WO2014015261A1 - Regenerating functional neurons for treatment of disease and injury in the nervous system - Google Patents

Regenerating functional neurons for treatment of disease and injury in the nervous system Download PDF

Info

Publication number
WO2014015261A1
WO2014015261A1 PCT/US2013/051277 US2013051277W WO2014015261A1 WO 2014015261 A1 WO2014015261 A1 WO 2014015261A1 US 2013051277 W US2013051277 W US 2013051277W WO 2014015261 A1 WO2014015261 A1 WO 2014015261A1
Authority
WO
WIPO (PCT)
Prior art keywords
neurodl
nucleic acid
expression vector
glial cell
subject
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/051277
Other languages
French (fr)
Inventor
Gong Chen
Yu Zhang
Lei Zhang
Zheng Wu
Yuchen Chen
Fang Wang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Penn State Research Foundation
Original Assignee
Penn State Research Foundation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Penn State Research Foundation filed Critical Penn State Research Foundation
Priority to US14/438,765 priority Critical patent/US9717804B2/en
Priority to CN202210111624.5A priority patent/CN114601937A/en
Priority to HK16101711.8A priority patent/HK1213939A1/en
Priority to CN201380048924.2A priority patent/CN104870634A/en
Publication of WO2014015261A1 publication Critical patent/WO2014015261A1/en
Anticipated expiration legal-status Critical
Priority to US15/643,186 priority patent/US10201619B2/en
Priority to US16/230,364 priority patent/US11167044B2/en
Priority to US17/502,944 priority patent/US20220072153A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/035Animal model for multifactorial diseases
    • A01K2267/0356Animal model for processes and diseases of the central nervous system, e.g. stress, learning, schizophrenia, pain, epilepsy
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/13011Gammaretrovirus, e.g. murine leukeamia virus
    • C12N2740/13041Use of virus, viral particle or viral elements as a vector
    • C12N2740/13043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • General aspects of the invention relate to the in situ conversion of glial cells to functional neuronal cells in the central nervous system (CNS), and the methods to transforming glial cells to neuronal cells both in vitro and in vivo.
  • CNS central nervous system
  • the central nervous system in mammals is largely unable to regenerate itself following injury.
  • Neurons are often killed or injured as a result of an injury or neurological condition, such as a disease or other pathology.
  • glial cells become reactive following brain or spinal cord injury, after a stroke or neurodegenerative diseases such as Alzheimer' s disease. These reactive glial cells can proliferate and maintain a high number in the injury site, and eventually form a dense scar tissue called glial scar to prevent the growth of neurons.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell.
  • the glial cell may be human or non-human mammalian, in vitro or in vivo.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering an expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a viral expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
  • the neuronal phenotype produced in a glial cell in which NeuroDl is exogenous ly expression include one or more, or all, of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell and wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell.
  • the glial cell may be human or non-human mammalian, in vitro or in vivo.
  • the neuronal phenotype produced in a glial cell in which NeuroDl is the only exogenously expressed transcription factor include one or more, or all, of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering an expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a viral expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
  • Methods of producing a neuronal phenotype in a glial cell including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
  • compositions including an in vitro glial cell including exogenous NeuroDl are provided according to aspects of the present invention.
  • compositions including an in vitro glial cell comprising an expression vector encoding NeuroDl are provided according to aspects of the present invention.
  • Compositions including an in vitro glial cell including exogenous NeuroDl are provided according to aspects of the present invention which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
  • compositions including an in vitro glial cell comprising an expression vector encoding NeuroDl are provided according to aspects of the present invention which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
  • compositions including an in vitro glial cell including exogenous NeuroDl are provided according to aspects of the present invention, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell and which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
  • compositions including an in vitro glial cell comprising an expression vector encoding NeuroDl are provided according to aspects of the present invention, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell and which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
  • Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
  • Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
  • Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: 1 or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,
  • Method of treating a neurological condition in a subject in need thereof are methods of treating a neurological condition characterized by presence of reactive astrocytes.
  • Method of treating a neurological condition in a subject in need thereof are methods of treating an injury to the central or peripheral nervous system.
  • Method of treating a neurological condition in a subject in need thereof are methods of treating Alzheimer disease, Parkinson disease, amyotrophic lateral sclerosis (ALS), epilepsy and stroke.
  • ALS amyotrophic lateral sclerosis
  • Method of treating a neurological condition in a subject in need thereof include administering a therapeutically effective dose of NeuroDl by local administration, systemic administration or a combination thereof.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a ubiquitous promoter by local administration.
  • Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a ubiquitous promoter by local administration to a site of injury or disease in the nervous system of the subject where additional neurons and/or fewer glial cells or reactive glial cells are desirable.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a cell type-specific promoter selected from the group consisting of: an astrocyte-specific promoter and an NG2 cell-specific promoter, by local administration to a site of injury or disease in the nervous system of the subject where additional neurons and/or fewer glial cells or reactive glial cells are desirable or by systemic administration to the subject.
  • a cell type-specific promoter selected from the group consisting of: an astrocyte-specific promoter and an NG2 cell-specific promoter
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is a viral expression vector.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is a retrovirus.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is an adenovirus.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is an adeno-associated virus.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is a lentivirus.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein administering the therapeutically effective dose of NeuroDl comprises administering NeuroDl protein.
  • Method of treating a neurological condition in a subject in need thereof include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein administering the therapeutically effective dose of NeuroDl comprises administering mRNA encoding NeuroDl protein.
  • Method of treating a neurological condition in a subject in need thereof include providing a viral expression vector comprising a nucleic acid encoding NeuroDl ; and delivering the viral expression vector to the central nervous system or peripheral nervous system of the subject, whereby the viral vector infects dividing cells of the central nervous system or peripheral nervous system, respectively, producing infected cells and whereby exogenous NeuroDl is expressed in the infected cells at a therapeutically effective level, wherein the expression of NeuroDl in the infected cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated.
  • Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein NeuroDl is the only transcription factor encoded by the nucleic acid.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter and wherein the expression vector is a viral vector.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter and wherein the expression vector is a retroviral expression vector.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter and wherein the expression vector is an adenovirus, adeno-associated virus or lenti virus.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the expression vector is a viral vector.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the expression vector is a retroviral expression vector.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the expression vector is an adenovirus, adeno-associated virus or lenti virus.
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to S
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%,
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter, wherein the expression vector is a viral vector and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 8
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter, wherein the expression vector is a retroviral vector and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71 , 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%,
  • Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter, wherein the expression vector is an adenovirus, adeno-associated virus or lentivirus vector and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%,
  • Figure 1A shows representative images illustrating GFP fluorescence in the left panel, GFAP immunofluorescence in the same field, shown in the middle panel, and the overlap of GFP fluorescence and GFAP immunofluorescence in the same field, shown in the right panel;
  • Figure IB shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
  • Figure 1C shows representative images illustrating GFAP promoter-driven NeuroDl- GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of GFAP promoter-driven NeuroDl -GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
  • Figure ID shows representative images at 2DPI illustrating NeuroDl -GFP fluorescence in the left panel, NG2 immunofluorescence in the same field, shown in the middle panel, and DCX immunofluorescence shown in the right panel;
  • Figure IE shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
  • Figure IF shows a representative trace from cortical slice recordings showing Na + and K + currents in NeuroDl -converted neurons at 30 DPI.
