid trifluoro acetate
Figure imgf000139_0001
Step 1 : A 0.1 M aqueous solution of LiOH»H20 (5.98 niL, 598 μηιοΐ, Eq: 1.00) was added to a solution of (S)-methyl 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-3-(tert- butoxycarbonylamino)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylate (0.35 g, 598 μηιοΐ, Eq: 1.00) in Me OH (20 niL) and the mixture was warmed to 45 - 50 °C. After 7 h, the MeOH was removed in vacuo and the mixture diluted with sat. NaHC03 then extracted with EtOAc. The aqueous mixture was cooled to 0 °C, acidifed to pH 3.0 with 3 N HCl and extracted with EtOAc. The combined organic extracts were washed with brine and concentrated a to give a material that was purified by silica gel chromatography to afford (S)-5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid (310 mg, 90 %) as a white foam.
Step 2: In a similar manner to that described for Example 50 Step 1, (S)-5-((6-bromo-2- methoxynaphthalen-l-yl)methyl)-3-(tert-butoxycarbonylamino)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid (150 mg, 263 μηιοΐ, Eq: 1.00) and 2- (methylamino)ethanol (21.7 mg, 289 μηιοΐ, Eq: 1.1) were converted to (S)-tert-butyl 5-((6- bromo-2-methoxynaphthalen-l-yl)methyl)-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (128 mg) as a white foam.
Step 3: In a similar manner to that described for Example 52 Step 1, (S)-tert -butyl 5-((6- bromo-2-methoxynaphthalen-l-yl)methyl)-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (123 mg, 196 μηιοΐ, Eq: 1.00), Pd(OAc)2 (2.42 mg, 10.8 μηιοΐ, Eq: .055), and 4,5-bis(diphenylphosphino)-9,9-dimethylxanthene (9.06 mg, 15.7 μηιοΐ, Eq: 0.08), TEA (896 μΐ) and MeOH (94.1 mg, 119 μΐ, 2.94 mmol, Eq: 15.00) were reacted to give a material that was purified by silica gel chromatography to afford (S)-methyl 5- ((3-(tert-butoxycarbonylamino)-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate (103 mg, 87%) as an off white foam.
Step 4: In a similar manner to that described for Example 49 step 3, (S)-methyl 5-((3- (tert-butoxycarbonylamino)-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate (103 mg, 170 μηιοΐ) was converted to (S)-methyl 5-((3-amino-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo-3,4- dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate trifluoroacetate (104 mg, 98 %) as an off white solid.
Step 5: In a similar manner to that described for the preparation of (S)-methyl 5-((6- bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylate Step 1, (S)-methyl 5-((3-amino-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo- 3 ,4-dihydrobenzo [b] [ 1 ,4]oxazepin-5 (2H)-yl)methyl)-6-methoxy-2-naphthoate trifluoroacetate (104 mg, 167 μηιοΐ, Eq: 1.00) and (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (34.0 mg, 167 μηιοΐ, Eq: 1.0) were converted to methyl 5-(((S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo- 3,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate (59 mg, 50 %)
Step 6: LiOH»H20 (7.15 mg, 170 μιηοΐ, Eq: 2.00) and H20 (200 μί) were added to a solution of methyl 5-(((S)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-9-((2- hydroxyethyl)(methyl)carbamoyl)-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-6- methoxy-2-naphthoate (59 mg, 85.2 μηιοΐ, Eq: 1.00) in MeOH (2 mL) and the mixture heated to 50 °C. After 4 h an additional portion of LiOH»H20 (2 mg, 48 μηιοΐ, Eq. 0.65) was added. After 1 h the mixture was diluted with sat. NaHC03 and extracted with Et20. The aqueous mixture was acidified to pH 2.0 with 1 N HC1, extracted with EtOAc and the combined organic extracts were washed with brine, dried over Na2S04 and concentrated to afford 5-(((S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo- 3,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2 -naphthoic acid (43 mg, 74 %) which was used without purification.
Step 7: In a similar manner to that described for Example 49 step 3, 5-(((S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-9-((2-hydroxyethyl)(methyl)carbamoyl)-4-oxo- 3,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2 -naphthoic acid (43 mg, 63.4 μηιοΐ) was converted to the title compound (40 mg, 91 %) as a white solid. 1H NMR (MeOH-c ) δ: 8.41 (d, J = 8.5 Hz, 1H), 8.01 - 8.11 (m, 2H), 7.91 - 8.00 (m, 1H), 7.79 - 7.90 (m, 1H), 7.53 (d, J = 7.5 Hz, 2H), 7.30 (d, J = 9.1 Hz, 1H), 7.11 (d, J = 7.2 Hz, 1H), 6.96 (d, J = 7.2 Hz, 1H), 6.02 (d, J = 14.2 Hz, 1H), 5.39 (d, J = 14.8 Hz, 1H), 4.28 (d, J = 11.2 Hz, 2H), 3.95 (s, 5H), 2.95 (s, 2H), 2.64 (s, 3H), 1.61 (d, J = 6.3 Hz, 3H)
Example 54
(S)-5-((4-Bromonaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifluoroacetate
Figure imgf000141_0001
In a similar manner to that described for Example 49 step 3, (S)-5-((4-bromonaphthalen- l-yl)methyl)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid (25 mg, 39.9 μηιοΐ) was converted to the title compound (21 mg, 82 %). MS m/z 527.4 (MH+)
Example 55
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(2-hydroxyethyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide
Figure imgf000141_0002
Step 1 : In a similar manner to that described for Example 50 Step 1 except the material was not purified, (S)-5-((4-bromonaphthalen-l-yl)methyl)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylic acid (130 mg, 208 μηιοΐ, Eq: 1.00) and 2-(piperazin-l-yl)ethanol (27 mg, 208 μηιοΐ, Eq: 1 were converted to tert-butyl (S)-l-((S)-5-((4-bromonaphthalen-l-yl)methyl)-9-(4-(2- hydroxyethyl)piperazine- 1 -carbonyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo[b] [ 1 ,4]oxazepin-3- ylamino)-l-oxopropan-2-yl(methyl)carbamate (130 mg, 86 %) obtained as a white foam.
Step 2: In a similar manner to that described for Example 51 Step 2, tert-butyl (S)-1-((S)- 5-((4-bromonaphthalen-l-yl)methyl)-9-(4-(2-hydroxyethyl)piperazine-l-carbonyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (130 mg, 176 μηιοΐ) was converted to the title compound (83 mg, 74 %) obtained as a white solid. MS m/z 639 (MH+)
Example 56
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(3-hydroxypropyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide
Figure imgf000142_0001
Step 1 : In a similar manner to that described for Example 50 Step 1 except the material was not purified, (S)-5-((4-bromonaphthalen-l-yl)methyl)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine- 9-carboxylic acid (70 mg, 112 μηιοΐ, Eq: 1.00) and 3-(piperazin-l-yl)propan-l-ol (16.1 mg, 112 μηιοΐ, Eq: 1.00) were converted to tert-butyl (S)-l-((S)-5-((4-bromonaphthalen-l-yl)methyl)-9- (4-(3 -hydroxypropyl)piperazine- 1 -carbonyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 - ylamino)-l-oxopropan-2-yl(methyl)carbamate (79 mg, 94 %) obtained as a white foam. Step 2: In a similar manner to that described for Example 51 step 2, tert-butyl (S)-1-((S)- 5-((4-bromonaphthalen-l-yl)methyl)-9-(4-(3-hydroxypropyl)piperazine-l-carbonyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (79 mg, 105 μηιοΐ) was converted to the title compound (50 mg, 73 %) obtained as a white solid. MS m/z 653 (MH+)
Example 57
(S)-N-((S)-5-((2-Chloro-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide
Figure imgf000143_0001
Step 1 : Diethyl azodicarboxylate solution 40 wt. % in toluene (DEAD 40 % w/w, 360 mg, 377 μΐ, 828 μηιοΐ, Eq: 2) was added to a solution of tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2-yl)carbamate (226 mg, 621 μηιοΐ, Eq: 1.5), 2-(2-chloro-3-(hydroxymethyl)-lH-indol-l-yl)benzonitrile (117 mg, 414 μηιοΐ, Eq: 1.00) and Ph3P (217 mg, 828 μηιοΐ, Eq: 2) in THF (5 mL) and the mixture was stirred at RT for 2.5 d. The mixture was diluted with MeOH (10 mL), concentrated and the residue purified by preparative TLC to give tert-butyl (S)-l-((S)-5-((2-chloro-l-(2-cyanophenyl)-lH-indol-3- yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 -oxopropan-2- yl(methyl)carbamate (130 mg, 50 %) as a yellow solid.
Step 2: TFA (5 mL) was added to a solution of tert-butyl (S)-l-((S)-5-((2-chloro-l-(2- cyanophenyl)- 1 H-indol-3 -yl)methyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 - ylamino)- l-oxopropan-2-yl(methyl)carbamate (130 mg, 207 μηιοΐ, Eq: 1.00) in DCM (5 mL). The mixture was stirred at RT for 16 h, then concentrated. Sat. NaHC03 was added to the residue and the mixture was extracted with DCM. The combined organic extracts were concentrated and the residue purified by preparative TLC to give the title compound (50 mg, 43 %) as a white solid. MS m/z 529 (MH+)
Example 58 (S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indol-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide
Figure imgf000144_0001
In a similar manner to that described for Example 57 except in Step 1 the mixture was heated at 60 °C for 2.5 d and in Step 2 the material was purified by silica gel chromatography, tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino) propan-2-yl)carbamate (250 mg, 688 μηιοΐ, Eq: 1.00), 2-(4-(hydroxymethyl)-lH-indol-l- yl)benzonitrile (440 mg, 1.77 mmol, Eq: 2.58) was converted to the title compound (35 mg) as a white solid. MS m/z 494 (MH+)
Example 59
(S)-N-((S)-5-((2-Chloro-l-(phenylsulfonyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide
Figure imgf000144_0002
Step 1 : DEAD 40 % w/w (119 mg, 124 μΐ, 273 μηιοΐ, Eq: 2) was added to a solution of (2-chloro-l-(phenylsulfonyl)-lH-indol-3-yl)methanol (44 mg, 137 μηιοΐ, Eq: 1.00), tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2- yl)carbamate (99.4 mg, 273 μηιοΐ, Eq: 2) and Ph3P (71.7 mg, 273 μηιοΐ, Eq: 2) in THF (10.0 mL). After stirring at RT for 12 h, the mixture was diluted with brine and extracted with EtOAc. The combined extracts were dried over MgSC>4, filtered and the filtrate was concentrated. The residue was purified by preparative TLC to afford tert-butyl (S)-l-((S)-5-((2-chloro-l- (phenylsulfonyl)- 1 H-indol-3 -yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 - ylamino)-l-oxopropan-2-yl(methyl)carbamate (36 mg, 36 %) as a white solid. Step 2: In a similar manner to that described for Example 57 Step 2, tert-butyl (S)-1-((S)- 5-((2-chloro-l-(phenylsulfonyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (42 mg, 63.0 μηιοΐ) was converted to the title compound (32 mg, 89.6 %) as a waxy solid. MS m/z 568 (MH+)
Example 60
(S)-N-[(S)-9-(l-Benzenesulfonyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide hydrochloride
Figure imgf000145_0001
Step 1 : In a similar manner to that described for Example 57 Step 1 except the mixture was stirred for 16 h, tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)propan-2-yl)carbamate (150 mg, 413 μηιοΐ, Eq: 1.00), (2-(methylsulfonyl)isoindolin-4-yl)methanol (250 mg, 1.1 mmol, Eq: 2.66) was converted to t-butyl methyl((S)-l -((S)-5-((2-(methylsulfonyl)isoindolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl)carbamate (170 mg, 72 %).
Step 2: 4 M HC1 in dioxane (8.4 g, 7 mL, 28.0 mmol, Eq: 94.3) and t-butyl methyl((S)-l- ((S)-5-((2-(methylsulfonyl)isoindolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl)carbamate (170 mg, 297 μηιοΐ, Eq: 1.00) were combined and the mixture stirred at RT. After 16 h the mixture was concentrated and the residue tritrurated with Et20 to give the title compound (120 mg, 79 %). MS m/z 473 (MH+)
Example 61
(S)-N-((S)-5-((6-Fluoro-l-methyl-2-oxo-l,2-dihydroquinolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide
Figure imgf000146_0001
Step 1 : In a similar manner to that described for Example 1 Step 1 except the Nal was omitted and the product was purified by preparative TLC, tert-butyl methyl((S)-l-oxo-l-((S)-4- oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)propan-2-yl)carbamate (87.5 mg, 0.241 mmol) and 4-(bromomethyl)-6-fiuoro-l-methylquinolin-2(lH)-one (50 mg, 0.185 mmol) were converted to tert-butyl (S)-l-((S)-5-((6-fiuoro-l-methyl-2-oxo-l ,2-dihydroquinolin-4-yl)methyl)- 4-0X0-2 ,3 ,4,5 -tetrahydrobenzo [b][ 1 ,4]oxazepin-3 -ylamino)- 1 -oxopropan-2-yl(methyl)carbamate (40 mg, 40 %).
Step 2: A mixture of 3 M HC1 in dioxane (36.0 g, 30 mL, 120 mmol, Eq: 1660) and tert- butyl (S)-l-((S)-5-((6-fiuoro-l-methyl-2-oxo-l,2-dihydroquinolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (40 mg, 72.4 μηιοΐ, Eq: 1.00) were stirred at RT overnight. The mixture was diluted with sat. NaHC03 and extracted with DCM The combined extracts were washed with H20 and concentrated. The residue was purified was purified by preparative TLC to give the title compound (26 mg, 95 %) as a white solid. MS m/z 453 (MH+)
Example 62
(S)-N-[(S)-9-(l-Benzyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9-tetrahydro-5-oxa- 9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide
Figure imgf000146_0002
In a similar manner to that described for Example 59 Step 1 except 3 eq. each of Ph3P and DEAD were used, (l-benzyl-2-chloro-lH-indol-3-yl)methanol (310 mg, 1.14 mmol, Eq: 3.03) and tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3- ylamino)propan-2-yl)carbamate (137 mg, 377 μηιοΐ, Eq: 1.00) were converted to tert-butyl (S)- l-((S)-5-((l-benzyl-2-chloro-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (90 mg, 39 %) as a viscous oil.
Step 2: 1 M HC1 in Et20 (24.0 g, 20 mL, 20.0 mmol, Eq: 137) was added to tert-butyl (S)-l-((S)-5-((l-benzyl-2-chloro-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (90 mg, 146 μηιοΐ, Eq: 1.00) and the mixture was stirred overnight at RT. The precipate that formed was filtered, washed with ether and dried under vacuum to afford the title compound (8 mg, 12 %). MS m/z 517 (MH+)
Example 63
(S)-N-((S)-5-((l-Ethyl-2-oxoindolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide
Figure imgf000147_0001