  • Figure 1G shows a representative trace from cortical slice recordings showing repetitive action potentials in NeuroDl -converted neurons at 30 DPI;
  • Figure 1H shows representative traces showing spontaneous synaptic events in a
  • Figure II shows an enlarged view of the synaptic events from Figure 1H;
  • Figure 2A shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, immunofluorescence labels axons in the same fields, shown in the corresponding middle panels top and bottom;
  • Figure 2B is a graph showing results of quantitation of axon fibers in the injured region infected with retrovirus construct encoding NeuroDl-GFP showing NeuroDl -induced conversion;
  • Figure 2C shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, CSPG immunofluorescence in the same fields is shown in the corresponding middle panels top and bottom;
  • Figure 2D is a graph showing results of quantitation of CSPG in the injured region infected with retrovirus construct encoding NeuroDl-GFP showing NeuroDl -induced conversion
  • Figure 2E shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, Dextran- Texas Red (Dextran-TR) fluorescence labels blood vessels in the same fields, shown in the corresponding middle panels top and bottom;
  • Figure 2F is a graph showing results of quantitation of area of blood vessels in the injured region infected with retrovirus construct encoding NeuroDl-GFP showing NeuroDl- induced conversion;
  • Figure 2G shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, GFAP immunofluorescence in the same field, shown in the middle left panel, arrow, Cx43 immunofluorescence in the same field shown in the middle right panel, arrowheads, and the overlap of NeuroDl-GFP fluorescence, GFAP immunofluorescence and Cx43 immunofluorescence in the same field, shown in the right panel;
  • Figure 3A shows representative images illustrating GFAP immunofluorescence in wild-type mouse cortex in the left panel, GFAP immunofluorescence in 5xFAD mouse cortex, shown in the middle panel, and the overlap of GFAP immunofluorescence in 5xFAD mouse cortex and thioflavin-S immunofluorescence in the same field, shown in the right panel;
  • Figure 3B shows representative images illustrating NeuroDl-GFP fluorescence in 7- month old 5xFAD mouse cortex in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
  • Figure 3C shows representative images illustrating GFAP promoter-driven NeuroDl- GFP fluorescence in 5xFAD mouse cortex in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of GFAP promoter-driven NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
  • Figure 3D shows representative images illustrating NeuroDl-GFP fluorescence in 5xFAD mouse cortex in the top panel and VGlutl immunofluorescence, arrowhead, in the same field shown in the bottom panel;
  • Figure 3E shows representative images illustrating GAD65 immunofluorescence, arrow, in 5xFAD mouse cortex in the same field as in Figure 3D in the top panel and the overlap of NeuroDl-GFP fluorescence, VGlutl immunofluorescence and GAD65 immunofluorescence in the same field, shown in the bottom panel;
  • Figure 3F shows representative traces of sodium and potassium currents of NeuroDl- converted neurons at 28 DPI with retrovirus construct encoding NeuroDl-GFP in AD cortical slices (5xFAD mouse cortex);
  • Figure 3G shows representative traces of spontaneous synaptic events recorded from NeuroDl -converted neurons at 28 DPI with retrovirus construct encoding NeuroDl-GFP in the AD cortical slices;
  • Figure 3H shows an enlarged view of two synaptic events shown in Figure 3G;
  • Figure 31 shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, at 15-17 DPI;
  • Figure 3J shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, at 15-17 DPI;
  • Figure 3K shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, at 15-17 DPI;
  • Figure 3L is a graph showing results of quantitation of ⁇ in the region of 5xFAD mouse cortex infected with retrovirus construct encoding NeuroDl-GFP at 15-17 DPI;
  • Figure 3M is a graph showing results of quantitation of ApoE in the region of 5xFAD mouse cortex region infected with retrovirus construct encoding NeuroDl-GFP at 15-17 DPI;
  • Figure 3N is a graph showing results of quantitation of Gltl in the region of 5xFAD mouse cortex injured region infected with retrovirus construct encoding NeuroDl-GFP at 15-17 DPI;
  • Figure 4A is a representative immunofluorescence image showing that the majority of cultured human astrocytes were immunolabeled by SIOOP antibodies, scale bar, 50 ⁇ ;
  • Figure 4B is a representative pair of phase contrast images showing NeuroDl - induced morphological change from astrocytes (left) to neurons at 45 DPI with a retrovirus encoding NeuroDl (right);
  • Figure 4C shows representative images illustrating GFP fluorescence in human astrocytes infected with a retrovirus construct encoding NeuroDl-GFP;
  • Figure 4D shows representative images illustrating GFP fluorescence in human astrocytes infected with a retrovirus construct encoding GFAP promoter-driven NeuroDl-GFP;
  • Figure 4E shows representative images illustrating direct conversion of human astrocytes into neurons;
  • Figure 4F shows representative images of immunostained synaptic puncta (SV2, left) on the dendrites (MAP2, middle) of NeuroDl -converted human neurons at 45 DPI, NeuroDl - GFP fluorescence;
  • Figure 4G is a high magnification image showing vesicular glutamate transporter 1 (VGlutl) immunostained puncta co-localized with dendritic spines on NeuroDl -converted neurons;
  • VGlutl vesicular glutamate transporter 1
  • Figure 4H is a representative trace of repetitive action potentials in NeuroDl - converted neurons at 20 DPI;
  • Figure 41 shows a representative trace showing the Na + and K + currents recorded from NeuroDl -converted neurons at 30 DPI;
  • Figure 4J shows a representative trace showing receptor currents induced by bath application of 100 ⁇ glutamate
  • Figure 4K shows a representative trace showing receptor currents induced by bath application of 100 ⁇ GABA
  • Figure 4L shows a representative trace showing receptor currents induced by bath application of 100 ⁇ NMD A
  • Figure 4M shows representative traces of spontaneous synaptic events in NeuroDl- converted neurons at 40 DPI;
  • Figure 5A is a set of low power images showing GFP retrovirus-infected reactive glial cells in the vicinity of injury core shown at 14 DPI;
  • Figure 5B shows NeuroDl -GFP fluorescence along with DCX immunostaining of the same field, middle and overlap of GFP fluorescence and DCX immunostaining of the same field, right;
  • Figure 5C shows low power images of DCX-positive cells infected by NeuroDl-GFP along the injection site at 14 DPI;
  • Figure 5D are high power images showing DCX-positive cells infected by NeuroDl - GFP along the injection site at 14 DPI;
  • Figure 5E shows images illustrating that GFAP::GFP retrovirus-infected astrocytes were DCX-negative;
  • Figure 6A shows representative images illustrating that cultured mouse astrocytes were mostly immunopositive for astrocyte marker GFAP;
  • Figure 6B shows representative images illustrating that NeuroDl-GFP retrovirus infected cells were immunopositive for NeuN;
  • Figure 6B shows NeuroDl-GFP fluorescence at left, NeuN immunostaining of the same field is shown in the middle panel and NeuroDl immunostaining of the same field is shown in the panel at right;
  • Figure 6C shows representative images illustrating that GFAP::NeuroDl retrovirus- infected cells were also positive for NeuN (8 DPI);
  • Figure 6C shows NeuroDl-GFP fluorescence at left, NeuN immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and NeuN immunostaining of the same field is shown in the panel at right;
  • FIG. 6D NeuroDl-GFP fluorescence is shown at left, Tbrl immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and Tbrl immunostaining of the same field is shown in the panel at right;
  • Figure 6E shows representative images illustrating that some NeuroDl -infected cells were also positive for dentate granule cell marker Proxl;
  • Figure 6E shows NeuroDl-GFP fluorescence at left, Proxl immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and Proxl immunostaining of the same field is shown in the panel at right;
  • Figure 7A shows large receptor currents induced by bath application of GAB A (100 ⁇ ) in mouse astrocyte-converted neurons
  • Figure 7D shows spontaneous synaptic currents recorded from NeuroDl -converted neurons
  • Figure 8A shows representative images of cultured mouse NG2 cells showing NG2 immunostaining, left, Ibal immunostaining, middle, and GFAP immunostaining, right;
  • Figure 8B shows GFP fluorescence at left, CNPase immunostaining at middle panel and the overlap of GFP fluorescence and CNPase immunostaining of the same field at right panel;
  • Figure 8D shows representative images illustrating that many NeuroDl -infected NG2 cells became GABAergic neurons
  • Figure 8E shows representative images illustrating that NeuroDl -infected NG2 cells were mostly immunopositive for cortical neuron marker Tbrl;