Step 1 : DEAD 40 % w/w (359 mg, 376 μΐ, 826 μηιοΐ, Eq: 3) was added to a mixture of tert-butyl methyl((S)- 1 -oxo- 1 -((S)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 - ylamino)propan-2-yl)carbamate (100 mg, 275 μηιοΐ, Eq: 1.00), (1 -ethyl- lH-indol-4-yl)methanol (48.2 mg, 275 μηιοΐ, Eq: 1.00) and polymer-bound Ph3P (500 mg, 275 μηιοΐ, Eq: 1.00) in THF(10 mL). After 2.5 d., additional portions of (1 -ethyl- lH-indol-4-yl)methanol (48.2 mg, 275 μηιοΐ, Eq: 1.00), polymer-bound Ph3P (1 eq) and DEAD (leq), were added. After 1 d, the mixture was filtered and the filter cake washed with MeOH and THF. The filtrate was concentrated and the residue was purified by preparative TLC to afford tert-butyl (S)-l-((S)-5- ((1 -ethyl- lH-indol-4-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (73 mg, 51 %).
Step 2: A solution of N-chlorosuccinimide (NCS, 17.2 mg, 129 μιηοΐ, Eq: 1.00) in DMF (2mL) was added dropwise to a solution of tert-butyl (S)-l-((S)-5-((l-ethyl-lH-indol-4- yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 -oxopropan-2- yl(methyl)carbamate (67 mg, 129 μιηοΐ, Eq: 1.00) in DMF (12 mL) at 0 °C. After 2 h at 0 °C the mixture was diluted with sat. NaHC03 and extracted with EtOAc. The combined extracts were washed with H20, concentrated and the residue was purified by preparative TLC to give tert- butyl (S)- 1 -((S)-5 -((3 -chloro- 1 -ethyl- 1 H-indol-4-yl)methyl)-4-oxo-2,3 ,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (65 mg, 91 %).
Step 3: Phosphoric acid (13.2 mg, 2 mL, 108 μηιοΐ, Eq: 1.00) was added to tert-butyl (S)- 1 -((S)-5 -((3 -chloro- 1 -ethyl- 1 H-indol-4-yl)methyl)-4-oxo-2 ,3 ,4 ,5 - tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (60 mg, 108 μηιοΐ, Eq: 1.00) and the mixture stirred at RT for 2 h. The mixture was diluted with sat. NaHC03 and extracted with DCM. The combined extracts were concentrated and the residue was purified by preparative TLC to give the title compound (7 mg, 14 %) as a solid. MS m/z 437 (MH+)
Example 64
(S)-2-Amino-N-((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)propan amide
Figure imgf000148_0001
Step 1 : In a similar manner to that described for Example 1 Step 1 except the Nal was omitted and the product was purified by preparative TLC, (S)-tert-butyl 4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (589 mg, 1.8 mmol) and 2-(3-(bromomethyl)- lH-indazol-l-yl)benzonitrile (673 mg, 2.16 mmol) were converted to (S)-tert-butyl 5-((l-(2- cyanophenyl)- 1 H-indazol-3 -yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 - ylcarbamate (915 mg, 100 %)
Step 2: In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1 h and the product was purified by silica gel chromatography, (S)-tert- butyl 5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (915 mg, 1.8 mmol) was converted to (S)-2-(3- ((3-amino-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l- yl)benzonitrile (650 mg, 88 %). Step 3: (Benzotriazol-l-yloxy)tris(dimethylamino)phosphonium hexafluorophosphate (BOP, 486 mg, 1.1 mmol, Eq: 1.5) was added to a mixture of (S)-2-(3-((3-amino-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l-yl)benzonitrile (300 mg, 733 μηιοΐ, Eq: 1.00), (S)-2-(tert-butoxycarbonylamino)propanoic acid (208 mg, 1.1 mmol, Eq: 1.5) and DIEA (284 mg, 383 μΐ, 2.2 mmol, Eq: 3) in THF (10.0 mL) and the mixture was stirred at RT overnight. The mixture was diluted with brine and extracted with EtOAc, then the combined extracts were dried over Na2S04. The mixture was filtered, concentrated and the residue was purified by silica gel chromatographyto give tert-butyl (S)-l-((S)-5-((l-(2-cyanophenyl)-lH- indazol-3-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)-l-oxopropan-2- ylcarbamate (380 mg, 89 %).
Step 4: In a similar manner to that described for Example 57 Step 2, tert-butyl (S)-1-((S)- 5-(( 1 -(2-cyanophenyl)- 1 H-indazol-3 -yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b][ 1 ,4]oxazepin- 3-ylamino)-l-oxopropan-2-ylcarbamate (30 mg, 51.7 μηιοΐ) was converted to the title compound (18 mg, 72.5 %). MS m/z 481 (MH+)
Example 65
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate
Figure imgf000149_0001
Step 1 : In a similar manner to that described for Example 1 Step 1 except the Nal was omitted, the mixture was stirred at RT for 16 h and the product was purified by preparative TLC, tert-butyl methyl((S)- 1 -oxo- 1 -((S)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 - ylamino)propan-2-yl)carbamate (30 mg, 82.6 μηιοΐ, Eq: 1.00) and 3-(bromomethyl)-l-(2- cyanophenyl)-lH-indole-2-carbonitrile (40 mg, 1 19 μηιοΐ, Eq: 1.44) were converted to tert-butyl (S)- 1 -((S)-5 -((2 -cyano- 1 -(2-cyanophenyl)- 1 H-indol-3 -yl)methyl)-4-oxo-2 ,3 ,4 ,5 - tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (45 mg, 88 %).
Step 2: TFA (1.48 g, 1 mL, 13.0 mmol, Eq: 178) was added to a solution of tert-butyl (S)- 1 -((S)-5 -((2 -cyano- 1 -(2-cyanophenyl)- 1 H-indol-3 -yl)methyl)-4-oxo-2 ,3 ,4 ,5 - tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (45 mg, 72.7 μηιοΐ, Eq: 1.00) in DCM (1.7 mL) at 0 °C. After 1 h, the mixture was concentrated and the residue triturated with Et20/Hexanes to give a solid which was lyophilized from MeCN/H20 to give the title compound (43 mg, 93.5 %) as a solid. MS m/z 519 (MH+)
Example 66
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(oxetan-3-ylamino)propan amide
Figure imgf000150_0001
NaBH3CN(10 mg, 159 μηιηιοΐ) and AcOH (1 mL) were added to a mixture of (S)-2- amino-N-((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propanamide (40 mg, 83.2 μηιοΐ) and oxetan-3-one(19 mg, 264 μηιηιοΐ) in MeOH (5 mL). After 16 h the mixture was concentrated, the residue treated with sat. NaHC03 and the resulting mixture extracted with DCM. The combined extracts were washed with H20, concentrated and the residue was purified by preparative TLC to give the title compound (10 mg, 22.4 %). MS m/z 537 (MH+)
Example 67
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxy-2 -methylpropylamino)propan amide
Figure imgf000150_0002
(S)-2-Amino-N-((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propanamide (50 mg, 104 μηιοΐ, Eq: 1.00), L1CIO4 (1 1.1 mg, 4.56 μΐ, 104 μηιοΐ, Eq: 1.00) and 2,2-dimethyloxirane (1 mL) were mixed with EtOH (7 mL) in a microwave reaction vial, the vial was sealed and heated in the microwave at 100 °C. After 2 h, 20 eq of 2,2-dimethyloxirane were added and heating was continued under microwave at 100 °C for 3 h. The mixture was concentrated and the residue was purified by preparative TLC to give the title compound (34 mg, 59.1 %) as a solid. MS m/z 553 (MH+)
Example 68
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxyethylamino)propan amide
Figure imgf000151_0001
Na(OAc)3BH (14.2 mg, 67.0 μηιοΐ, Eq: 1.4) was added to a solution of (S)-2-amino-N- ((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propanamide (23 mg, 47.9 μηιοΐ, Eq: 1.00) and glycolaldehyde dimer (3.16 mg, 26.3 μηιοΐ, Eq: 0.55) in DCM (1.5 mL). After 72 h. at RT, the mixture was diluted with NaHC03 and extracted with DCMThecombined extracts were concentrated. The residue was purified by preparative TLC to give the title compound (16 mg, 95 %) as a solid. MS m/z 525 (MH+)
Example 69
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide
Figure imgf000151_0002
Step 1 : In a similar manner to that described for Example 1 Step 1 except the Nal was omitted and the product was purified by preparative TLC, tert-butyl methyl((S)-l-oxo-l-((S)-4- oxo-2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)propan-2- yl)carbamate (55 mg, 127 μηιοΐ, Eq: 1.00) and 2-(3-(bromomethyl)-lH-indazol-l-yl)benzonitrile (78 mg, 250 μηιοΐ, Eq: 1.97) were converted to (S)-2-amino-N-((S)-5-((l-(2-cyanophenyl)-lH- indazol-3-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)propanamide (60mg, 71.1%).
Step 2: In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1 h, tert-butyl (S)-l-((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)- 4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (60 mg, 90.3 μηιοΐ) was converted to the title compound (48 mg, 94.2 %). MS m/z 565 (MH+)
Example 70
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethyl-d5-amino)propanamide
Figure imgf000152_0001
Step 1 : PyBOP (215 mg, 414 μηιοΐ, Eq: 1.5) was added to a mixture of (S)-2- (benzyloxycarbonyl-ethyl(d5)-amino)-propionic acid (106 mg, 414 μηιοΐ, Eq: 1.5), (S)-2-(3-((3- amino-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l-yl)benzonitrile (113 mg, 276 μmol, Eq: 1.00) and DIEA (71.3 mg, 96.4 μΐ, 552 μηιοΐ, Eq: 2) in THF (2.00 mL). After 2 h, the mixture was diluted with EtOAc, washed with sat. NaHC03 and NH4C1. The organic mixture was concentrated and the residue was purified by preparative TLC to give ((S)- l-{(S)-9-[l-(2-cyano-phenyl)-lH-indazol-3-ylmethyl]-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza- benzocyclohepten-7-ylcarbamoyl} -ethyl)-ethyl-d5-carbamic acid benzyl ester (77 mg, 43.1 %).
Step 2: 5 % Pd/C (35 mg) was added to a solution of ((S)-l-{(S)-9-[l-(2-cyano-phenyl)- lH-indazol-3-ylmethyl]-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7- ylcarbamoyl} -ethyl)-ethyl-d5-carbamic acid benzyl ester (77 mg, 119 μηιοΐ, Eq: 1.00) in MeOH (70 mL) and the mixture was stirred under ¾. After 4 h, the mixture was filtered through Celite and the filter cake washed with MeOH. The filtrate was concentrated and the residue was purified by preparative TLC to give the title compound (40 mg, 65 %). MS m/z 514 (MH+)
Example 71 (S)-N-((S)-5-((l-(2-Cyanophenyl)-6-fluoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide
Figure imgf000153_0001
Step 1 : In a similar manner to that described for Example 1 Step 1 except the Nal was omitted and the product was used without purification, (S)-tert-butyl 4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (0.125 g, 449 μηιοΐ) and 2-(3-(bromomethyl)-6- fluoro-lH-indazol-l-yl)benzonitrile (162 mg, 494 μηιοΐ) were converted to (S)-tert-butyl 5-((l- (2-cyanophenyl)-6-fiuoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (237 mg, 100 %).
Step 2: In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1.5 h and the product was used without purification, (S)-tert-butyl 5-((l- (2-cyanophenyl)-6-fiuoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (150 mg, 284 μηιοΐ) was converted to (S)-2-(3- ((3-amino-4-oxo-3,4-dihydrobenzo|¾][l ,4]oxazepin-5(2H)-yl)methyl)-6-fluoro-lH-indazol-l- yl)benzonitrile (121 mg, 100 %).
Step 3: PyBOP (223 mg, 428 μιηοΐ, Eq: 1.5) was added to a mixture of (S)-2-(3-((3- amino-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-6-fluoro-lH-indazol-l- yl)benzonitrile (122 mg, 285 μmol, Eq: 1.00) and (S)-2- ((benzyloxycarbonyl)(ethyl)amino)propanoic acid (Tetrahedron: Asymmetry 2008, 79,970-975, 108 mg, 428 μιηοΐ, Eq: 1.5) and DIEA (1 11 mg, 150 μΐ, 856 μιηοΐ, Eq: 3) in THF (2 mL). After 3 h the mixture was diluted with NH4C1 and extracted with EtOAc. The combined extracts were washed with sat. NaHC03 and concentrated. The residue was purified by preparative TLC to give (S)-l-((S)-5-((l-(2-cyanophenyl)-6-fluoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(ethyl)carbamate (150 mg, 79.5 %)
Step 4: In a similar manner to that described for Example 70 except the mixture was stirred under H2 for 4 h, (S)-l-((S)-5-((l-(2-cyanophenyl)-6-fluoro-lH-indazol-3-yl)methyl)-4- oxo-2,3 ,4,5-tetrahydrobenzo [b][ 1 ,4]oxazepin-3 -ylamino)- 1 -oxopropan-2-yl(ethyl)carbamate (150 mg, 227 μηιοΐ) was converted to the title compound (30 mg, 23 %). MS m/z 527 (MH+)
Example 72
(S)-N-((S)-5-((6-Bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate
Figure imgf000154_0001
Step 1 : CS2CO3 (163 mg, 494μηιο1) was added to a mixture of (S)-tert-butyl 4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (0.125 g, 449 μηιοΐ) and, 2-(3- (bromomethyl)-6-bromo-lH-indazol-l-yl)benzonitrile (193 mg, 494 μηιοΐ) in DMF (5 mL) and the mixture heated at 70 °C overnight. The mixture was cooled and poured into sat. NH4CI resulting in a precipitate. The solid was filtered, washed with H20, hexane and dried under vacuum to give (S)-tert-butyl 5-((6-bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (237 mg, 100 %) which was used without purification.
Step 2: In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1.5 h and the product was used without purification, (S)-tert-butyl 5-((6- bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (95 mg, 161 μηιοΐ) was converted to (S)-2-(3- ((3-amino-4-oxo-3,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-6-bromo-lH-indazol-l- yl)benzonitrile (79 mg, 100 %).
Step 3: In a similar manner to that described for Example 71 Step 3, (S)-2-(3-((3-amino- 4-0X0-3 ,4-dihydrobenzo[b][l ,4]oxazepin-5(2H)-yl)methyl)-6-bromo- lH-indazol- 1 - yl)benzonitrile (78 mg, 160 μηιοΐ, Eq: 1.00) and (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (65 mg, 320 μηιοΐ, Eq: 2.00) were converted to tert-butyl (S)-l-((S)-5-((6-bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (75 mg, 70 %) as a white solid. Step 4: In a similar manner to that described for Example 65, tert-butyl (S)-l-((S)-5-((6- bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (75 mg, 111 μηιοΐ) was converted to the title compound (65 mg, 85 %) as a white powder. MS m/z 575 (MH+)
Example 73
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide
Figure imgf000155_0001
Step 1 : CS2CO3 (9.58 g, 29.4 mmol, Eq: 1.5) was added to a mixture of 3-(bromomethyl)-
1- (2-cyanophenyl)-lH-indole-2-carbonitrile (9.89 g, 29.4 mmol, Eq: 1.5) and tert-butyl methyl((S)-l-oxo-l-((S)-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'- pyran]-3-ylamino)propan-2-yl)carbamate (8.5 g, 19.6 mmol, Eq: 1.00) in DMF (20 mL) and the mixture heated to 70 °C for 1 h. The mixture was cooled, diluted with sat. NH4CI and extracted with EtOAc. The combined extracts were washed with H20, dried over Na2S04 and concentrated to give a material that was purified by silica gel chromatography to afford tert-butyl (S)-l-((S)-5- ((2-cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (13 g, 96.3 %) as a light yellow solid.
Step 2: TFA (37.0 g, 25 mL, 324 mmol, Eq: 55.9) was added dropwise over 2 h to a solution of tert-butyl (S)-l-((S)-5-((2-cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-
2- yl(methyl)carbamate (4 g, 5.81 mmol) in DCM (50 mL) at 0 °C. After 30 min. the mixture was added to sat. NaHCCVFLO 1 :1, the organic phase was separated, dried over Na2S04, filtered and concentration to give the title compound (3.4 g, 97 %) as a light yellow solid. MS m/z 589 (MH+)
Example 74
(2S)-N-((2S,3S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide trifluoroacetate
Figure imgf000156_0001
Step 1 : In a similar manner to that described for Example 71 Step 3 except 1.3 eq. each of DIEA and PyBOP were used and the sat. NaHC03 wash was omitted, (2S,3S)-3-amino-2- methyl-2,3-dihydrobenzo[b][l ,4]oxazepin-4(5H)-one (113 mg, 588 μηιοΐ, Eq: 1.00) and (S)-2- (tert-butoxycarbonyl(ethyl)amino)propanoic acid (Peptides: Struct. Funct., Proc. Am. Pept. Symp. 1983, 8, 143-6, 166 mg, 764 μηιοΐ, Eq: 1.3) was converted to tert-butyl ethyl((S)-l- ((2S,3S)-2-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)-l-oxopropan-2- yl)carbamate (35 mg, 82 %).
Step 2: In a similar manner to that described for Example 65 except the product was not lyophilized, tert-butyl (2 S)- 1 -((2 S,3 S)-5 -(( 1 -(2-cyanophenyl)- 1 H-indazol-3 -yl)methyl)-2 -methyl- 4-0X0-2 ,3 ,4,5 -tetrahydrobenzo [b][ 1 ,4]oxazepin-3 -ylamino)- 1 -oxopropan-2-yl(ethyl)carbamate (35 mg, 56.2 μηιοΐ) was converted to the title compound (30 mg, 80 %) as an off white solid. MS m/z 523 (MH+)
Example 75
(S)-N-((R)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2,2-dimethyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4 ]thiazepin-3 -yl)-2-(ethylamino)propanamide
Figure imgf000156_0002
Step 1 : In a similar manner to that described for Example 71 Step 3 except the reaction was stirred at RT for 16 h, (R)-3-amino-2,2-dimethyl-2,3-dihydrobenzo[b][l,4]thiazepin-4(5H)- one (343 mg, 1.54 mmol, Eq: 1.00) and (S)-2-(tert-butoxycarbonyl(ethyl)amino)propanoic acid (436 mg, 2.01 mmol, Eq: 1.3) were converted to tert-butyl ethyl((S)-l-((2S,3S)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl)carbamate (500 mg, 77 %). Step 2: In a similar manner to that described for Example 1 Step 1 except the Nal was omitted and the product was purified by preparative TLC, tert-butyl ethyl((S)-l -((2S,3S)-2- methyl-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3-ylamino)- 1 -oxopropan-2-yl)carbamate (27 mg, 69.0 μηιοΐ, Eq: 1.00) and 2-(3-(bromomethyl)-lH-indazol-l-yl)benzonitrile (32.3 mg, 103 μηιοΐ, Eq: 1.5) were converted to tert-butyl (S)-l-((R)-5-((2-cyano-l -(2-cyanophenyl)-lH- indol-3-yl)methyl)-2,2-dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-ylamino)-l - oxopropan-2-yl(ethyl)carbamate (35 mg, 81.5 %).
Step 3 : In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1 h, (S)-l -((R)-5-((2-cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2,2- dimethyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-ylamino)-l-oxopropan-2- yl(ethyl)carbamate (200 mg, 295 μηιοΐ) was converted to the title compound (82 mg yield 45.7 %). MS m/z 577 (MH+)
Example 76
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide
Figure imgf000157_0001
Step 1 : In a similar manner to that described for Example 1 Step 1 except the Nal was omitted, the reaction mixture was heated at 65 °C for 1.5 h and the product was purified by preparative TLC, tert-butyl (2S,3S)-2-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3- ylcarbamate (Bioorg. Med. Chem. Lett. 1994, 4, 1789-94, 400 mg, 1.37 mmol, Eq: 1.00) and 3- (bromomethyl)-l-(2-cyanophenyl)-lH-indole-2-carbonitrile (598 mg, 1.78 mmol, Eq: 1.3) were converted to tert-butyl (2S,3S)-5-((2-cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl- 4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (320 mg, 43 %).
Step 2: In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1 h and the product was not purified, tert-butyl (2S,3S)-5-((2-cyano-l-(2- cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin- 3-ylcarbamate (320 mg, 584 μηιοΐ) was converted to 3-(((2S,3S)-3-amino-2-methyl-4-oxo-3,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 -(2-cyanophenyl)- 1 H-indole-2-carbonitrile (261 mg, 99 %) which was used without purification.
Step 3: In a similar manner to that described for Example 71 Step 3 except the reaction was stirred at RT for 16 h and 1.5 eq. each of DIEA and PyBOP were used, 3-(((2S,3S)-3-amino- 2-methyl-4-oxo-3 ,4 -dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 -(2-cyanophenyl)- 1 H- indole-2-carbonitrile (95 mg, 212 μηιοΐ, Eq: 1.00) and (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (64.7 mg, 318 μηιοΐ, Eq: 1.5) were converted to (S)-l-((2S,3S)-5-((2-cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (102 mg, 76 %).
Step 4: In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1 h, tert-butyl (S)-l-((2S,3S)-5-((2-cyano-l-(2-cyanophenyl)-lH-indol-3- yl)methyl)-2-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2- yl(methyl)carbamate (102 mg, 161 μηιοΐ) was converted to the title compound (78 mg, 95 %). MS m/z 533 (MH+)
Example 77
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide
Figure imgf000158_0001
Step 1 : In a similar manner to that described for Example 71 Step 3 except the reaction was stirred at RT for 16 h and 1.5 eq. each of DIEA and PyBOP were used, 3-(((2S,3S)-3-amino- 2-methyl-4-oxo-3 ,4 -dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 -(2-cyanophenyl)- 1 H- indole-2-carbonitrile (95 mg, 212 μηιοΐ, Eq: 1.00) and (S)-2-(tert- butoxycarbonyl(ethyl)amino)propanoic acid (69.2 mg, 318 μηιοΐ, Eq: 1.5) were converted to tert- butyl (S)- 1 -((2 S,3 S)-5 -((2 -cyano- 1 -(2-cyanophenyl)- 1 H-indol-3 -yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(ethyl)carbamate (120 mg, 87 %). Step 2: In a similar manner to that described for Example 57 Step 2 except the mixture was stirred at 0 °C for 1 h, tert-butyl (S)-l-((2S,3S)-5-((2-cyano-l-(2-cyanophenyl)-lH-indol-3- yl)methyl)-2-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2- yl(ethyl)carbamate (120 mg, 186 μηιοΐ) was converted to the title compound (69 mg, 68 %). MS m/z 547 (MH+)
Example 78
(S)-N-((S)-8-Bromo-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide trifiuoro acetate
Figure imgf000159_0001
Step 1 : CS2CO3 (331 mg, 1.01 mmol, Eq: 2.2) was added was added to a solution of tert- butyl methyl((S)-l-oxo-l-((S)-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine- 2,4'-pyran]-3-ylamino)propan-2-yl)carbamate (200 mg, 461 μηιοΐ, Eq: 1.00) and DMF (10 mL) and the mixture was cooled to 0 °C and a solution of NBS (82.1 mg, 461 μηιοΐ, Eq: 1.00) in 2 mL DMF was added dropwise over 5 min. and the mixture warmed to RT. After 10 h the mixture was diluted with with sat. NH4CI and extracted with EtOAc. The combined extracts were washed with H20, concentrated and the residue was purified by preparative TLC to give tert-butyl (S)-l- ((S)-8-bromo-4-oxo-2',3^4,5,5^6'-hexahydro-3H-spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-3- ylamino)-l-oxopropan-2-yl(methyl)carbamate (300 mg, 98 %).
Step 2: In a similar manner to that described for Example 1 Step 1 except the Nal was omitted and the product was purified by preparative TLC, tert-butyl (S)-l-((S)-8-bromo-4-oxo- 2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan- 2-yl(methyl)carbamate (300 mg, 585 μηιοΐ, Eq: 1.00) and 2-(3-(bromomethyl)-lH-indazol-l- yl)benzonitrile (274 mg, 878 μηιοΐ, Eq: 1.5) were converted to tert-butyl (S)-l-((S)-8-bromo-5- ((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (300 mg, 69 %). Step 3: In a similar manner to that described for Example 65 Step 2, tert-butyl (S)-1-((S)- 8-bromo-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (33.5 mg, 45.0 μηιοΐ) was converted to the title compound (30 mg, 88 %) as an off white solid. MS m/z 644.8(MH+)
Example 79
(S)-N-((S)-8-Cyano-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide 2 ,2 ,2 -tri fiuoroacetate
Figure imgf000160_0001
Step 1 : A solution of tert-butyl (S)-l-((S)-8-bromo-5-((l-(2-cyanophenyl)-lH-indazol-3- yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3- ylamino)-l-oxopropan-2-yl(methyl)carbamate (50 mg, 67.2 μmol, Eq: 1.00) in DMF (1.5 mL) was degassed with argon and Zn(CN)2 (15.8 mg, 134 μηιοΐ, Eq: 2) and Pd(Ph3P)4 (23.3 mg, 20.2 μηιοΐ, Eq: 0.3) were added. The mixture was heated in microwave at 110 °C for 30 min., cooled, diluted with sat. NH4C1 and extracted with EtOAc. The combined extracts were washed with H20, then concentrated and the residue was purified by preparative TLC to give tert-butyl (S)-l- ((S)-8-cyano-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro- 3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (43.5 mg, 94 %)
Step 2: In a similar manner to that described for Example 65 Step 2, tert-butyl (S)-1-((S)- 8-cyano-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (43.5 mg, 63.1 μηιοΐ) was converted to the title compound (40 mg, 86 %). MS m/z 590 (MH+)
Example 80 3-Cyano-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzoic acid trifluoroacetate
Figure imgf000161_0001
Step 1 : In a similar manner to that described for Example 72 Step 1 except the mixture was heated at 70 °C for 1 h, (2S,3S)-2-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3- ylcarbamate (200mg, 0.684mmol) and methyl 4-(3-(bromomethyl)-l H-indazol- l-yl)-3- cyanobenzoate were converted to methyl 4-(3-(((2S,3S)-3-(tert-butoxycarbonylamino)-2-methyl- 4-0X0-3 ,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l-yl)-3-cyanobenzoate (395mg, 97%) obtained as a white solid.
Step 2: In a similar manner to that described for Example 57 Step 2 except the reaction mixture was stirred at 0 °C for 1 h, methyl 4-(3-(((2S,3S)-3-(tert-butoxycarbonylamino)-2- methyl-4-oxo-3,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l-yl)-3- cyanobenzoate (254mg, 437 μηιοΐ) was converted to methyl 4-(3-(((2S,3S)-3-amino-2-methyl-4- oxo-3,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l-yl)-3-cyanobenzoate (210mg, 99 %) obtained as a brown oil.
Step 3: PyBop (295 mg, 567 μηιοΐ, Eq: 1.3) was added to a mixture of methyl 4-(3- (((2S,3S)-3-amino-2-methyl-4-oxo-3,4-dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-lH- indazol-l-yl)-3-cyanobenzoate (210mg, 436 μηιοΐ, Eq: 1.00), (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (115 mg, 567 μηιοΐ, Eq: 1.3) and DIEA (73.3 mg,
99.0 μΐ, 567 μηιοΐ, Eq: 1.3) in THF (7 mL). After 16 h, the mixture was diluted with sat. NH4C1 and H20, extracted with EtOAc. The combined extracts were washed with H20, concentrated and the residue purified by preparative TLC to afford 4-(3-(((2S,3S)-3-((S)-2-(tert- butoxycarbonyl(methyl)amino)propanamido)-2-methyl-4-oxo-3,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)-3-cyanobenzoate (230mg,
79.1 %).
Step 4: LiOH (1 N, 448 μΐ, 448 μιηοΐ, Eq: 1.3) was added to a solution of 4-(3-(((2S,3S)- 3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-2-methyl-4-oxo-3,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)-3-cyanobenzoate (230 mg, 345 μιηοΐ, Eq: 1.00) in THF (7 mL) at 0 °C and H20 (3 mL) was added. After 7 h the mixture was acidified with citric acid to pH 4 - 5 and was extracted with EtOAc. The combined extracts were washed with H20, dried over Na2S04 and concentrated to give 4-(3-(((2S,3S)-3-((S)-2- (tert-butoxycarbonyl(methyl)amino)propanamido)-2-methyl-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l-yl)-3-cyanobenzoic acid (220 mg, 97.7 %) which was used without purification.
Step 5: In a similar manner to that described for Example 65 Step 2, 4-(3-(((2S,3S)-3- ((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-2-methyl-4-oxo-3 ,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)-3-cyanobenzoic acid (28.5 mg, 43.7 μηιοΐ) was converted to the title compound (26 mg, 85 %). MS m/z 553 (MH+)
Example 81
3-Cyano-N-ethyl-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo- 3 ,4-dihydrobenzo [b] [ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzamide trifluoroacetate
Figure imgf000162_0001
Step 1 : Ethylamine (100 μΐ, 200 μηιοΐ, Eq: 3.11) was added to a mixture of 4-(3- (((2S,3S)-3-((S)-2-(tert-butoxycarbonyl(methyl)amino)propanamido)-2-methyl-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-lH-indazol-l-yl)-3-cyanobenzoic acid (42 mg, 64.3 μιηοΐ, Eq: 1.00), DIEA (37.0 mg, 50 μΐ, 286 μιηοΐ, Eq: 4.45) and PyBOP (43.5 mg, 83.7 μηιοΐ, Eq: 1.3). After 16 h the mixture was diluted with sat. NH4C1 and extracted with EtOAc. The combined extracts were washed with sat. NaHC03, NH4Cl,and H20, then dried over Na2S04 and concentrated to give a residue that was purified by preparative TLC to afford tert-butyl (S)- l-((2S,3S)-5-((l-(2-cyano-4-(ethylcarbamoyl)phenyl)-lH-indazol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (40 mg, 92 %).
Step 2: In a similar manner to that described for Example 65 Step 2, tert-butyl (S)-l- ((2S,3S)-5-((l-(2-cyano-4-(ethylcarbamoyl)phenyl)-lH-indazol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (40 mg, 58.8 μηιοΐ) was converted to the title compound (30 mg, 75 %). MS m/z 580 (MH+) Example 82