  • Figure 8F shows representative images illustrating that NeuroDl -infected NG2 cells were either positive (arrow) or negative for Proxl (arrowhead);
  • Figure 8G is a graph showing quantitation of cultured mouse NG2 cells immunopositive for GFAP, Ibal and NG2;
  • Figure 9A shows representative images illustrating that numerous VGluTl puncta were detected on NG2 cells converted to neurons by NeuroDl after infecting mouse NG2 cultures with NeuroDl-GFP retrovirus;
  • Figure 9B is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large sodium and potassium currents
  • Figure 9C is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed repetitive action potentials
  • Figure 9D is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large glutamate-evoked current
  • Figure 9E is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large GABA-evoked current
  • Figure 9F is a representative trace showing that spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed glutamatergic components
  • Figure 9G is a representative trace showing that spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed GABAergic components;
  • Figure 10A is an image of NeuroDl-GFP fluorescence in clear dendritic spines (arrows) observed in 2-month old NeuroDl -converted neurons after viral injection;
  • Figure 10B is a representative trace showing large spontaneous synaptic events recorded from 2-month old NeuroDl -converted neurons in cortical slice recordings;
  • Figure IOC is a representative trace showing an expanded view of the synaptic events shown in Figure 10B;
  • Figure 11A shows representative images of BrdU immunostaining at 4 days post- injury, left panel, along with DCX immunostaining of the same field, middle panel, and the overlap of BrdU immunostaining and DCX immunostaining of the same field, right panel;
  • Figure 11B shows representative images of BrdU immunostaining at 1 month post- injury, left panel, along with NeuN immunostaining of the same field, middle panel, and the overlap of BrdU immunostaining and NeuN immunostaining of the same field, right panel;
  • Figure 12A shows representative images of immunostaining showing changes of GFAP (astrocyte), NG2 (NG2 cell), and Ibal (microglia) signal before (DO) and up to one month after brain stab injury;
  • GFAP astrocyte
  • NG2 NG2 cell
  • Ibal microglia
  • Figure 12B shows representative images of TUNEL staining
  • Figure 12C shows representative images indicating a significant decrease of astrocytic glutamate transporter Gltl and axon fibers
  • Figure 12D shows bar graphs showing the quantified data of the immunostaining signal before and after brain injury
  • Figure 13A includes images of GFP fluorescence, NeuroDl -GFP fluorescence, Cx43 immunostaining, and the overlap of GFP or NeuroDl-GFP and Cx43 immunostaining;
  • Figure 13A further includes a graph showing that astrocytic gap junctions (Cx43) decreased in NeuroDl -infected regions compared to the control GFP retrovirus -infected areas;
  • Figure 13B includes images of GFP fluorescence, NeuroDl-GFP fluorescence,
  • Figure 13B further includes a graph showing that TUNEL staining showed reduced cell death in the regions containing NeuroDl -converted neurons;
  • Figure 13C includes images of GFP fluorescence, NeuroDl-GFP fluorescence, VEGF immunostaining, and the overlap of GFP or NeuroDl-GFP and VEGF immunostaining;
  • Figure 13C further includes a graph showing that angiogenesis marker VEGF was significantly increased in the regions containing NeuroDl -converted neurons;
  • Figure 13D shows representative images illustrating that in regions containing NeuroDl -converted neurons, astrocytes were closely contacting blood vessels;
  • Figure 13E shows representative images illustrating that in regions containing NeuroDl -converted neurons
  • Figure 13E shows SMI312 immunostaining, MBP immunostaining and the overlap of SMI312 immunostaining and MBP immunostaining
  • Figure 14C is a graph showing quantitation of these results.
  • Figure 15 A shows representative images indicating that cells infected with a retrovirus encoding NeuroDl and GFP (14 DPI) were positive for NeuN in 7-month old WT mice;
  • Figure 15A shows NeuroDl -GFP fluorescence, NeuN immunostaining and the overlap of NeuroDl -GFP fluorescence and NeuN immunostaining in the same field;
  • Figure 15B shows representative images indicating that NeuroDl -converted neurons (16 DPI) showed robust dendrites in 14 month old animals;
  • Figure 15C shows NeuroDl-GFP fluorescencel, ⁇ 42 immunostaining and the overlap of NeuroDl -GFP fluorescence and ⁇ 42 immunostaining in the same field;
  • Figures 17A and 17B are representative images showing glutamate immunostaining in mouse cultured neurons
  • Figures 17C and 17D are representative images showing GABA immunostaining in mouse cultured neurons
  • Figure 18A shows representative images indicating that the majority of cells in human astrocyte cultures were immunopositive for astrocyte marker SIOOP;
  • Figure 18B shows representative images indicating that NeuroDl-GFP infected human astrocytes became immunopositive for NeuN;
  • Figure 18C shows representative images indicating that NeuroDl -converted neurons generated by infection of human astrocytes with a retrovirus encoding NeuroDl were positive for Proxl ;
  • Figure 18D shows representative images indicating that the majority of cells in human microglia cultures were positive for Ibal ;
  • Figures 18E and 18F are representative images showing that human microglia could not be converted into neurons by NeuroDl ;
  • Figure 18G is a graph showing quantitation of cultured human astrocytes immunopositive for SIOOP
  • Figure 18H is a graph showing quantitation of cultured human microglia immunopositive for GFAP, Ibal;
  • Figure 19A shows representative images obtained after injecting hNG2 :: NeuroDl - IRES-GFP retrovirus into one month old mouse cortex; and
  • Figure 19B shows representative images obtained after infecting cultured NG2 cells with hNG2::NeuroDl-IRES-GFP retrovirus.
  • NeuroDl converts astrocytes, reactive astrocytes, NG2 cells and reactive NG2 cells into functional neurons, as disclosed herein.
  • NeuroDl converts astrocytes and reactive astrocytes into functional glutamatergic neurons and converts NG2 cells and reactive NG2 cells predominantly into functional GABAergic neurons, along with a few functional glutamatergic neurons.
  • Conversion of astrocytes, reactive astrocytes, NG2 cells and/or reactive NG2 cells to neurons in vitro, ex vivo and/or in vivo may be used to treat neurodegenerative disease and injury, replacing degenerated neurons and restoring neural function.
  • glial cells Provided by the present invention are methods for direct conversion of reactive glial cells into functional neurons by a single transcription factor, NeuroDl, to treat injury and/or disease of the nervous system.
  • [00175] Expression of NeuroDl in astrocytes and/or NG2 cells converts the astrocytes and NG2 cells into functional neurons and has several significant consequences on brain injury: 1) reduces the number of reactive glial cells in the injury site; 2) generates new functional neurons to connect with existing neurons; 3) axon fibers increase in the injury site; 4) blood vessels increase after conversion of astrocytes and NG2 cells into functional neurons; 5) cell death decreases after conversion of astrocytes and NG2 cells into functional neurons. Therefore, the entire landscape of the injury site is changed into a more neuro-permissive environment, which will be a critical step toward functional recovery.
  • NeuroDl -mediated direct conversion of glial cells into functional neurons not only occurs in young adult animals, but also in very old animals and even old animals with Alzheimer's disease, making it possible for brain repair in the adult brain. Moreover, reactive glial cells in an accepted model of Alzheimer' s disease are converted into functional neurons by the exogenous expression of a single transcription factor, NeuroDl, and such conversion was accompanied with reduced amyloid ⁇ peptide deposits.
  • NeuroDl converted neurons represent the first in vitro and in vivo direct conversion of these cells to functional neurons.
  • the NeuroDl converted neurons are characterized by long-term stability of the neuronal phenotype.
  • Methods for producing new neurons in the brain in vivo are provided according to aspects of the present invention which include introducing NeuroDl into a glial cell, particularly into an astrocyte, reactive astrocyte, NG2 cell or reactive NG2 cell, thereby "converting" the glial cell to a neuron, a "NeuroDl converted neuron.”
  • Methods and compositions of the present invention have various uses, including for example, production of neurons in situ to treat a neurological condition of a subject.
  • in situ replacement of injured neuronal cells by conversion of endogenous reactive astrocytes into neurons eliminates the possibility of immunorejection such as can occur when a tissue/cell transplant is performed to replace damaged neuronal cells.