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5-tetrahydro benzo [b] [ 1 ,4]oxazepin-3 -yl)-2 -(methylamino)butanamide hydrochloride
Figure imgf000163_0001
Step 1 : A mixture of (S)-tert-butyl 4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3- ylcarbamate (1.412 g, 5.07 mmol), 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (1.59 g, 5.58 mmol), Cs2C03 (1.98 g, 6.09 mmol), and Nal (913 mg, 6.09 mmol) in DMF (16.9 mL) was stirred at RT for 22 h, diluted with H20 and extracted with EtOAc. The combined extracts were washed with brine, dried over Na2S04 and. The filtrate was concentrated to give a residue that was purified by silica gel chromatography to give (S)-tert-butyl 5-((6-bromo-2- methoxynaphthalen- 1 -yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3-ylcarbamate (1.804 g, 67 %) as an off-white solid. MS m/z 549/551 (MNa)+
Step 2: A solution of (5)-/er/-butyl 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4- oxo-2,3,4,5-tetrahydrobenzo[¾][l,4]oxazepin-3-ylcarbamate (1.803 g, 3.42 mmol) in 4 M HC1 in dioxane (17.1 mL) was stirred at RT for 2 h.The mixture was concentrated and the residue triturated with Et20 to provide (5)-3-amino-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-2,3- dihydrobenzo[¾][l,4]oxazepin-4(5H)-one hydrochloride (1.415 g, 89 %) as an off-white solid. MS m z 427/429 MH+
Step 3: A mixture of (5)-3-amino-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-2,3- dihydrobenzo[¾][l,4]oxazepin-4(5H)-one hydrochloride (54 mg, 116 μηιοΐ), (S)-2-(tert- butoxycarbonyl(methyl)amino)butanoic acid (27.8 mg, 128 μηιοΐ), DIEA (80.6 μί, 466 μηιοΐ), and HBTU (48.6 mg, 128 μηιοΐ) in DMF (388 μϋ) was stirred at RT for 30 min. The mixture was diluted with EtOAc, washed with sat. NaHC03, H20 and brine, then dried over Na2S04, and filtered. The filtrate was concentrated to give a residue that was purified by silica gel chromatography to provide tert-butyl (5')-l-((5)-5-((6-bromo-2-methoxynaphthalen-l- yl)methyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 -oxobutan-2 - yl(methyl)carbamate (67.5 mg, 93 %) as a white solid. MS m/z 648/650 (MNa)+
Step 4: 2 M HCl in Et20 (419 μί) was added to a solution of teri-butyl (S)-l-((S)-5-((6- bromo-2-methoxynaphthalen- 1 -yl)methyl)-4-oxo-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3- ylamino)-l -oxobutan-2 -yl(methyl)carbamate (65.7 mg, 105 μηιοΐ) in MeOH (105 uV). After 4 h the mixture was concentrated and the residue was dissolved in MeCN/H20 and the solution lyophilized to provide the title compound (55.9 mg, 95 %) as a white solid. MS m z 526/528 (MH)+
Example 83
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-yl)-2-(2-hydroxyethylamino)butanamide trifiuoroacetate
Figure imgf000164_0001
Step 1 : A mixture of (5)-3-amino-5-((6-bromo-2-methoxynaphthalen-l -yl)methyl)-2,3- dihydrobenzo[¾][l ,4]oxazepin-4(5H)-one hydrochloride (348 mg, 750 μηιοΐ), (S)-2-(tert- butoxycarbonylamino)butanoic acid (168 mg, 825 μηιοΐ), DIEA (519 μΐ,, 3.00 mmol), and HBTU (313 mg, 825 μηιοΐ) in DMF (2.5 mL) was stirred at RT for 30 min. The mixture was diluted with EtOAc, washed with sat. NaHC03, H20, and brine brine, then dried over Na2S04, and filtered. The filtrate was concentrated to give a residue that was purified by silica gel chromatography to provide tert-butyl (5')-l-((5)-5-((6-bromo-2-methoxynaphthalen-l -yl)methyl)- 4-0X0-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 -oxobutan-2 -ylcarbamate (431 mg, 94 %) as a white solid. MS m/z 634/636 (MNa)+
Step 2: A solution of tert-butyl (5')-l-((5)-5-((6-bromo-2-methoxynaphthalen-l- yl)methyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -ylamino)- 1 -oxobutan-2 - ylcarbamate (430 mg, 702 μηιοΐ) in 4 M HCl in dioxane (3.51 mL) was stirred at RT for 1 h, and concentrated, theresidue was triturated with Et20 to provide (S)-2-amino-N-((S)-5-((6-bromo-2- methoxynaphthalen- 1 -yl)methyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxaze in-3 - yl)butanamide hydrochloride (357 mg, 93 %) as a white solid.
Step 3: A solution of (S)-2-amino-N-((S)-5-((6-bromo-2-methoxynaphthalen-l- yl)methyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)butan amide hydrochloride (283 mg) in 25 % MeOH/CH2Cl2 was treated with silica-supported carbonate (SiliCycle, ~3 eq) for 1 h, filtered, and the filtrate concentrated to provide (S)-2-amino-N-((S)-5-((6-bromo-2- methoxynaphthalen- 1 -yl)methyl)-4-oxo-2 ,3 ,4 ,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 - yl)butanamide (264 mg) as a white foam. MS m/z 512/514 (MH)+
Step 4: Na(OAc)3BH (45.1 mg, 213 μηιοΐ) was added to a solution of (5)-2-amino-N- ((5)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-yl)butanamide (77.8 mg, 152 μηιοΐ) and glycolaldehyde dimer (9.57 mg, 79.7 μηιοΐ) in dichloroethane (1.52 mL). After 30 min. the mixture was diluted with sat. NaHC03 and extracted with EtOAc. The combined extracts were washed with brine, dried over Na2S04, filtered, the filtrate was concentrated to give a residue that was purified by preparative reverse phase HPLC to provide, after lyophilization, the title compound (36.9 mg, 36 %) as a white solid. MS m z 556/558 (MH)+
Example 84
(5)-N-((5)-5-(Benzo[ ]isoxazol-3-ylmethyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propanamide hydrochloride
Figure imgf000165_0001
Step 1 : A mixture of tert-butyl methyl((25')-l-oxo-l-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)propan-2-yl)carbamate (156 mg, 360 μηιοΐ), 3-(bromomethyl)benzo[d]isoxazole (83.9 mg, 396 μηιοΐ), Cs2C03 (141 mg, 432 μηιοΐ) and Nal (64.7 mg, 432 μιηοΐ) in DMF (900 μί) was stirred at RT for 18 h, diluted with EtOAc, washed with H20, brine, dried over Na2S04, filtered, and the filtrate concentrated to give a residue that was purified by silica gel chromatography. The resulting material was purified by supercritical fluid chromatography (SFC) to provide tert-butyl (5)-l-((5)-5-(benzo[ ]isoxazol-3-ylmethyl)-4- oxo-2',3^4,5,5^6'-hexahydro-3H-spiro|¾enzo[¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l- oxopropan-2-yl(methyl)carbamate (54.5 mg, 27 %) as a white foam.
Step 2: In a similar manner to that described for Example 82 Step 4, tert-butyl (5)-l-((5)- 5-(benzo[ ]isoxazol-3-ylmethyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (51.6 mg, 91.4 μηιοΐ) was converted to the title compound (42.2 mg, 92 %) as a white solid. MS m/z 465 (MH)+
Example 85
(5)-N-((5)-5-((2-(Difiuoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride
Figure imgf000166_0001
Step 1 : A mixture of tert-butyl methyl((25')-l-oxo-l-(4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)propan-2-yl)carbamate (118 mg, 272 μηιοΐ), (2-(difluoromethoxy)naphthalen-l-yl)methyl methanesulfonate (98.7 mg, 327 μηιοΐ) and CS2CO3 (115 mg, 354 μηιοΐ) in DMF (681 uV) was stirred at RT for 20 h. The mixture wasdiluted with EtOAc, washed with H20 and brine, then dried over Na2S04, and filtered. The filtrate was concentrated to give a residue that was purified by silica gel chromatography. The resulting material was purified by SFC to provide tert-butyl (5,)-l-((5)-5-((2-(difluoromethoxy)naphthalen-
1- yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3- ylamino)-l-oxopropan-2-yl(methyl)carbamate (52.6 mg, 30 %) as a white foam (MS m/z 662 (MNa)+) and tert-butyl (5')-l-((i?)-5-((2-(difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo- 2',3',4,5,5',6'-hexahydro-3H-spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-
2- yl(methyl)carbamate (72.8 mg, 42 %) as a white foam (MS m/z 662 (MNa)+).
Step 2: In a similar manner to that described for Example 82 Step 4, tert-butyl (5)-l-((5)- 5-((2-(difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (52.6 mg, 82.2 μηιοΐ) was converted to the title compound (46.3 mg, 98 %) as a white solid. MS m/z 540 (MH)+
Example 86
(5)-N-((i?)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride
Figure imgf000167_0001
In a similar manner to that described for Example 82 Step 4, (5')-l-((i?)-5-((2- (difiuoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (72.8 mg, 1 14 μηιοΐ) was converted to the title compoud (61.7 mg, 94 %) as a white solid. MS m/z 540 (MH)+
Example 87
(S)-N-((S)-5 -((6-Bromo-2-methoxynaphthalen- 1 -yl)methyl)-9-fiuoro-4-oxo-2 ,3 ,4,5 - tetrahydrobenzo[¾][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride
Figure imgf000167_0002
Step 1 : A solution of BOC-Ser-OH (2.58 g, 12.6 mmol) in DMF (10.00 mL) was added to a suspension ofNaH (60 % in mineral oil, 1.06 g, 26.4 mmol) inDMF (10 mL) at 0 °C over 10 min. After 1 h at 0 °C a solution of l ,2-difiuoro-3-nitrobenzene (2 g, 12.6 mmol) in DMF (10 mL) was added and the mixture stirred at 0 °C for 2 h. The mixture was diluted with H20 and acidified to pH 3 with 1 N HC1, then extracted with EtOAc. The combined extracts were dried over MgS04 and the filtrate was concentrated to give a residue that was purified by silica gel chromatography to afford (S)-2-(tert-butoxycarbonylamino)-3-(2-fiuoro-6- nitrophenoxy)propanoic acid (2.94 g, 68 %) as a yellow foam.
Step 2: A mixture of (S)-2-(tert-butoxycarbonylamino)-3-(2-fiuoro-6- nitrophenoxy)propanoic acid (2.94 g, 8.54 mmol) and 10 % Pd/C (150 mg) in MeOH was stirred under H2 for 4 h. The mixture was filtered through Celite and the cake was washed with MeOH. The filtrate was concentrated to afford (S)-3-(2-amino-6-fiuorophenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (2.6 g, 97 %) which was used without purification.
Step 3 : A solution of (S)-3-(2-amino-6-fiuorophenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (2.6 g, 8.27 mmol) and EDCI (1.97 mg, 10.3 mmol) in DMF (40 mL) was stirred at RT for 6 h. The mixture was diluted with EtOAc and washed with H20. The combined aqueous layers were extracted with EtOAc. The combined organic extracts were dried over MgS04, filtered and the filtrate was concentrated to give a residue that was purified by silica gel chromatography to afford (S)-tert-butyl 9-fluoro-4-oxo-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-ylcarbamate (1.03 g, 42 %) as an orange solid. MS m z 319 (M+Na)+
Step 4: In a similar manner to that described for Example 82 Step 1 , (S)-tert-bxityl 9- fluoro-4-oxo-2,3,4,5-tetrahydrobenzo[¾][l ,4]oxazepin-3-ylcarbamate (0.503 g, 1.7 mmol) and 6- bromo-l-(chloromethyl)-2-methoxynaphthalene (582 mg, 2.04 mmol were converted to (S)-tert- butyl 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-fluoro-4-oxo-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-ylcarbamate (634 mg, 69 %) as an orange solid. MS m/z 567/569 (MNa)+
Step 5 : In a similar manner to that described for Example 82 Step 2, (S)-tert-bxityl 5-((6- bromo-2-methoxynaphthalen- 1 -yl)methyl)-9-fiuoro-4-oxo-2 ,3 ,4,5 - tetrahydrobenzo[¾][l ,4]oxazepin-3-ylcarbamate (634 mg, 1.16 mmol) was converted to (5)-3- amino-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-fiuoro-2,3- dihydrobenzo[¾][l ,4]oxazepin-4(5H)-one hydrochloride (545 mg, 97 %) as a light yellow solid. MS m/z 445/447 (MH)+
Step 6: In a similar manner to that described for Example 82 Step 3, (5)-3-amino-5-((6- bromo-2-methoxynaphthalen-l-yl)methyl)-9-fluoro-2,3-dihydrobenzo[¾][l ,4]oxazepin-4(5H)- one hydrochloride (86.8 mg, 180 μηιοΐ) and Boc-N-methyl-L-alanine (40.3 mg, 198 μηιοΐ) were converted to tert-butyl (5')-l-((5)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-fiuoro-4- oxo-2,3,4,5-tetrahydrobenzo[¾][l,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (103.2 mg, 91 %) obtained as a light yellow solid. MS m/z 652/654 (MNa)+
Step 7: In a similar manner to that described for Example 82 Step 4, tert-butyl (5)-l-((5)- 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-fiuoro-4-oxo-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate was converted to the title compound (85.9 mg, 94 %) obtained as an off-white solid. MS m z 530/532 (MH)+
Example 88
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide hydrochloride
Figure imgf000169_0001
Step 1 : A mixture of (S)-tert-butyl 4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (389 mg, 1.12 mmol), 6-bromo-l- (chloromethyl)-2-methoxynaphthalene (481 mg, 1.68 mmol), Nal (253 mg, 1.68 mmol) and CS2CO3 (549 mg, 1.68 mmol) in DMF (15.6 mL) was stirred at RT for 6 h and diluted with EtOAc. The mixture was washed with brine, dried over Na2SC>4, filtered and the filtrate concentrated to give a residue that was purified by silica gel chromatography to afford (S)-tert- butyl 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (321 mg, 48 %) as a colorless waxy solid. MS m/z 617/619 (MNa)+
Step 2: In a similar manner to that described for Example 82 Step 2, (S)-tert-bxityl 5-((6- bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifiuoromethyl)-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-ylcarbamate (320 mg, 537 μηιοΐ) was converted to (S)-3- amino-5 -((6 -bromo-2 -methoxynaphthalen- 1 -yl)methyl)-9-(trifluoromethyl)-2 ,3 - dihydrobenzo[&][l,4]oxazepin-4(5H)-one hydrochloride (252 mg, 88 %) obtained as a light yellow solid. MS m/z 495/497 (MH)+
Step 3: In a similar manner to that described for Example 82 Step 3, (5)-3-amino-5-((6- bromo-2 -methoxynaphthalen- 1 -yl)methyl)-9-(trifluoromethyl)-2 ,3 - dihydrobenzo[¾][l,4]oxazepin-4(5H)-one hydrochloride (77.9 mg, 146 μηιοΐ) and Boc-N- methyl-L-alanine (32.8 mg, 161 μηιοΐ) were converted to tert-butyl (^-l-^^-S-iie-bromo^- methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifiuoromethyl)-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (78.7 mg, 79 %) obtained as a white solid. MS m z 702/704 (MNa)+
Step 4: In a similar manner to that described for Example 82 Step 4, tert-butyl (5)-l-((5)- 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[¾][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate was converted to the title compound (64.1 mg, 92 %) obtained as a white solid. MS m/z 580/582 (MH)+
Example 89
(S)-2-(Methylamino)-N-((S)-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-9- (trifluoromethyl)-2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)propanamide hydrochloride
Figure imgf000170_0001
Step 1 : In a similar manner to that described for Example 88 Step 1 , (S)-tert-butyl 4-oxo- 9-(trifluoromethyl)-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (200 mg, 578 μηιοΐ) and l-(chloromethyl)-2-methylnaphthalene (165 mg, 866 μηιοΐ) were converted to (S)-tert-butyl 5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (184 mg, 64 %) obtained as a colorless oil. MS m/z 523 (MNa)+ Step 2: TFA (533 μΐ) was added to a solution of (S)-tert-butyl 5-((2-methylnaphthalen-l- yl)methyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate mg, 142 μηιοΐ) in DCM (2 mL) at 0 °C. After 2.5 h the mixture was concentrated and the residue azeotroped with MeCN to afford (S)-3-amino-5-((2-methylnaphthalen-l-yl)methyl)-9- (trifluoromethyl)-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifluoroacetate (73 mg, 100 %) which was used without purification.
Step 3: In a similar manner to that described for Example 82 Step 3, (S)-3-amino-5-((2- methylnaphthalen-l-yl)methyl)-9-(trifluoromethyl)-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)- one trifluoroacetate (73 mg, 142 μηιοΐ) and (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (32 mg, 156 μηιοΐ) were converted to tert-butyl methyl((S)-l-((S)-5-((2-methylnaphthalen- l-yl)methyl)-4-oxo-9-(trifiuoromethyl)-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylamino)-l- oxopropan-2-yl)carbamate (66 mg, 79 %) obtained as a colorless oil. MS m/z 608 (MNa)+
Step 4: 2 M solution of HC1 in Et20 (1.26 mL) was added to a solution of tert-butyl methyl((S)-l-((S)-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl)carbamate (66 mg, 113 μηιοΐ) in MeOH (400 μΐ) After 2.5 h the mixture was concentrated, MeCN was added to the residue and the mixture concentrated. The residue was lyophilized from MeCN/H20 to afford the title compound (48 mg, 82 %) as a white powder. MS m/z 486 (MH)+
Example 90
(S)-N-((S)-5-(Benzo[d]isoxazol-3-ylmethyl)-4-oxo-9-(trifiuoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride
Figure imgf000171_0001
Step 1 : In a similar manner to that described for Example 88 Step 1 , (S)-tert-butyl 4-oxo- 9-(trifluoromethyl)-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (200 mg, 578 μηιοΐ) and 3-(bromomethyl)benzo[d]isoxazole (184 mg, 866 μηιοΐ) was converted to (S)-tert-butyl 5- (benzo[d]isoxazol-3-ylmethyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (168 mg, 61 %) obtained as a white foam. MS m/z 500 (MNa)+
Step 2: In a similar manner to that described for Example 89 Step 2, (S)-tert-butyl 5- (benzo[d]isoxazol-3-ylmethyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (73 mg, 153 μηιοΐ) was converted to (S)-3- amino-5-(benzo[d]isoxazol-3-ylmethyl)-9-(trifluoromethyl)-2,3-dihydrobenzo[b][l ,4]oxazepin- 4(5H)-one trifluoroacetate (75 mg, 100 %) which was used without purification.
Step 3: In a similar manner to that described for Example 89 Step 3, (S)-3-amino-5- (benzo[d]isoxazol-3-ylmethyl)-9-(trifluoromethyl)-2,3-dihydrobenzo|¾][l ,4]oxazepin-4(5H)-one trifluoroacetate (75 mg, 153 μηιοΐ) and (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (34 mg, 168 μηιοΐ) was converted to tert-butyl (S)-l-((S)-5-(benzo[d]isoxazol-3-ylmethyl)-4- oxo-9-(trifiuoromethyl)-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2- yl(methyl)carbamate (76 mg, 89 %) obtained as a colorless oil. MS m/z 585 (MNa)+
Step 4: In a similar manner to that described for Example 89 Step 4, tert-butyl (S)-1-((S)- 5-(benzo[d]isoxazol-3-ylmethyl)-4-oxo-9-(trifiuoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (76 mg, 135 μηιοΐ) was converted to the title compound (55 mg, 82 %) obtained as a white powder. MS m/z 463 (MH)+
Example 91
(S)-N-((S)-9-Bromo-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride
Figure imgf000172_0001
Step 1 : In a similar manner to that described for Example 87 Step 1, BOC-Ser-OH (1.87 mmol) and 3-bromo-2-fluoronitrobenzene (2 g, 9.09 mmol) were converted to (S)-3-(2- bromo-6-nitrophenoxy)-2-(tert-butoxycarbonylamino)propanoic acid (2.45 g, 67 %) obtained as a yellow gum.
Step 2: A mixture of (S)-3-(2-bromo-6-nitrophenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (2.1 g, 5.18 mmol), zinc dust (3.39 g, 51.8 mmol) and NH4C1 (2.77g, 51.8 mmol) in MeOH/THF 1 :1 (40 mL) was stirred at RT until TLC indicated the reaction was complete. The mixture was then filtered and the filtrate concentrated. The residue was mixed with H20/EtOAc (50 mL/50 mL) and extracted with EtOAc. The combined organic extracts were dried over MgSC>4, filtered and the filtrate concentrated to afford (S)-3-(2-amino-6- bromophenoxy)-2-(tert-butoxycarbonylamino)propanoic acid (1.88 g, 97 %) as an off-white foam which was used without purification.
Step 3: In a similar manner to that described for Example 87 Step 3 except the reaction mixture was stirred overnight, (S)-3-(2-amino-6-bromophenoxy)-2-(tert- butoxycarbonylamino)propanoic acid (1.88 g, 5.02mmol) and EDCI (1.19 g, 6.22 mmol) was converted to (S)-tert-butyl 9-bromo-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3- ylcarbamate (452 mg, 25 %) obtained as a brown oil.
Step 4: In a similar manner to that described for Example 88 Step 1, (S)-tert-butyl 9- bromo-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (200 mg, 560 μηιοΐ) and l-(chloromethyl)-2-methylnaphthalene (160 mg, 840 μηιοΐ) were converted to (S)-tert-butyl 9- bromo-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3- ylcarbamate (95 mg, 33 %) obtained as an orange foam. MS m/z 533/535 (MNa)+
Step 5: In a similar manner to that described for Example 89 Step 2 except the reaction was stirred 45 min., (S)-tert-butyl 9-bromo-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (40 mg, 78.2 μηιοΐ) in DCM (2 mL) was cooled to 0 °C and treated with TFA (300 μΐ). After 45 min, the mixture was concentrated to dryness and the residue azeotroped with MeCN to afford (S)-3-amino-9-bromo-5-((2-methylnaphthalen- l-yl)methyl)-2,3-dihydrobenzo[b][l ,4]oxazepin-4(5H)-one trifluoroacetate (41 mg), which was used without purification.
Step 6: In a similar manner to that described for Example 82 Step 3 except 1.5 eq. HBTU and 6.4 eq. DIEA were used and the mixture was stirred for 1 h, (S)-3-amino-9-bromo-5-((2- methylnaphthalen-l-yl)methyl)-2,3-dihydrobenzo[b][l ,4]oxazepin-4(5H)-one trifluoroacetate (41 mg, 76 μηιοΐ) and (S)-2-(tert-butoxycarbonyl(methyl)amino)propanoic acid (22 mg, 107 μηιοΐ) were converted to tert-butyl (S)-l-((S)-9-bromo-5-((2-methylnaphthalen-l-yl)methyl)-4- oxo-2,3 ,4,5-tetrahydrobenzo [b][ 1 ,4]oxazepin-3 -ylamino)- 1 -oxopropan-2-yl(methyl)carbamate (37 mg, 64 %) obtained as a colorless oil. MS m/z 618/620 (MNa)+
Step 7: In a similar manner to that described for Example 89 Step 4, tert-butyl (S)-1-((S)- 9-bromo-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-2,3 ,4,5-tetrahydrobenzo [b][l ,4]oxazepin- 3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (35 mg, 58.7 μηιοΐ) was converted to the title compound (29 mg, 93 %) obtained as a white powder. MS m/z 496/498 (MH)+
Example 92
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride
Figure imgf000174_0001
Step 1 : In a similar manner to that described for Example 87 Step 1, BOC-Ser-OH (1.98 g, 9.67 mmol) and 2-fiuoro-l-methyl-3-nitrobenzene (1.5 g, 9.67 mmol) was converted to (S)-2- (tert-butoxycarbonylamino)-3-(2-methyl-6-nitrophenoxy)propanoic acid (2.93 g, 89 %) obtained as a yellow oil.
Step 2: In a similar manner to that described for Example 87 Step 2, (S)-2-(tert- butoxycarbonylamino)-3-(2-methyl-6-nitrophenoxy)propanoic acid (2.93 g, 8.61 mmol) was converted to (S)-3-(2-amino-6-methylphenoxy)-2-(tert-butoxycarbonylamino)propanoic acid (2.60 g, 97 %) obtained as a brown oil.
Step 3: In a similar manner to that described for Example 87 Step 3, (S)-3-(2-amino-6- methylphenoxy)-2-(tert-butoxycarbonylamino)propanoic acid (2.60 g, 8.38 mmol) was converted to (S)-tert-butyl 9-methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (846 mg, 35 %) obtained as a white solid. MS m/z 315 (MNa)+
Step 4: In a similar manner to that described for Example 88 Step 1, (S)-tert-butyl 9- methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (150 mg, 513 μηιοΐ) and 6-bromo-l-(chloromethyl)-2-methoxynaphthalene (220 mg, 770 μηιοΐ) was converted to (S)-tert- butyl 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylcarbamate (122 mg, 44 %) obtained as a colorless oil. MS m/z 563/565 (MNa)+
Step 5: A solution of (S)-tert-butyl 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9- methyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-ylcarbamate (122 mg, 225 μηιοΐ) in DCM (5 mL) was cooled to 0 °C and treated with TFA (750 μΐ). After 2.5 h, the mixture was concentrated to dryness and the residue azeotroped with MeCN to afford (S)-3-amino-5-((6- bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-2,3-dihydrobenzo[b][l,4]oxazepin-4(5H)- one trifiuoroacetate (125 mg), which was used without purification.
Step 6: In a similar manner to that described for Example 82 Step 3 except the mixture was stirred for 5 h, (S)-3-amino-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-2,3- dihydrobenzo[b][l,4]oxazepin-4(5H)-one trifiuoroacetate (125 mg, 225 μηιοΐ) and (S)-2-(tert- butoxycarbonyl(methyl)amino)propanoic acid (50 mg, 248 μηιοΐ) were converted to tert-butyl (S)-l-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (117 mg, 83 %) obtained as a colorless waxy solid. MS m z 648/650 (MNa)+
Step 7: In a similar manner to that described for Example 89 Step 4, tert-butyl (S)-1-((S)- 5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-ylamino)-l-oxopropan-2-yl(methyl)carbamate (1 14 mg, 182 μηιοΐ) was converted to the title compound (95 mg, 93 %) obtained as a light yellow powder. MS m/z 526/528 (MH)+
Example 93
Biochemical Assays
TR-FRET Assay for BIR2 and BIR3
The ability of a test compound to inhibit the binding of BIR2 and/or BIR3 domains of the XIAP protein to Peptide A (a SMAC-derived peptide described below) evidences that the test compound acts as a SMAC -mimetic resulting in reactivation of a cell's apoptotic pathway.
The peptide AVPIAQKSEK-(s-biotin)-OH 1 :2 TFA ("Peptide A") was identified as a substrate for the TR-FRET assay by screening the 6x Histidine -tagged BIR2 domain and BIR3 domain of XIAP against a set of 29 peptides synthesized based on sequences reported by Sweeny et al. (Biochemistry, 2006, 45, 14740 14748). The peptides were labeled with the fluorescent tags FITC or TAMRA and Kd values were determined by fluorescence polarization assay. The sequence AVPIAQKSEK was identified as optimal for using in an assay. The peptide sequence was derivatized with biotin to provide AVPIAQKSEK-(s-biotin)-OH 1 :2 TFA as the substrate for the TR-FRET assay.
The XIAP protein sequence was obtained from the SWISS-PROT protein sequence database and the BIR2 and BIR3 domains were derived from that. The sequence of the BIR2 domain used for the TR-FRET assay is
MRHHHHHHRDHFALDRPSETHADYLLRTGQWDISDTIYPRNPAMYSEEARLKSFQNW PDYAHLTPRELASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVL GRNLNIRSE.
The sequence of the BIR3 domain used for the TR-FRET assay is MRHHHHHHRSDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNK
EQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLL
EQKGQE YINNIHLTHSLEECLVRTT .
Ten nanomolar of 6x Histidine-tagged BIR2 domain, corresponding to amino acids 124- 240 of XIAP, or BIR3 domain, corresponding to amino acids 241-356 of XIAP, was mixed with 20 nM of the peptide AVPIAQKSEK-(s-biotin)-OH 1 :2 TFA, in the presence of 50 mM Tris-Cl, pH 7.5, 100 mM NaCl, 1 mM dithiothreitol (DTT) and 0.1 mg/niL bovine serum albumin (BSA). Following a 45 min. incubation at 37 °C, Europium-Streptavidin and Allophycocyanin conjugated anti-Histidine antibody were added to a final concentration of 1.5 nM and 15 nM, respectively. Time -resolved fluorescence resonance energy transfer (TR-FRET) signals were measured 1 hour later at room temperature. Test compound potency was assessed at 10 serially diluted concentrations. Percentage of inhibition at each concentration was determined to generate an IC5o value for each test compound.
BIR2 BIR3
Figure imgf000176_0001
Figure imgf000177_0001
22.9
26.23
>54.8
17.7
>54.8a >54.8b 14.19c 37.14d >54.8e >54.8f >54.8g 17.565h >54.8
0.373 >54.8
0.373 >54.8
0.402 >54.8
0.245 >54.8
1.403 >54.8
1.424 >54.8
0.101
a 0.6755 >54.8b 0.198 >54.8c 5.121 >54.8
0.382 43.19
0.189 >54.8
0.055 >54.8
2.168 >54.8
0.316 >54.8
2.290 >54.8
0.080 41.8
7.080 >54.8
0.077 >54.8
0.054 >54.8
0.080 37.65
0.082 27.17
0.057 >54.8
0.092 >54.8
0.845 >54.8
5.608 >54.8
3.105 >54.8
6.031 >54.8
0.089 >54.8
0.164 >54.8
0.134 >54.8 0.410 >54.8
0.059 >54.8
0.090 >54.8
0.649 >54.8
0.957 >54.8
1.601 >54.8
0.015 37.16
1.159 >54.8
0.045 17.19
1.737 53.21
0.686 >54.8
0.167 12.98
1.121 >54.8
0.069 >54.8
0.021 13.63
7.389 >54.8
1.017 >54.8
0.116 >54.8
0.183 >53.1
0.183 >54.8
0.227 >54.8
0.281 >54.8
0.032 2.863
0.146 >54.8
0.249 43.56
0.031 13.81
0.107 >54.8
0.067 13.1
0.151 15.2
0.118 >54.8
0.132 >54.8
0.014 16.53
0.044 >54.8
0.569 >54.8
0.410 36.2
6.406 >54.8
0.042 32.35
0.050 23.44
0.142 35.99
0.490 >54.8
0.124 32.41
0.027 16.81