  • glial cells such as astrocytes often over proliferate. Changing surplus glial cells into neurons will reduce the number of reactive glial cells, and in the mean while replenish lost neurons for internal brain repair.
  • Methods of producing a neuronal phenotype from a glial cell such as an NG2 cell, reactive NG2 cell, astrocyte and/or reactive astrocyte, are provided according to aspects of the present invention which include expressing exogenous NeuroDl in the glial cell.
  • the glial cell such as an NG2 cell, reactive NG2 cell, astrocyte and/or reactive astrocyte, is in vitro, ex vivo or in vivo.
  • Glial cells expressing exogenous NeuroDl may be transferred to a site of nervous system injury or disease to treat a subject in need thereof.
  • the glial cell such as an NG2 cell, reactive NG2 cell, astrocyte and/or reactive astrocyte, may be human or non-human mammalian, but can be non-mammalian as well.
  • RNA Interference Nuts and Bolts of RNAi Technology, DNA Press LLC, Eagleville, PA, 2003; Herdewijn, p. (Ed.), Oligonucleotide Synthesis: Methods and Applications, Methods in Molecular Biology, Humana Press, 2004; A. Nagy, M. Gertsenstein, K. Vintersten, R.
  • NeuroDl proteins and nucleic acids may be isolated from natural sources, such as the brain of an organism or cells of a cell line which expresses NeuroDl.
  • NeuroDl protein or nucleic acid may be generated recombinantly, such as by expression using an expression construct, in vitro or in vivo.
  • NeuroDl proteins and nucleic acids may also be synthesized by well-known methods.
  • promoter refers to a DNA sequence operably linked to a nucleic acid sequence to be transcribed such as a nucleic acid sequence encoding NeuroDl.
  • a promoter is generally positioned upstream of a nucleic acid sequence to be transcribed and provides a site for specific binding by RNA polymerase and other transcription factors.
  • a promoter is generally positioned upstream of the nucleic acid sequence transcribed to produce the desired molecule, and provides a site for specific binding by RNA polymerase and other transcription factors.
  • the 5 ' non-coding region of a gene can be isolated and used in its entirety as a promoter to drive expression of an operably linked nucleic acid.
  • a portion of the 5' non-coding region can be isolated and used to drive expression of an operably linked nucleic acid.
  • about 500-6000 bp of the 5' non- coding region of a gene is used to drive expression of the operably linked nucleic acid.
  • a portion of the 5' non-coding region of a gene containing a minimal amount of the 5' non-coding region needed to drive expression of the operably linked nucleic acid is used.
  • Assays to determine the ability of a designated portion of the 5' non-coding region of a gene to drive expression of the operably linked nucleic acid are well-known in the art.
  • Promoters can be derived entirely from a single gene or can be chimeric, having portions derived from more than one gene.
  • Human GFAP promoter is shown herein as SEQ ID NO:6.
  • Mouse AldhlLl promoter is shown herein as SEQ ID NO:7.
  • NG2 cell-specific promoter is the promoter of the chondroitin sulfate proteoglycan 4 gene, also known as neuron-glial antigen 2 (NG2).
  • NG2 promoter is shown herein as SEQ ID NO:8.
  • a non-limiting example of a "reactive astrocyte-specific" promoter is the promoter of the lipocalin 2 (lcn2) gene.
  • Mouse lcn2 promoter is shown herein as SEQ ID NO:5.
  • Homologues and variants of ubiquitous and cell type-specific promoters may be used in expressing NeuroDl.
  • Promoter homologues and promoter variants can be included in an expression vector for expressing NeuroDl according to the present invention.
  • the terms "promoter homologue” and “promoter variant” refer to a promoter which has substantially similar functional properties to confer the desired type of expression, such as cell type-specific expression of NeuroDl or ubiquitous expression of NeuroDl, on an operably linked nucleic acid encoding NeuroDl compared to those disclosed herein.
  • a promoter homologue or variant has substantially similar functional properties to confer cell type-specific expression on an operably linked nucleic acid encoding NeuroDl compared to GFAP, AldhlLl, NG2, lcn2 and CAG promoters.
  • SEQ ID NO: 9 is an example of a nucleic acid including CAG promoter operably linked to a nucleic acid encoding NeuroDl, and further including a nucleic acid sequence encoding EGFP and an enhancer, WPRE.
  • An IRES separates the nucleic acid encoding NeuroDl and the nucleic acid encoding EGFP.
  • SEQ ID NO:9 is inserted into an expression vector for expression of NeuroDl and the reporter gene EGFP.
  • the IRES and nucleic acid encoding EGFP are removed and the remaining CAG promoter and operably linked nucleic acid encoding NeuroDl is inserted into an expression vector for expression of NeuroDl.
  • the WPRE or another enhancer is optionally included.
  • Exemplary reporter genes include, but are not limited to, green fluorescent protein (GFP), enhanced green fluorescent protein (eGFP), yellow fluorescent protein (YFP), enhanced yellow fluorescent protein (eYFP), cyan fluorescent protein (CFP), enhanced cyan fluorescent protein (eCFP), blue fluorescent protein (BFP), enhanced blue fluorescent protein (eBFP), MmGFP (Zernicka-Goetz et al., Development, 124: 1133-1137, 1997, dsRed, luciferase and beta-galactosidase (lacZ).
  • GFP green fluorescent protein
  • eGFP enhanced green fluorescent protein
  • YFP yellow fluorescent protein
  • eYFP enhanced yellow fluorescent protein
  • CFP cyan fluorescent protein
  • BFP blue fluorescent protein
  • eBFP enhanced blue fluorescent protein
  • MmGFP Zernicka-Goetz et al., Development, 124: 1133-1137, 1997, dsRed, luciferase and beta-galactosidase (lacZ).
  • a host cell is transfected ex-vivo and then re-introduced into a host organism.
  • cells or tissues may be removed from a subject, transfected with an expression vector encoding NeuroDl and then returned to the subject.
  • Expression of exogenous NeuroDl in the host glial cell to convert the glial cell to a neuron is optionally achieved by introduction of mRNA encoding NeuroDl, or a functional fragment thereof, to the host glial cell in vitro or in vivo.
  • Expression of exogenous NeuroDl in the host glial cell to convert the glial cell to a neuron is optionally achieved by introduction of NeuroDl protein to the host glial cell in vitro or in vivo.
  • the carrier is a particulate carrier such as lipid particles including liposomes, micelles, unilamellar or mulitlamellar vesicles; polymer particles such as hydrogel particles, polyglycolic acid particles or polylactic acid particles; inorganic particles such as calcium phosphate particles such as described in for example U.S. Patent No. 5,648,097; and inorganic/organic particulate carriers such as described for example in U.S. Patent No. 6,630,486.
  • lipid particles including liposomes, micelles, unilamellar or mulitlamellar vesicles
  • polymer particles such as hydrogel particles, polyglycolic acid particles or polylactic acid particles
  • inorganic particles such as calcium phosphate particles such as described in for example U.S. Patent No. 5,648,097
  • inorganic/organic particulate carriers such as described for example in U.S. Patent No. 6,630,486.
  • a particulate carrier is typically formulated such that particles have an average particle size in the range of about 1 nm - 10 microns.
  • a particulate carrier is formulated such that particles have an average particle size in the range of about 1 nm - 100 nm.
  • liposomes and methods relating to their preparation and use may be found in Liposomes: A Practical Approach (The Practical Approach Series, 264), V. P. Torchilin and V. Weissig (Eds.), Oxford University Press; 2nd ed., 2003. Further aspects of nanoparticles are described in S.M. Moghimi et al., FASEB J. 2005, 19, 311-30.
  • Host cells containing the recombinant expression vector are maintained under conditions wherein NeuroDl is produced.
  • Host cells may be cultured and maintained using known cell culture techniques such as described in Celis, Julio, ed., 1994, Cell Biology Laboratory Handbook, Academic Press, N.Y.
  • Various culturing conditions for these cells including media formulations with regard to specific nutrients, oxygen, tension, carbon dioxide and reduced serum levels, can be selected and optimized by one of skill in the art.