Claims

Claims
1. A compound of the formula
Figure imgf000180_0001
wherein:
W and X are the same or different and are independently selected from H, Ci_6-alkyl, hydoxy-Ci-6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, C2-6-alkenyl-Ci_6-alkyl, C2-6- alkynyl-Ci-6-alkyl and heterocycle or
X and W together with the nitrogen to which they are bound can form a C2-9- heterocycle, or W together with the nitrogen to which it is bound and Y together with the carbon to which it is bound can form a C3-9-heterocycle;
Y is Ci-6-alkyl, hydoxy-Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, , halo-Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7- cycloalkyl-Ci-6-alkyl, COOH, C(0)NR8 'R9', acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano and SO2R10;
R2 is selected from H, halo, Ci-6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci-6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano and SO2R10;
R3 is selected from H, halo, Ci_6-alkyl, halo-Ci-6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl- Ci-6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano and SO2R10;
R4 is H or Ci_6-alkyl;
R5 and R6 are the same or different and are independently selected from H, Ci-6-alkyl, Ci-6-alkyl-S-Ci-6-alkyl, Ci-6-alkyl-0-Ci-6-alkyl, aryl and C3-7-cycloalkyl, or
R5 and R6 together with the carbon to which they are bound can form a C4_7-carbocycle or heterocycle, which is optionally substituted by Ci_6-alkyl-S02; V is S, O or S02
Z is selected from Ci-6-alkyl, aryl, optionally substituted by C3-7-cycloalkyl, Ci-6-alkyl, Ci-6-alkoxy, halo, halo-Ci-6- alkoxy, C(0)N(Ci_6-alkyl,Ci_6-alkyl), C(0)NHS02-Ci_6-alkyl, C(0)N(Ci_6-alkyl,hydroxy-Ci_6- alkyl), C(0)N(Ci_6-alkyl,COOH-Ci_6-alkyl), phenyl optionally substituted by cyano, COO-Ci_6- alkyl or COOH; aryl-Ci_6-alkyl, heteroaryl optionally substituted by cyano, Ci-6-alkoxy or phenyl optionally substituted by C(0)N(H,Ci_6-alkyl), cyano or COOH, polycyclic aromatics, polycyclic hetero aromatics, optionally substituted by halo, S02-phenyl, Ci-6-alkyl-phenyl or phenyl optionally substituted by cyano; mixed aryl and non-aryl polycycles and mixed aryl and non-aryl polyheterocycles; optionally substituted by S02-Ci_6-alkyl, oxo, halo or Ci-6-alkyl;
R7 is Ci-6-alkyl, aryl, heteroaryl or sulfonyl;
R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, whereby the alkyl portion is optionally substituted by oxo; and heteroaryl-Ci-6- alkyl,
R8 ' is selected from H and Ci_6-alkyl
R9' is selected from HOOC-Ci_6-alkyl, hydroxy-Ci-6-alkyl and aryl-Ci_6-alkyl, wherein the aryl portion is substituted by COOH, or R8 ' and R9' form together with the nitrogen to which they are attached a heterocyclyl, substituted by hydroxy-Ci_6-alkyl; and
RIO is Ci-6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl or a pharmaceutically acceptable salt thereof.
2. The compound of formula I of claim 1 , wherein
W and X are the same or different and are independently selected from H, Ci_6-alkyl, hydoxy-Ci-6-alkyl, and heterocycle or
Y is Ci-6-alkyl or hydoxy-Ci-6-alkyl;
Rl is H, halo, Ci_6-alkyl, halo-Ci_6-alkyl, COOH, C(0)NR8'R9', NR8R9 , N-acyl or N- sulfonyl;
R2 is H, halo, Ci_6-alkyl or cyano;
R3 is H, or halo-Ci-6-alkyl;
R4 is H or Ci_6-alkyl;
R5 and R6 are the same or different and are H, Ci-6-alkyl, Ci-6-alkyl-S-Ci_6-alkyl, Ci_6- alkyl-O-Ci-6-alkyl or C3-7-cycloalkyl, or
R5 and R6 together with the carbon to which they are bound can form a C4_7-carbocycle or heterocycle, which is optionally substituted by Ci_6-alkyl-S02,
V is S or O; S02
Z is selected from Ci-6-alkyl, aryl, optionally substituted by C3-7-cycloalkyl, Ci-6-alkyl, Ci-6-alkoxy, halo, halo-Ci-6- alkoxy, C(0)N(Ci_6-alkyl,Ci_6-alkyl), C(0)NHS02-Ci_6-alkyl, C(0)N(Ci_6-alkyl,hydroxy-Ci_6- alkyl), C(0)N(Ci_6-alkyl,COOH-Ci_6-alkyl), phenyl optionally substituted by cyano, COO-Ci_6- alkyl or COOH; aryl-Ci_6-alkyl, heteroaryl optionally substituted by cyano, Ci_6-alkoxy or phenyl optionally substituted by C(0)N(H,Ci_6-alkyl), cyano or COOH, polycyclic heteroaromatics, optionally substituted by halo, S02-phenyl, Ci-6-alkyl-phenyl or phenyl optionally substituted by cyano; and mixed aryl and non-aryl polyheterocycles; optionally substituted by S02-Ci_6-alkyl, oxo, halo or Ci-6-alkyl; R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, whereby the alkyl portion is optionally substituted by oxo; and heteroaryl-Ci-6- alkyl,
R8' is selected from H and Ci_6-alkyl;
R9' is selected from HOOC-Ci_6-alkyl, hydroxy-Ci-6-alkyl and aryl-Ci-6-alkyl, wherein the aryl portion is substituted by COOH, or R8' and R9' form together with the nitrogen to which they are attached a heterocyclyl, substituted by hydroxy-Ci-6-alkyl; and
RIO is Ci-6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl or a pharmaceutically acceptable salt thereof.
3. The compound of formula I of any one of claims 1-2, wherein W is H.
4. The compound of formula I of any one of claims 1-3, wherein X is Ci-6-alkyl.
5. The compound of formula I of any one of claims 1-4, wherein Y is Ci-6-alkyl.
6. The compound of formula I of any one of claims 1-5, wherein Rl , R2, R3 and R4 are H.
7. The compound of formula I of any one of claims 1-6, wherein R5 and R6 are individually selected from H, Ci-6-alkyl and C4-7-carbocycle.
8. The compound of formula I of any one of claims 1-6, wherein Z is naphthyl, optionally substituted 0-2 substituents selected from halo, Ci_6-alkyl and Ci_6- alkoxy.
9. The compound of formula I of claim 1 , wherein
W and X are the same or different and are independently selected from H, Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, C2-6-alkenyl-Ci_6-alkyl or C2-6-alkynyl-Ci_6-alkyl, or X and W together with the nitrogen to which they are bound can form a C2-9- heterocycle, or W together with the nitrogen to which it is bound and Y together with the carbon to which it is bound can form a C3-9-heterocycle;
Y is Ci-6-alkyl, or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano or SO2R10;
R2 is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10;
R3 is selected from H, halo, Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10;
R4 is H or Ci_6-alkyl;
R5 and R6 are the same or different and are independently selected from H, Ci_6-alkyl, aryl or C3-7-cycloalkyl, or
R5 and R6 together with the carbon to which they are bound can form a C4_7-carbocycle or heterocycle, with the proviso that R5 and R6 are not both hydrogen;
V is S or O;
Z is selected from aryl, heteroaryl polycyclic aromatics, polycyclic heteroaromatics, mixed aryl and non-aryl polycycles or mixed aryl and non-aryl polyheterocycles; R7 is Ci-6-alkyl, aryl, heteroaryl or sulfonyl;
R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl, or heteroaryl-Ci-6-alkyl, RIO is Ci-6-alkyl, aryl, heterocyclyl or aryl-Ci_6-alkyl or a pharmaceutically acceptable salt thereof.
10. The compound of any one of claims 1-2 of the formula
Figure imgf000185_0001
wherein:
X is selected from Ci_6-alkyl, aryl-Ci_6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, C2-6-alkenyl- Ci-6-alkyl or C2-6-alkynyl-Ci_6-alkyl;
Y is selected from Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano or SO2R10;
R2 is selected from H, halo, Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9, N-acyl, N-sulfonyl, cyano or SO2R10;
R3 is selected from H, halo, Ci_6-alkyl, aryl-Ci-6-alkyl, C3-7-cycloalkyl-Ci_6-alkyl, acyl, OR7, SR7, NR8R9 , N-acyl, N-sulfonyl, cyano or SO2R10;
R4 is selected from H or Ci-6-alkyl;
R5 and R6 are the same or different and independently selected from H, Ci-6-alkyl, aryl or C3-7-cycloalkyl-Ci-6-alkyl, or R5 and R6 together with the carbon to which they are bound can form a C3_7-carbocycle or heterocycle with the proviso that R5 and R6 are not both hydrogen;
V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics, polycyclic hetero aromatics, mixed aryl and non-aryl polycycles or mixed aryl and non-aryl polyheterocycles; R7 is selected from Ci_6-alkyl, aryl, heteroaryl or sulfonyl;
R8 and R9 are the same or different and independently selected from H, Ci_6-alkyl, aryl, aryl-Ci-6-alkyl or heteroaryl-Ci-6-alkyl;
RIO is selected from Ci_6-alkyl, aryl, heterocyclyl or aryl-Ci-6-alkyl; or a pharmaceutically acceptable salt thereof.
11. The compound of claim 1 of the formula
Figure imgf000186_0001
wherein:
X is selected from Ci-6-alkyl, aryl-Ci_6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Y is selected from Ci-6-alkyl or C3-7-cycloalkyl-Ci_6-alkyl;
Rl is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2R10; R2 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2R10; R3 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl, cyano or SO2R10; R4 is selected from H or Ci_6-alkyl;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; R7 is selected from Ci-6-alkyl, aryl, heteroaryl or sulfonyl; RIO is selected from Ci_6-alkyl, aryl, heterocyclyl or aryl-Ci-6-alkyl; or a pharmaceutically acceptable salt thereof.
12. The compound of any one of claims 1-11 wherein
X is selected from methyl, ethyl, methyl-d3, ethyl-d5, n-propyl; i-propyl, 2-hydroxyethyl, 3-hydroxypropyl, cyclopropyl, cyclobutyl, cyclopentyl or oxetan-3-yl;
Y is selected from methyl, ethyl, cyclopropyl, methylcycloproplyl, hydroxymethyl, (S)-l- hydroxyethyl or (R)-l -hydro xyethyl;
Rl is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano;
R2 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano;
R3 is selected from H, halo, Ci_6-alkyl, acyl, OR7, N-acyl, N-sulfonyl or cyano;
R4 is selected from H or Ci_6-alkyl;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
Y is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; R7 is selected from Ci_6-alkyl, aryl, heteroaryl or sulfonyl; or a pharmaceutically acceptable salt thereof.
13. The compound of any one of claims 1.12 wherein
X is selected from methyl, ethyl, methyl-d3, ethyl-d5 or 2-hydroxyethyl;
Y is selected from methyl, ethyl, cyclopropyl, hydroxymethyl or (S)-l -hydroxy ethyl; Rl is selected from H, halo, Ci_6-alkyl, acyl, N-acyl or N-sulfonyl, cyano;
R2 is selected from H, halo, Ci_6-alkyl, acyl, N-acyl or N-sulfonyl, cyano; R3 is selected from H, halo, Ci_6-alkyl, acyl, N-acyl, N-sulfonyl or cyano; R4 is selected from H, methyl or ethyl;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; or a pharmaceutically acceptable salt thereof.
14. The compound of any one of claims 1-13 wherein
X is selected from methyl, ethyl, methyl-d3, ethyl-d5 or 2-hydroxyethyl;
V is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R4 is H;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
V is selected from S or O;
Z is selected from aryl, heteroaryl, polycyclic aromatics or polycyclic heteroaromatics; or a pharmaceutically acceptable salt thereof.
15. The compound of any one of claims 1-14 wherein X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H;
R5 and R6 are the same or different and independently selected from H or Ci_6-alkyl but are not both hydrogen, or R5 and R6 together with the carbon to which they are bound can form a C3-6-carbocycle or heterocycle;
V is O;
Z is selected from 2,5-disubstituted phenyl, 2-substituted-naphthalen-l-yl, 2,5- disubstituted-naphthalen-l-yl, 2,6-disubstituted-naphthalen-l-yl, 2,7-disubstituted-naphthalen-l- yl, 5-substituted-naphthalen-l-yl, 1 -substituted- lH-indazol-3-yl, benzo[d]isoxazole-3-yl, 4- quinolinyl, 5-quinolinyl, 3-substituted-quinolin-4-yl, l,2-disubstituted-indol-3-yl, 1,6- disubstituted-lH-indazol-3-yl, 1 -substituted- 1 ,3 -dihydro-indol-2-one-4-yl, 1 ,6-lH-quinolin-2- one-4-yl, 2-substituted-2,3-dihydro-lH-isoindol-4-yl, 2-(4-methyl-indol-l-yl)-benzonitrile or 1- substituted-indol-4-yl; or a pharmaceutically acceptable salt thereof.
16. The compound of any one of claims 1-15 wherein
X is selected from methyl, ethyl, methyl-d3 or ethyl-d5;
Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl;
Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H;
R5 and R6 are methyl or H but are not both hydrogen; V is O;
Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difluoromethoxy-naphthalen- 1 -yl,
Figure imgf000190_0001
or a pharmaceutically acceptable salt thereof.
17. The compound of any one of claims 1-16 wherein X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H;
R5 and R6 together form a ring selected from
Figure imgf000190_0002
V is O; Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difluoromethoxy-naphthalen- 1 -yl,
Figure imgf000191_0001
or a pharmaceutically acceptable salt thereof.
18. The compound of any one of claims 1-17 wherein X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano;
R4 is H;
CH,
* °
R5 is
Figure imgf000191_0002
V is O;
Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difluoromethoxy-naphthalen- 1 -yl,
Figure imgf000192_0001
or a pharmaceutically acceptable salt thereof.
19. The compound of any one of claims 1-18 wherein X is selected from methyl, ethyl, methyl-d3 or ethyl-d5; Y is selected from methyl, ethyl, hydroxymethyl or (S)-l-hydroxyethyl; Rl is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R2 is selected from H, F, CI, Br, carboxyamide, N-acyl, N-sulfonyl or cyano; R3 is selected from H, F, CI, Br or cyano; R4 is H;
R5 is *
ΟΗ3
R6 is * V is O;
Z is selected from 5-bromo-2-methoxynaphthalen-l-yl, 6-bromo-2-(d3-methoxy)- naphthalen-l-yl, 6-bromo-2-methoxy-naphthalen-l-yl, 3-methoxy-quinolin-4-yl, quinolin-4-yl, 2-(2 ,2 ,2-trifluoroethoxy)naphthalen- 1 -yl, 2-difiuoromethoxy-naphthalen- 1 -yl,
Figure imgf000193_0001
or a pharmaceutically acceptable salt thereof.
20. A compound of any one of claims 1-19 selected from the group consisting of
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-4,5-dihydro-3H- spiro[benzo[b][l,4]oxazepine-2,r-cyclohexane]-3-yl)-2-(methylamino)propanamide
hydrochloride;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l ,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-2-naphthoic acid trifluoroacetate;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-2',3',5',6'-tetrahydro-3H- spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-5(4H)-yl)methyl)-N-(methylsulfonyl)-2-naphthamide trifluoroacetate ;
(R)-N- [(S)-5 -(6 -Bromo-2-methoxy-naphthalen- 1 -ylmethyl)-2 ,2-dimethyl-4-oxo-2 ,3 ,4,5 - tetrahydro-benzo[b][l,4]thiazepin-3-yl]-2-methylamino-propionamide hydrochloride
(S)-N-(5-Benzyl-4-oxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2- methylaminopropanamide hydrochloride ;
N-(5-Benzyl-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride ;
N-(5-(4-Phenyl-butyl)-l,l,4-trioxo-2,3,4,5-tetrahydrobenzo[b][l ,4]thiazepin-3-yl)-2-(S)- (methylamino)propanamide hydrochloride;
N-(5-Biphenyl-3-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-3-yl)-2-(S)- methylamino-propionamide hydrochloride ; (2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-8,9-difluoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8,9-difluoro-4-oxo- 2',3',5',6'-tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fluoro-4-oxo-2',3',5', tetrahydro-3H-spiro|¾enzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fluoro-4-oxo-2',3',5',6 tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride and
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3R)-9-fluoro-4-oxo-2',3',5', tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride .
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-9-fluoro-4-oxo-2',3',5',6 tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fluoro-4-oxo-2',3',5',6 tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride ;
(2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-8-fluoro-4-oxo-2',3',5',6 tetrahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)butanamide hydrochloride;
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(2- hydroxyethylamino)prop anamide ;
(2S)-N-(5-((3-Methoxyquinolin-N-oxide-4-yl)methyl)-(3S)-4-oxo-2',3',5',6'-tetrahydro 3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide; (2S)-N-(5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro[¾enzo[¾][l,4]oxazepm
hydrochloride;
(2S)-N-(5-((6-Bromo-2-(methoxy-d3)-naphthalen-l-yl)methyl)-(3S)-4-oxo-2',3',5',6'- tetrahydro-3H-spiro|¾enzo|¾][l,4]oxazepine-2,4'^yran]-3-yl)-2-(methyl-d3-amino)propanamide hydrochloride;
(R)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide ;
(S)-N-((S)-5-((6-bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-aminopropanamide;
(S)-N-{(R)-9-[2-(2-Methoxy-ethoxy)-acetylamino]-5-naphthalen-l-ylmethyl-4-oxo- 2,3,4,5-tetrahydro-benzo[b][l ,4]thiazepin-3-yl} -2-methylamino-propionamide hydrochloride;
1 -Acetyl-piperidine-4-carboxylic acid [(R)-3-((S)-2-methylamino-propionylamino)-5- naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide and
5- Oxo-hexanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride.
3,4,5-Trimethoxy-N-[(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-benzamide hydrochloride ;
6- Oxo-heptanoic acid [(R)-3-((S)-2-methylamino-propionylamino)-5-naphthalen-l- ylmethyl-4-oxo-2,3,4,5-tetrahydro-benzo[b][l,4]thiazepin-9-yl]-amide hydrochloride;
(S)-N-((R)-9-Amino-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5-tetrahydro- benzo[b][l,4]thiazepin-3-yl)-2-methylamino-propionamide hydrochloride;
N-[(R)-3-((S)-2-Methylamino-propionylamino)-5-naphthalen-l-ylmethyl-4-oxo-2,3,4,5- tetrahydro-benzo[b][l,4]thiazepin-9-yl]-benzamide hydrochloride ;
(S)-N- [(S)-9-(6-Bromo-2-methoxy-naphthalen- 1 -ylmethyl)-8-oxo-6 ,7 ,8 ,9-tetrahydro-5 - oxa-9-aza-benzocyclohepten-7-yl] -2-methylamino-propionamide trifluoroacetate ; (S)-N- [(S)-9-(6-Cyclopropyl-2-methoxy-naphthalen- 1 -ylmethyl)-8-oxo-6 ,7 ,8 ,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methyla mino-propionamide trifluoroacetate;
Methyl 6-methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-2-naphthoate trifluoroacetate;
6-Methoxy-5-(((S)-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4-dihydrobenzo[b] [l,4]oxazepin-5(2H)-yl)methyl)-2-naphthoic acid trifluoroacetate ;
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid (2-hydroxy-ethyl)-methyl- amide;
4-({6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5- oxa-9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carbonyl}-amino)-butyric acid trifluoroacetate ;
6-Methoxy-7-[(S)-7-((S)-2-methylamino-propionylamino)-8-oxo-7,8-dihydro-6H-5-oxa- 9-aza-benzocyclohepten-9-ylmethyl]-naphthalene-2-carboxylic acid dimethylamide trifluoroacetate and
(S)-N-[(S)-9-(7-Bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide trifluoroacetate.
(2S,3R)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8- oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide
trifluoracetate;
(2S,3S)-2-Amino-N-[(S)-9-(7-bromo-3-methoxy-naphthalen-2-ylmethyl)-3-methyl-8- oxo-6,7,8,9-tetrahydro-5-oxa-9-azabenzocyclohepten-7-yl]-3-hydroxy-butyramide
trifluoroacetate ;
(S)-N-((2S,3S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-2,8-dimethyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
Methyl 5-(((2S,3S)-2,8-dimethyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo[b][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoate trifluoroacetate; (2S,3S)-2-Amino-N-[(6S,7S)-9-(6-bromo-2-methoxy-naphthalen-l-ylmethyl)-3,6- dimethyl-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-3-hydroxy-butyramide trifluoro acetate;
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-7-(trifluoromethyl)- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
(S)-N-[(6S,7S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-6-methyl-8-oxo-2- trifluoromethyl-6 ,7 ,8 ,9-tetrahydro-5 -oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino- propionamide trifluoroacetate;
(S)-2-Methylamino-N-[(S)-9-(2-methyl-naphthalen-l-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-propionamide ;
(S)-N-((S)-5-(2-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-N-((S)-5-(3-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-N-((S)-5-(4-Chlorobenzyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2- (methylamino)prop anamide ;
(S)-5-((6-bromo-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid trifluoroacetate and
3- {[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- propionic acid trifluoroacetate.
4- ({[(S)-9-(6-Bromo-2-methoxy-naphthalen-l-ylmethyl)-7-((S)-2-methylamino- propionylamino)-8-oxo-6,7,8,9-tetrahydro-5-oxa-9-aza-benzocycloheptene-4-carbonyl]-amino}- methyl)-benzoic acid methyl ester;
(S)-5-((6-Carboxy-2-methoxynaphthalen- 1 -yl)methyl)-3-((S)-2- (methylamino)propanamido)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepine-9-carboxylic acid trifluoroacetate ; 5-(((S)-9-((2-Hydroxyethyl)(methyl)carbamoyl)-3-((S)-2-(methylamino)propanamido)-4- oxo-3,4-dihydrobenzo|¾][l,4]oxazepin-5(2H)-yl)methyl)-6-methoxy-2-naphthoic acid trifluoro acetate;
S)-5-((4-Bromonaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifluoroacetate;
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(2-hydroxyethyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((4-Bromonaphthalen-l-yl)methyl)-9-(4-(3-hydroxypropyl)piperazine-l- carbonyl)-4-oxo-2,3,4,5-tetrahydrobenzo[b][l,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((2-Chloro-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indol-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-((S)-5-((2-Chloro-l-(phenylsulfonyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-[(S)-9-(l-Benzenesulfonyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9- tetrahydro-5-oxa-9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide hydrochloride;
(S)-N-((S)-5-((6-Fluoro-l-methyl-2-oxo-l,2-dihydroquinolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide;
(S)-N-[(S)-9-(l-Benzyl-2-chloro-lH-indol-3-ylmethyl)-8-oxo-6,7,8,9-tetrahydro-5-oxa- 9-aza-benzocyclohepten-7-yl]-2-methylamino-propionamide and
(S)-N-((S)-5-((l-Ethyl-2-oxoindolin-4-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide .
(S)-2-Amino-N-((S)-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propan amide;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate ; (S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(oxetan-3-ylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxy-2 -methylpropylamino)propan amide ;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(2-hydroxyethylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethyl-d5-amino)propanamide;
(S)-N-((S)-5-((l-(2-Cyanophenyl)-6-fluoro-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide;
S)-N-((S)-5-((6-Bromo-l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide trifluoroacetate;
(S)-N-((S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide;
(2S)-N-((2S,3S)-5-((l-(2-Cyanophenyl)-lH-indazol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide trifluoroacetate;
(S)-N-((R)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2,2-dimethyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]thiazepin-3 -yl)-2-(ethylamino)propanamide and
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide .
(S)-N-((2S,3S)-5-((2-Cyano-l-(2-cyanophenyl)-lH-indol-3-yl)methyl)-2-methyl-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(ethylamino)propanamide ;
(S)-N-((S)-8-Bromo-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[b][l,4]oxazepine-2,4'-pyran]-3-yl)-2- (methylamino)propanamide trifluoroacetate ; (S)-N-((S)-8-Cyano-5-((l-(2-cyanophenyl)-lH-indazol-3-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo|¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propanam^ 2 ,2 ,2 -tri fluoroacetate ;
3-Cyano-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo-3,4- dihydrobenzo [b][ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzoic acid trifluoroacetate;
3-Cyano-N-ethyl-4-(3-(((2S,3S)-2-methyl-3-((S)-2-(methylamino)propanamido)-4-oxo- 3 ,4-dihydrobenzo [b] [ 1 ,4]oxazepin-5 (2H)-yl)methyl)- 1 H-indazol- 1 -yl)benzamide trifluoroacetate;
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)butanamide hydrochloride ;
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(2 -hydroxyethylamino)butanamide trifluoroacetate ;
(5)-N-((5)-5-(Benzo[ ]isoxazol-3-ylmethyl)-4-oxo-2',3',4,5,5',6'-hexahydro-3H- spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propanamide hydrochloride;
(5)-N-((5)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(5)-N-((i?)-5-((2-(Difluoromethoxy)naphthalen-l-yl)methyl)-4-oxo-2',3',4,5,5',6'- hexahydro-3H-spiro[benzo[¾][l ,4]oxazepine-2,4'-pyran]-3-yl)-2-(methylamino)propan amide hydrochloride;
(S)-N-((S)-5 -((6-Bromo-2-methoxynaphthalen- 1 -yl)methyl)-9-fluoro-4-oxo-2 ,3 ,4,5 - tetrahydrobenzo [b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride and
(5)-N-((5)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-4-oxo-9-(trifluoromethyl)- 2 ,3 ,4,5 -tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide hydrochloride .
(S)-2-(Methylamino)-N-((S)-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-9- (trifluoromethyl)-2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepin-3-yl)propanamide hydrochloride;
(S)-N-((S)-5-(Benzo[d]isoxazol-3-ylmethyl)-4-oxo-9-(trifluoromethyl)-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride; (S)-N-((S)-9-Bromo-5-((2-methylnaphthalen-l-yl)methyl)-4-oxo-2,3,4,5- tetrahydrobenzo[b][l ,4]oxazepin-3-yl)-2-(methylamino)propanamide hydrochloride;
(S)-5-((2-Methoxynaphthalen-l-yl)methyl)-3-((S)-2-(methylamino)propanamido)-4-oxo- 2,3,4,5-tetrahydrobenzo[b][l ,4]oxazepine-9-carboxylic acid trifiuoroacetate and
(S)-N-((S)-5-((6-Bromo-2-methoxynaphthalen-l-yl)methyl)-9-methyl-4-oxo-2,3,4,5- tetrahydrobenzo [b] [ 1 ,4]oxazepin-3 -yl)-2-(methylamino)propanamide hydrochloride .
21. A compound according to any one of claims 1 to 20 for use as therapeutically active substance.
22. A compound according to any one of claims 1 to 20 for use in the treatment or prophylaxis of cancer.
23. A pharmaceutical composition comprising a compound in accordance with any one of claims 1 to 20 and a therapeutically inert carrier.
24. The use of a compound according to any one of claims 1 to 20 for the treatment or prophylaxis of cancer.
25. The use of a compound according to any one of claims 1 to 20 for the preparation of a medicament for the treatment or prophylaxis of cancer.
26. A method for the treatment or prophylaxis of cancer, which method comprises administering an effective amount of a compound as defined in any one of claims 1 to 20.
27. The invention as hereinbefore described.
PCT/EP2013/066431 2012-08-09 2013-08-06 Substituted hetero-azepinones WO2014023708A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
KR20157005929A KR20150041647A (en) 2012-08-09 2013-08-06 Substituted hetero-azepinones
BR112015001830A BR112015001830A2 (en) 2012-08-09 2013-08-06 compound, use of a compound, method for cancer treatment or prophylaxis and invention
JP2015525858A JP6266617B2 (en) 2012-08-09 2013-08-06 Substituted heteroazepinone
US14/418,383 US9394263B2 (en) 2012-08-09 2013-08-06 Substituted hetero-azepinones
CA2877048A CA2877048A1 (en) 2012-08-09 2013-08-06 Substituted hetero-azepinones
EP13747659.4A EP2882725A1 (en) 2012-08-09 2013-08-06 Substituted hetero-azepinones
RU2015105561A RU2015105561A (en) 2012-08-09 2013-08-06 SUBSTITUTED HETEROAZEPINONES
CN201380035993.XA CN104470905B (en) 2012-08-09 2013-08-06 The miscellaneous azepine * assimilation compounds of substitution
MX2015001720A MX2015001720A (en) 2012-08-09 2013-08-06 Substituted hetero-azepinones.
HK15107346.9A HK1206740A1 (en) 2012-08-09 2015-07-31 Substituted hetero azepinones