  • a recombinant expression vector including a nucleic acid encoding NeuroDl is introduced into glial cells of a subject. Expression of exogenous NeuroDl in the glial cells "converts" the glial cells into neurons.
  • a recombinant expression vector including a nucleic acid encoding NeuroDl or a functional fragment thereof is introduced into astrocytes of a subject. Expression of exogenous NeuroDl in the glial cells "converts" the astrocytes into neurons.
  • a recombinant expression vector including a nucleic acid encoding NeuroDl or a functional fragment thereof is introduced into reactive astrocytes of a subject. Expression of exogenous NeuroDl or a functional fragment thereof in the reactive astrocytes "converts" the reactive astrocytes into neurons.
  • a recombinant expression vector including a nucleic acid encoding NeuroDl or a functional fragment thereof is introduced into NG2 cells of a subject. Expression of exogenous NeuroDl or a functional fragment thereof in the NG2 cells "converts" the NG2 cells into neurons.
  • Detection of expression of exogenous NeuroDl following introduction of a recombinant expression vector including a nucleic acid encoding the exogenous NeuroDl or a functional fragment thereof is accomplished using any of various standard methodologies including, but not limited to, immunoassays to detect NeuroDl, nucleic acid assays to detect NeuroDl nucleic acids and detection of a reporter gene co-expressed with the exogenous NeuroDl.
  • glial phenotype such as astrocyte phenotype and reactive astrocyte phenotypes encompasses but is not limited to: characteristic morphological aspects of astrocytes and reactive astrocytes such as a generally "star-shaped" morphology; and characteristic astrocyte and reactive astrocyte protein expression, such as presence of glial fibrillary acidic protein (GFAP).
  • characteristic morphological aspects of astrocytes and reactive astrocytes such as a generally "star-shaped" morphology
  • characteristic astrocyte and reactive astrocyte protein expression such as presence of glial fibrillary acidic protein (GFAP).
  • GFAP glial fibrillary acidic protein
  • the nucleic acid of SEQ ID NO: 3 is an example of an isolated DNA molecule having a sequence that hybridizes under high stringency hybridization conditions to the nucleic acid set forth in SEQ ID NO: 1.
  • a fragment of a NeuroDl nucleic acid is any fragment of a NeuroDl nucleic acid that is operable in aspects of the present invention including a NeuroDl nucleic acid.
  • a nucleic acid probe or primer able to hybridize to a target NeuroDl mRNA or cDNA can be used for detecting and/or quantifying mRNA or cDNA encoding NeuroDl protein.
  • a nucleic acid probe can be an oligonucleotide of at least 10, 15, 30, 50 or 100 nucleotides in length and sufficient to specifically hybridize under stringent conditions to NeuroDl mRNA or cDNA or complementary sequence thereof.
  • a nucleic acid primer can be an oligonucleotide of at least 10, 15 or 20 nucleotides in length and sufficient to specifically hybridize under stringent conditions to the mRNA or cDNA, or complementary sequence thereof.
  • nucleic acid includes a nucleotide sequence described as having a "percent complementarity" to a specified second nucleotide sequence.
  • a nucleotide sequence may have 80%, 90%, or 100% complementarity to a specified second nucleotide sequence, indicating that 8 of 10, 9 of 10 or 10 of 10 nucleotides of a sequence are complementary to the specified second nucleotide sequence.
  • the nucleotide sequence 3'-TCGA-5' is 100% complementary to the nucleotide sequence 5'-AGCT-3'.
  • the nucleotide sequence 3'-TCGA- is 100% complementary to a region of the nucleotide sequence 5 ' -TTAGCTGG-3 ' .
  • hybridization and “hybridizes” refer to pairing and binding of complementary nucleic acids. Hybridization occurs to varying extents between two nucleic acids depending on factors such as the degree of complementarity of the nucleic acids, the melting temperature, Tm, of the nucleic acids and the stringency of hybridization conditions, as is well known in the art.
  • stringency of hybridization conditions refers to conditions of temperature, ionic strength, and composition of a hybridization medium with respect to particular common additives such as formamide and Denhardt's solution. Determination of particular hybridization conditions relating to a specified nucleic acid is routine and is well known in the art, for instance, as described in J. Sambrook and D.W.
  • High stringency hybridization conditions are those which only allow hybridization of substantially complementary nucleic acids. Typically, nucleic acids having about 85-100% complementarity are considered highly complementary and hybridize under high stringency conditions. Intermediate stringency conditions are exemplified by conditions under which nucleic acids having intermediate complementarity, about 50-84% complementarity, as well as those having a high degree of complementarity, hybridize. In contrast, low stringency hybridization conditions are those in which nucleic acids having a low degree of complementarity hybridize.
  • hybridization and “specifically hybridizes” refer to hybridization of a particular nucleic acid to a target nucleic acid without substantial hybridization to nucleic acids other than the target nucleic acid in a sample.
  • Stringency of hybridization and washing conditions depends on several factors, including the Tm of the probe and target and ionic strength of the hybridization and wash conditions, as is well-known to the skilled artisan.
  • Hybridization and conditions to achieve a desired hybridization stringency are described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001; and Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002.
  • Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include delivering a therapeutically effective amount of NeuroDl to glial cells of the central nervous system or peripheral nervous system of the subject, the therapeutically effective amount of NeuroDl in the glial cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated.
  • the conversion of reactive glial cells into neurons also reduces neuroinflammation and neuroinhibitory factors associated with reactive glial cells, thereby making the glial scar tissue more permissive to neuronal growth so that neurological condition is alleviated.
  • neurological condition refers to any condition of the central and/or peripheral nervous system of a subject which is alleviated, ameliorated or prevented by additional neurons. Injuries or diseases which result in loss or inhibition of neurons and/or loss or inhibition of neuronal function are neurological conditions for treatment by methods according to aspects of the present invention.
  • Injuries or diseases which result in loss or inhibition of glutamatergic neurons and/or loss or inhibition of glutaminergic neuronal functions are neurological conditions for treatment by methods according to aspects of the present invention. Loss or inhibition of other types of neurons, such as GABAergic, cholinergic, dopaminergic, norepinephrinergic, or seratonergic neurons can be treated with the similar method.
  • injuries or diseases which result in loss or inhibition of neurons and/or loss or inhibition of neuronal functions including, but not limited to, Alzheimer's disease, Parkinson disease, Amyotrophic lateral sclerosis (ALS), stroke, epilepsy, physical injury such as brain or spinal cord injury, and tumor, are neurological conditions for treatment by methods according to aspects of the present invention.
  • Alzheimer's disease Parkinson disease
  • Amyotrophic lateral sclerosis ALS
  • stroke epilepsy
  • physical injury such as brain or spinal cord injury
  • tumor are neurological conditions for treatment by methods according to aspects of the present invention.
  • a therapeutically effective amount is intended to mean an amount of an inventive composition which is effective to alleviate, ameliorate or prevent a symptom or sign of a neurological condition to be treated.
  • a therapeutically effective amount is an amount which has a beneficial effect in a subject having signs and/or symptoms of a neurological condition.
  • treat refers to alleviating, inhibiting or ameliorating a neurological condition, symptoms or signs of a neurological condition, and preventing symptoms or signs of a neurological condition, and include, but are not limited to therapeutic and/or prophylactic treatments.
  • Method of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include providing a viral vector comprising a nucleic acid encoding NeuroDl; and delivering the viral vector to the central nervous system or peripheral nervous system of the subject, whereby the viral vector infects glial cells of the central nervous system or peripheral nervous system, respectively, producing infected glial cells and whereby exogenous NeuroDl is expressed in the infected glial cells at a therapeutically effective level, wherein the expression of NeuroDl in the infected cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated.
  • the number of reactive glial cells will also be reduced, resulting in less neuroinhibitory factors released, thereby making local environment more permissive to neuronal growth or axon penetration, hence alleviating neurological conditions.
  • Administration of a pharmaceutical composition to the central nervous system or peripheral nervous system of a subject is accomplished by methods including systemic or local administration.