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261681337P 2012-08-09 2012-08-09
US61/681,337 2012-08-09

Publications (1)

Publication Number Publication Date
WO2014023708A1 true WO2014023708A1 (en) 2014-02-13

Family

ID=48951449

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2013/066431 WO2014023708A1 (en) 2012-08-09 2013-08-06 Substituted hetero-azepinones

Country Status (11)

Country Link
US (1) US9394263B2 (en)
EP (1) EP2882725A1 (en)
JP (1) JP6266617B2 (en)
KR (1) KR20150041647A (en)
CN (1) CN104470905B (en)
BR (1) BR112015001830A2 (en)
CA (1) CA2877048A1 (en)
HK (1) HK1206740A1 (en)
MX (1) MX2015001720A (en)
RU (1) RU2015105561A (en)
WO (1) WO2014023708A1 (en)

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016079527A1 (en) 2014-11-19 2016-05-26 Tetralogic Birinapant Uk Ltd Combination therapy
WO2016097773A1 (en) 2014-12-19 2016-06-23 Children's Cancer Institute Therapeutic iap antagonists for treating proliferative disorders
US9815850B2 (en) 2016-02-05 2017-11-14 Denali Therapeutics Inc. Compounds, compositions and methods
WO2020027225A1 (en) 2018-07-31 2020-02-06 ファイメクス株式会社 Heterocyclic compound
WO2021020585A1 (en) 2019-07-31 2021-02-04 ファイメクス株式会社 Heterocyclic compound
US10947226B2 (en) 2016-10-17 2021-03-16 Genentech, Inc. Bicyclic pyridone lactams and methods of use thereof
US10988459B2 (en) 2015-07-02 2021-04-27 Genentech, Inc. Bicyclic lactams and methods of use thereof
US11072607B2 (en) 2016-12-16 2021-07-27 Genentech, Inc. Inhibitors of RIP1 kinase and methods of use thereof
US11072618B2 (en) 2016-12-09 2021-07-27 Denali Therapeutics Inc. Compounds, compositions and methods
WO2022171745A1 (en) * 2021-02-12 2022-08-18 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives for the treatment of cancer
WO2023030295A1 (en) * 2021-09-01 2023-03-09 先声再明医药有限公司 Ubiquitin specific protease 1 (usp1) inhibitor
US11634436B2 (en) 2018-04-20 2023-04-25 Genentech, Inc. Pyridine lactam compounds and methods of use thereof
WO2024033389A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033458A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives
WO2024033388A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033457A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR112015004547A8 (en) * 2012-09-19 2018-01-23 Hoffmann La Roche compounds, pharmaceutical composition, use of a compound and method for treating or ameliorating cancer
CN106467521A (en) * 2015-08-14 2017-03-01 陈志龙 Two kinds of preparation methoies of one class bisbenzimidazole indole derivativeses
CN106467515B (en) * 2015-08-18 2019-09-24 宁波洞密生物科技有限公司 Application of a kind of 6- pyridine benzimidazole indole derivatives and preparation method thereof with field of medicaments
WO2023150790A2 (en) * 2022-02-07 2023-08-10 The Wistar Institute Of Anatomy And Biology Novel and highly selective sars-cov-2 mpro inhibitors

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996011940A1 (en) 1994-10-14 1996-04-25 Glaxo Wellcome Inc. Acyl amino acetamide derivatives with agonist activity for cck-a receptors
WO2006133147A2 (en) * 2005-06-08 2006-12-14 Novartis Ag Organic compounds
WO2007101347A1 (en) * 2006-03-07 2007-09-13 Aegera Therapeutics Inc. Bir domain binding compounds

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
TW200502221A (en) * 2002-10-03 2005-01-16 Astrazeneca Ab Novel lactams and uses thereof
CN101115730A (en) * 2004-12-14 2008-01-30 阿斯利康(瑞典)有限公司 Novel molecular probes
JP2009529518A (en) * 2006-03-10 2009-08-20 アストラゼネカ アクチボラグ Compound
EP2131657A1 (en) * 2007-02-28 2009-12-16 Merck & Co., Inc. Substituted benzodiazepinones, benzoxazepinones and benzothiazepinones as sodium channel blockers

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1996011940A1 (en) 1994-10-14 1996-04-25 Glaxo Wellcome Inc. Acyl amino acetamide derivatives with agonist activity for cck-a receptors
WO2006133147A2 (en) * 2005-06-08 2006-12-14 Novartis Ag Organic compounds
WO2007101347A1 (en) * 2006-03-07 2007-09-13 Aegera Therapeutics Inc. Bir domain binding compounds

Non-Patent Citations (10)

* Cited by examiner, † Cited by third party
Title
ANSEL ET AL., PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY SYSTEMS, 1995, pages 456 - 457
ANSEL, HOWARD C. ET AL.: "Ansel's Pharmaceutical Dosage Forms and Drug Delivery Systems", 2004, LIPPINCOTT, WILLIAMS & WILKINS
BIOORG. MED. CHEM. LETT., vol. 4, 1994, pages 1789 - 94
CHEM. REV., vol. 109, no. 6, 2009, pages 2551 - 2651
GENNARO, ALFONSO R. ET AL.: "Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT, WILLIAMS & WILKINS
PEPTIDES: STRUCT. FUNCT., PROC. AM. PEPT. SYMP., vol. 8, 1983, pages 143 - 6
ROWE, RAYMOND C.: "Handbook of Pharmaceutical Excipients", 2005, PHARMACEUTICAL PRESS
SWEENY ET AL., BIOCHEMISTRY, vol. 45, 2006, pages 14740 14748
TETRAHEDRON: ASYMMETRY, vol. 19, 2008, pages 970 - 975
THEODORA W. GREENE, PROTECTIVE GROUPS IN ORGANIC SYNTHESIS

Cited By (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016079527A1 (en) 2014-11-19 2016-05-26 Tetralogic Birinapant Uk Ltd Combination therapy
WO2016097773A1 (en) 2014-12-19 2016-06-23 Children's Cancer Institute Therapeutic iap antagonists for treating proliferative disorders
US10988459B2 (en) 2015-07-02 2021-04-27 Genentech, Inc. Bicyclic lactams and methods of use thereof
US9815850B2 (en) 2016-02-05 2017-11-14 Denali Therapeutics Inc. Compounds, compositions and methods
US9896458B2 (en) 2016-02-05 2018-02-20 Denali Therapeutics Inc. Compounds, compositions and methods
US10131676B2 (en) 2016-02-05 2018-11-20 Denali Therapeutics Inc. Compounds, compositions and methods
US10604535B2 (en) 2016-02-05 2020-03-31 Denali Therapeutics Inc. Compounds, compositions and methods
US10947226B2 (en) 2016-10-17 2021-03-16 Genentech, Inc. Bicyclic pyridone lactams and methods of use thereof
US11072618B2 (en) 2016-12-09 2021-07-27 Denali Therapeutics Inc. Compounds, compositions and methods
US11072607B2 (en) 2016-12-16 2021-07-27 Genentech, Inc. Inhibitors of RIP1 kinase and methods of use thereof
US11634436B2 (en) 2018-04-20 2023-04-25 Genentech, Inc. Pyridine lactam compounds and methods of use thereof
WO2020027225A1 (en) 2018-07-31 2020-02-06 ファイメクス株式会社 Heterocyclic compound
US11639354B2 (en) 2018-07-31 2023-05-02 Fimecs, Inc. Heterocyclic compound
WO2021020585A1 (en) 2019-07-31 2021-02-04 ファイメクス株式会社 Heterocyclic compound
WO2022171745A1 (en) * 2021-02-12 2022-08-18 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives for the treatment of cancer
WO2023030295A1 (en) * 2021-09-01 2023-03-09 先声再明医药有限公司 Ubiquitin specific protease 1 (usp1) inhibitor
WO2024033389A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033458A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives
WO2024033388A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033457A1 (en) * 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives

Also Published As

Publication number Publication date
EP2882725A1 (en) 2015-06-17
BR112015001830A2 (en) 2017-07-04
CN104470905A (en) 2015-03-25
HK1206740A1 (en) 2016-01-15
MX2015001720A (en) 2015-04-14
CA2877048A1 (en) 2014-02-13
RU2015105561A (en) 2016-09-27
US20150361059A1 (en) 2015-12-17
JP6266617B2 (en) 2018-01-24
US9394263B2 (en) 2016-07-19
JP2015528821A (en) 2015-10-01
KR20150041647A (en) 2015-04-16
CN104470905B (en) 2017-09-12

Similar Documents

Publication Publication Date Title
EP2882725A1 (en) Substituted hetero-azepinones
DE602004004663T2 (en) PROCESS FOR PREPARING 2- (CHINOXALIN-5-YLSULFONYLAMINO) -BENZAMIDE COMPOUNDS
JP6141428B2 (en) Antiproliferative benzo [B] azepin-2-one
US20030232832A1 (en) Pyrrolotriazinone compounds and their use to teat diseases
AU2004247559A1 (en) Benzamide derivative or salt thereof
WO1993019063A1 (en) Benzodiazepine derivatives, compositions containing them and their use in therapy
AU2008203305A1 (en) New benzimidazole derivatives
SK286568B6 (en) Inhibitors of farnesyl protein transferase
EP0442878A1 (en) Derivatives of tryptophan as cck antagonists
BRPI0610147A2 (en) method for preparing and synthesizing substituted 3-cyanoquinolines and 4-amino-3-cyanoquinolines
TW200951114A (en) Phenyl or pyridinyl substituted indazoles derivatives
KR101920472B1 (en) Piperidine derivatives as orexin receptor antagonist
WO2008073459A1 (en) Aryl sulfamide derivatives and methods of their use
MX2014012992A (en) Quinazolinedione derivative.
WO2003093245A1 (en) Sulfonylquinoxalone acetamide derivatives and related compounds as bradykinin antagonists
RU2715233C2 (en) Method of producing nitrogen mustard derivatives
KR100347287B1 (en) 1,5-benzodiazepine derivatives useful as antagonists of cholestyokinin or gastrin
WO2011138265A2 (en) Indole and indazole derivatives as orexin receptor antagonists
EP2504316A1 (en) Heterocylic compounds as antagonists of the orexin receptors
CN115677701A (en) Benzo heterocyclic compound and preparation method and application thereof
CN108690052A (en) 5- aryl -1- imino group -1- oxos-[1,2,4]Thiadiazine
CA2648369A1 (en) Polymorphic forms of (2r,z)-2-amino-2-cyclohexyl-n-(5-(1-methyl-1h-pyrazol-4?l)-1-oxo-2,6-dihydro-1h-[1,2]diazepino[4,5,6-cd]indol-8-yl)acetamide
JP2007332061A (en) NEW PYRAZOLO[1,5-a]PYRIMIDINE DERIVATIVE AND USE THEREOF
Viso et al. Synthesis of enantiopure vicinal diaminoesters and ketopiperazines from N-sulfinylimidazolidines
Wang Discovery of Proteolysis Targeting Chimeras for the Son of Sevenless Homolog 1 (SOS1)

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13747659

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2877048

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2013747659

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 14418383

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015525858

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2015/001720

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20157005929

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2015105561

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112015001830

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112015001830

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20150127