  • Combinations of therapies for a neurological condition of a subject are administered according to aspects of the present invention.
  • subject refers to humans and also to non-human mammals such as, but not limited to, non-human primates, cats, dogs, sheep, goats, horses, cows, pigs and rodents, such as but not limited to, mice and rats; as well as to non-mammalian animals such as, but not limited to, birds, poultry, reptiles, amphibians.
  • non-human mammals such as, but not limited to, non-human primates, cats, dogs, sheep, goats, horses, cows, pigs and rodents, such as but not limited to, mice and rats; as well as to non-mammalian animals such as, but not limited to, birds, poultry, reptiles, amphibians.
  • inventive compositions and methods are illustrated in the following examples. These examples are provided for illustrative purposes and are not considered limitations on the scope of inventive compositions and methods.
  • Astrocyte culture medium contained DMEM/F12 (Gibco), 10% fetal bovine serum (Gibco), penicillin/ streptomycin (Gibco), 3.5 mM glucose (Sigma), and supplemented with B27 (Gibco), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen).
  • mice For mouse NG2 culture, the cortical tissue of postnatal mice (P3-P5) was dissociated and plated in 25 cm 2 flasks coated with poly-D-lysine (Sigma). The cells were maintained in DMEM/F12 (Gibco) with 10% fetal bovine serum (Gibco) for 9 days, with a medium change every 3 days. On the 9 th day, the flasks were shaken rigorously and the supernatant was collected and centrifuged to harvest NG2 cells with a small number of neurons and microglia cells. After centrifuge, cells were resuspended and seeded on poly-D-lysine (Sigma) coated coverslips (12 mm).
  • poly-D-lysine Sigma
  • the cells were cultured in serum-free DMEM medium (Gibco) with N2 supplements (STEMCELLTM) and 10 ng/ml platelet-derived growth factor (PDGF, Invitrogen), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen) for 3 days.
  • PDGF platelet-derived growth factor
  • EGF epidermal growth factor
  • FGF2 fibroblast growth factor 2
  • HA 1800 Human cortical astrocytes (HA 1800) were purchased from ScienCell (California). Cells were subcultured when they were over 90% confluent. For subculture, cells were trypsinized by TrypLETM Select (Invitrogen), centrifuged for 5 min at 1,000 rpm, re-suspended, and plated in a medium consisting of DMEM/F12 (Gibco), 10% fetal bovine serum (Gibco), penicillin/ streptomycin (Gibco), 3.5 mM glucose (Sigma), and supplemented with B27 (Gibco), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen).
  • the astrocytes were cultured on poly-D-lysine (Sigma) coated coverslips (12 mm) at a density of 50,000 cells per coverslip in 24-well plates (BD Biosciences).
  • Human primary microglial cells were obtained from Clonexpress, Inc. (Maryland).
  • the cells were cultured in DMEM/F-12 (Gibco) supplemented with 5% FBS, 10 ng/ml of macrophage colony- stimulating factor (M-CSF, Invitrogen), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen).
  • M-CSF macrophage colony- stimulating factor
  • EGF2 epidermal growth factor 2
  • FGF2 fibroblast growth factor 2
  • the mouse NeuroDl gene was subcloned from the pAd NeuroD-I-nGFP construct, described in Zhou, Q. et al., Nature 455(7213):627-632, 2008 (Addgene) and inserted into a pCAG-GFP-IRES-GFP retroviral vector described in Zhao, C. et al., J. Neurosci., 26(1):3- 11,2006 to generate pCAG-NeuroDl-IRES-GFP retroviral vector.
  • the sequence of CAG- NeuroDl-IRES-GFP is shown herein as SEQ ID NO:9.
  • a control retrovirus construct, pCAG- GFP encodes GFP and not NeuroD 1.
  • the human GFAP promoter gene was subcloned from hGFAP Promo ter-Cre-MP-1 (Addgene) and replaced the CAG promoter to generate pGFAP-NeuroDl-IRES-GFP and pGFAP-GFP-IRES-GFP retroviral vectors.
  • the mouse Lcn2 promoter was subcloned and replaced the CAG promoter to generate mLcn2-NeuroDl-IRES-GFP and mLcn2-GFP-IRES-GFP retroviral vectors.
  • Reactive glial cells typically have high expression of Lcn2, an inflammation marker after injury.
  • the mouse AldhlLl promoter was subcloned and replaced the CAG promoter to generate m Aldh 1 L 1 -NeuroD 1 -IRES-GFP and m Aldh 1 L 1 - GFP-IRES - GFP retroviral vectors. Reactive glial cells typically have high expression of AldhlLl.
  • the nucleic acid encoding GFP is not included for expression of NeuroDl without GFP. Similarly, when only NeuroDl is to be expressed, the IRES need not be included in the construct.
  • Viral particles were packaged in gpg helperfree HEK (human embryonic kidney) cells to generate VSV-G (vesicular stomatitis virus glycoprotein)-pseudotyped retroviruses encoding neurogenic factors in CellMaxTM hollow fiber cell culture system (Spectrum Laboratories).
  • the titer of viral particles was about 10 8 particles/ ⁇ , determined after transduction of HEK cells.
  • CBX carbenoxolone
  • AD transgenic mice were purchased from The Jackson Laboratory (B6SJL-Tg).
  • mice were housed in a 12 hr light/dark cycle and supplied with enough food and water.
  • Each mouse received injection (site: AP 1.25 mm, ML 1.4 mm, DV -1.5 mm) of virus with a 5 ⁇ syringe and a 34 gauge needle.
  • the injection volume and flow rate were controlled as 3 ⁇ at 0.2 ⁇ /min, and the needle was moved up during the injection at speed of 0.1 mm/min. After injection, the needle was kept for at least 5 additional minutes and then slowly withdrawn.
  • the needle injection itself was used as stab injury model.
  • Coronal brain sections were first pretreated in 0.3% Triton X-100 in phosphate-buffered saline (PBS, pH 7.4) for 1 hour, followed by incubation in 3% normal goat serum, 2% normal donkey serum and 0.1% Triton X-100 in PBS for 1 hour.
  • PBS phosphate-buffered saline
  • BrdU immunohistochemistry 100 mg/kg of BrdU (5-bromo-2-deoxyuridine; Invitrogen) was administered to stab- injured mice through intraperitoneal injection for 3 consecutive days starting from 2 days post injury (DPI) to 4 DPI. Mice were euthanized at 4 DPI or 1 month post injury. Floating brain sections were immersed in 85-90°C IX citrate buffer (Sigma # C9999) for 15 min and cool down to room temperature (RT) for 20 min. After wash with PBS for 3 times, brain sections were treated with 2 M HC1 at 37°C for 20 min and washed with PBS for 6 times.
  • Patch pipettes were pulled from borosilicate glass (4 - 5 ⁇ ) and filled with a pipette solution consisting of 135 mM KCl (or 10 mM KCl + 125 mM K-Gluconate), 5 mM Na-phosphocreatine, 10 mM HEPES, 2 mM EGTA, 4 mM MgATP, and 0.5 mM Na 2 GTP, pH 7.3 adjusted with KOH.
  • 0 mM CI " (135 mM K-Gluconate) pipette solution was also used.
  • the series resistance was typically 10-25 ⁇ .
  • the membrane potential was typically held at -70 or -80 mV.
  • NeuroDl-GFP fluorescence refers to GFP fluorescence detected in cells infected with a retrovirus construct encoding both NeuroDl and GFP, such that the GFP fluorescence is a surrogate marker for expression of NeuroDl.
  • expression of NeuroDl was independently verified using an anti-NeuroDl antibody assay, examples of which are described and/or shown herein. Note the significant number of NeuN-positive neurons in the injury site after infection with retrovirus construct pCAG-NeuroDl-IRES-GFP.
  • Figure IE shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel.
  • NeuroDl -converted neurons are shown to be NeuN-positive, arrowhead, having robust dendrites and a potential axon is shown at the arrow, scale bar, 20 ⁇ .
  • Figure 2A shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, pCAG-GFP, top left or in cells infected with retroviral vector pCAG-NeuroDl-IRES-GFP, bottom left, at 12-16 DPI.
  • FIG. 3A shows representative images illustrating GFAP immunofluorescence in wild-type mouse cortex in the left panel, GFAP immunofluorescence in 5xFAD mouse cortex, shown in the middle panel, and the overlap of GFAP immunofluorescence in 5xFAD mouse cortex and thioflavin-S immunofluorescence in the same field, shown in the right panel, scale bar, 20 ⁇ . Thioflavin-S labels ⁇ plaques. Reactive astrocytes (labeled by GFAP) in 5xFAD mouse cortex were significantly increased compared to wild-type mouse cortex.
  • Gltl immunofluorescence in the same fields is shown in the corresponding middle panels top and bottom.
  • the overlap of GFP fluorescence or NeuroDl-GFP fluorescence and Gltl immunofluorescence in the same field is shown in the corresponding right panels, scale bar, 40 ⁇ .
  • Figure 4B is a representative pair of phase contrast images showing NeuroDl -induced morphological change from astrocytes (left) to neurons at 45 DPI with retrovirus construct pCAG-NeuroDl-IRES-GFP (right), scale bar, 20 ⁇ .
  • FIG. 5E show images illustrating that GFAP::GFP retrovirus-infected astrocytes were DCX-negative, scale bar, 40 ⁇ .
  • Figure 6B shows representative images illustrating that NeuroDl-GFP retrovirus infected cells were immunopositive for NeuN. NeuroDl expression was confirmed by NeuroDl staining (8 DPI).
  • NeuroDl-GFP fluorescence is shown at left, NeuN immunostaining of the same field is shown in the middle panel and NeuroDl immunostaining of the same field is shown in the panel at right, scale bar, 40 ⁇ .
  • Figure 6D shows representative images illustrating that cells infected with a retrovirus construct encoding NeuroDl were mostly positive for cortical neuron marker Tbrl.
  • NeuroDl-GFP fluorescence is shown at left, Tbrl immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and Tbrl immunostaining of the same field is shown in the panel at right, scale bar, 40 ⁇ .
  • Example 20 Functional characterization of NeuroDl-converted neurons generated by infection of mouse astrocytes with a retrovirus encoding NeuroDl
  • NeuroDl-converted neurons generated by infection of mouse astrocytes with a retrovirus encoding NeuroDl showed large GABA, glutamate and NMDA currents, as well as spontaneous synaptic events which were blocked by CNQX but not BIC, suggesting that they were glutamatergic neurons.
  • NeuroDl converts NG2 cells into neurons
  • FIG. 8A shows representative images of cultured mouse NG2 cells showing NG2 immunostaining, left, Ibal immunostaining, middle, and GFAP immunostaining, right, indicating that the majority of cells in the mouse NG2 cultures were immunopositive for NG2 (79.2 + 3.2%), scale bar, 40 ⁇ .
  • Cultured mouse NG2 cells had many oligodendrocytes as identified immunopositive for CNPase at 5 DPI with a retrovirus construct encoding GFP without NeuroDl.
  • FIG. 8B GFP fluorescence is shown at left, CNPase immunostaining is shown in the middle panel and the overlap of GFP fluorescence and CNPase immunostaining of the same field is shown in the right panel, scale bar, 40 ⁇ .
  • NG2 cells are oligodendrocyte precursor cells.
  • Figure 8C shows representative images illustrating that NG2 cells infected with a retrovirus encoding NeuroDl-GFP became NeuN-positive neurons, shown at 5 DPI.
  • NeuroDl -GFP fluorescence is shown at left, NeuN immunostaining is shown in the middle panel and the overlap of GFP fluorescence and NeuN immunostaining of the same field is shown in the right panel, scale bar, 40 ⁇ .
  • NeuroDl -GFP fluorescence is shown at left, GAB A immunostaining is shown in the middle panel and the overlap of GFP fluorescence and GABA immunostaining of the same field is shown in the right panel, scale bar, 40 ⁇ .
  • Arrows in Figure 8D point to GABAergic neurons, arrowhead points to a non-GABAergic neuron.
  • Figure 8E shows representative images illustrating that NG2 cells infected with a retrovirus construct encoding NeuroDl were mostly immunopositive for cortical neuron marker Tbrl, 5 DPI.
  • NeuroDl-GFP fluorescence is shown at left, Tbrl immunostaining is shown in the middle panel and the overlap of GFP fluorescence and Tbrl immunostaining of the same field is shown in the right panel, scale bar, 40 ⁇ .
  • Figure 8F shows representative images illustrating that NG2 cells infected with a retrovirus construct encoding NeuroDl were either positive (arrow) or negative for Proxl (arrowhead, 5 DPI).
  • Figure 8F NeuroDl-GFP fluorescence is shown at left, Proxl immunostaining is shown in the middle panel and the overlap of GFP fluorescence and Proxl immunostaining of the same field is shown in the right panel, scale bar, 40 ⁇ .
  • Figure 8G is a graph showing quantitation of cultured mouse NG2 cells immunopositive for GFAP, Ibal and NG2.
  • FIG. 9 A shows representative images illustrating that numerous VGluTl puncta were detected on NG2 cells converted to neurons by NeuroDl after infecting mouse NG2 cultures with NeuroDl-GFP retrovirus.
  • NeuroDl-GFP fluorescence is shown in the left panel
  • vGlutl immunostaining is shown in the middle panel
  • the overlap of NeuroDl- GFP fluorescence and vGlutl immunostaining in the same field is shown in the right panel, scale bar, 20 ⁇ .
  • Spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed both glutamatergic and GABAergic components, confirming that NeuroDl can convert NG2 cells into both excitatory and inhibitory neurons.
  • FIG. 10A is an image of NeuroDl-GFP fluorescence in clear dendritic spines (arrows) observed in 2-month old NeuroDl- converted neurons after viral injection, scale bar, 4 ⁇ .
  • Figure 10B is a representative trace showing large spontaneous synaptic events recorded from 2-month old NeuroDl-converted neurons in cortical slice recordings.
  • Figure IOC is a representative trace showing an expanded view of the synaptic events shown in Figure 10B.
  • Figure 11B shows representative images of BrdU immunostaining at 1 month post-injury, left panel, along with NeuN immunostaining of the same field, middle panel, and the overlap of BrdU immunostaining and NeuN immunostaining of the same field, right panel, scale bar, 20 ⁇ .
  • Figure 12A shows representative images of immunostaining showing changes of GFAP (astrocyte), NG2 (NG2 cell), and Ibal (microglia) signal before (DO) and up to one month after brain stab injury.
  • TUNEL cell death
  • CSPG chondroitin sulfate proteoglycan
  • Cx43 astrocytic gap junctions
  • CSPG chondroitin sulfate proteoglycan
  • TUNEL, CSPG, and Cx43 signals decreased at 2 weeks after injury, but increased again at 30 days after injury. Furthermore, the astrocytic glutamate transporter (Gltl), axon fibers (SMI312), and oligodendrocyte myelin proteins (MBP) all decreased after injury.
  • Example 26 More beneficial effects after conversion of reactive astrocytes and NG2 cells into functional neurons by expression of exogenous NeuroDl in the injury sites
  • Figure 13A includes images of GFP fluorescence, top left or NeuroDl -GFP fluorescence, bottom left, Cx43 immunostaining, middle panels and the overlap of GFP or NeuroDl-GFP fluorescence and Cx43 immunostaining, right panels, top and bottom respectively, scale bar, 20 ⁇ .
  • Figure 13B includes images of GFP fluorescence, top left or NeuroDl-GFP fluorescence, bottom left, TUNEL staining, middle panels and the overlap of GFP or NeuroDl-GFP and TUNEL staining, right panels, top and bottom respectively, scale bar, 20 ⁇ .
  • Figure 13C includes images of GFP fluorescence, top left or NeuroDl-GFP fluorescence, bottom left, VEGF immunostaining, middle panels and the overlap of GFP or NeuroDl-GFP and VEGF immunostaining, right panels, top and bottom respectively, scale bar, 10 ⁇ .
  • SMI312 immunostaining is shown in the left panel, MBP immunostaining in the middle left panel and the overlap of SMI312 immunostaining and MBP immunostaining is shown in the panel on the right.
  • Gap junction-mediated trans-cellular signaling may mediate beneficial effects of conversion of astrocytes to neurons by expression of exogenous NeuroDl.
  • Astrocytes are coupled with gap junctions and brain injury increases astrocytic gap junctions, see Figure 12B.
  • the studies described herein showed that during the early stage of astrocyte-neuron conversion, gap junctions might remain between astrocytes and new NeuroDl -converted neurons, see Figure 2G. Further results showed that injecting dye (sulforhodamine B) into 1-day old NeuroDl- converted neurons resulted in the spreading of the dye into neighboring astrocytes (Figure 14A). The dye coupling was blocked by gap junction inhibitor carbenoxolone (CBX), see Figure 14A.
  • CBX gap junction inhibitor carbenoxolone
  • Figure 14C is a graph showing quantitation of these results.
  • NeuroDl can convert reactive astrocytes and NG2 cells into NeuroDl-converted neurons in aging animals
  • NeuroDl-GFP fluorescence is shown in the left panel
  • NeuN immunostaining is shown in the middle panel
  • the overlap of NeuroDl -GFP fluorescence and NeuN immunostaining in the same field is shown in the right panel.
  • NeuroDl -GFP fluorescence is shown in the left panel and the overlap of NeuroDl -GFP fluorescence and DAPI fluorescence in the same field is shown in the right panel.
  • FIG 15C NeuroDl-GFP fluorescence is shown in the left panel, ⁇ 42 immunostaining is shown in the middle panel and the overlap of NeuroDl -GFP fluorescence and ⁇ 42 immunostaining in the same field is shown in the right panel.
  • NeuroDl-GFP fluorescence is shown in the left panel
  • Musashi immunostaining is shown in the middle panel
  • the overlap of NeuroDl-GFP fluorescence and Musashi immunostaining in the same field is shown in the right panel, along with DAPI fluorescence.
  • Figure 17E and Figure 17F are representative images showing Tbrl immunostaining in mouse cultured neurons (7 DIV) and NeuroDl -converted neurons generated by infection of human astrocytes with a retrovirus encoding NeuroDl (21 DPI), respectively, scale bars, 40 ⁇ .
  • Human astrocytes can be converted into neurons whereas human microglia cannot.
  • Figure 18G is a graph showing quantitation of cultured human astrocytes immunopositive for SIOO (94.3 + 0.7 %), Ibal and NG2.
  • Figure 18H is a graph showing quantitation of cultured human microglia immunopositive for GFAP, Ibal (97.1 + 1.1%) and NG2.
  • hNG2 NeuroDl -IRES -GFP
  • hNG2 NeuroDl -IRES -GFP
  • FIG. 19A shows representative images obtained after injecting hNG2:: NeuroDl -IRES -GFP retrovirus into one month old mouse cortex.
  • FIG. 19B shows representative images obtained after infecting cultured NG2 cells with hNG2::NeuroDl-IRES- GFP retrovirus.
  • GFP fluorescence is shown in the left panel
  • NeuN immunofluorescence is shown in the middle panel, identifying NeuN-positive neurons in vivo, arrows, 7 DPI.
  • the overlap of GFP fluorescence and NeuN immunofluorescence, along with DAPI staining, is shown in the same field in the right panel. Scale bar: 40 ⁇ .
  • a mouse model for endothelin-1 induced focal ischemic stroke is used to determine the effects of expression of exogenous NeuroDl in glial cells in the stroke injured brain.
  • mice 3-5 month old C57BL/6 male mice (20-30 gram) are housed in standard cage of animal facility of Penn State University on a 12:12 light/dark cycle. Mice are maintained on a restricted feeding schedule (3g/day) to prevent satiation and motivate reaching performance.
  • One group of mice receives intracortical infusions of endothelin-1 (ET-1); one group of mice receives intracortical infusions of 0.9% sterile saline; one group of mice receives sham procedures.
  • ET-1 endothelin-1
  • mice receives intracortical infusions of 0.9% sterile saline
  • mice receives sham procedures.
  • a small burr hole is drilled through the skull over the center of the forelimb region of the sensorimotor cortex at coordinates of 2.25mm lateral to midline and +0.6mm anterior to Bregma.
  • the dura mater is punctured and a 1ml syringe with a 26 gauge needle is lowered into the cortex to a depth of 700 ⁇ .
  • 4 ⁇ of ET-1 (320 pmol, 0.2 ⁇ g/ ⁇ l in sterile saline) is injected into the cortex for 10 min, and the syringe is left in place for 5 min post-injection to prevent backflow before slowly removed.
  • the burr hole is then filled with gelfoam and covered with UV curing dental cement, and the wound is sutured and covered in antibiotic ointment.
  • the animal is placed on the thermal pad till fully awaken before returning to its home cage.
  • one group receives all surgical procedures up to the skull opening and the other receives a skull opening and infusion of vehicle (0.9% sterile saline) into the forelimb area of the sensorimotor cortex.
  • Mice are checked in the following days (4- 5 days) after surgery to ensure the normal recovery of mice.
  • a behavioral test the bilateral tactile stimulation test, can be used to assess the induced stroke.
  • each mouse is placed into a shallow transparent plastic container (8.5cm tall, 18cm in diameter) with an open top and allowed to habituate for lmin.
  • the mouse is picked up and lightly restrained by the scruff while a 1.27 cm long piece of 3mm wide tape is placed onto the ventral side of each paw.
  • the mouse is then placed back into the container and allowed to remove each piece of tape using its teeth. The latency to contact and remove each piece of tape is recorded for five trials, allowing 30 s of rest between each trial.
  • a mouse model for photothrombosis-induced focal ischemic stroke is used to determine the effects of expression of exogenous NeuroDl in glial cells in the stroke injured brain.
  • NeuroDl retrovirus including SEQ ID NO: 2 or SEQ ID NO: 4 is generated as described in Example 3 and injected into the cortex of mice as described in Example 7. After about two weeks following the injection of NeuroDl, the brains will be examined to confirm an increase in neurons in the vicinity of the NeuroDl retrovirus injection. The bilateral tactile stimulation test can be used to assess improvement of stroke-related behavioral effects.
  • a mouse model for spinal cord injury is used to determine the effects of expression of exogenous NeuroDl in glial cells in the injured spinal cord.
  • Example 36 Effect of expression of exogenous Dlx2 converted human astrocytes into GABAergic and glutamatergic neurons in cell culture
  • Item 1 A method of producing a neuronal phenotype in a glial cell, comprising: expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell.
  • Item 2 The method of item 1, wherein the glial cell is in vitro.
  • Item 6 The method of any of items 1-5, wherein expressing exogenous
  • Item 22 The method of treating a neurological condition in a subject in need thereof, according to any of items 17-21, wherein the neurological condition is selected from the group consisting of: Alzheimer disease, Parkinson disease, amyotrophic lateral sclerosis (ALS), epilepsy and stroke.
  • the neurological condition is selected from the group consisting of: Alzheimer disease, Parkinson disease, amyotrophic lateral sclerosis (ALS), epilepsy and stroke.
  • Item 24 The method of treating a neurological condition in a subject in need thereof, according to any of items 17-23, wherein administering a therapeutically effective dose of NeuroDl comprises systemic administration.
  • Item 26 The method of treating a neurological condition in a subject in need thereof, according to any of items 17-25, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a cell type-specific promoter selected from the group consisting of: an astrocyte-specific promoter and an NG2 cell- specific promoter.
  • Item 27 The method of treating a neurological condition in a subject in need thereof, according to any of items 17-26, wherein the expression vector is a viral expression vector.
  • Item 31 The method of treating a neurological condition in a subject in need thereof, according to any of items 17-28, wherein the expression vector is a lentivirus.
  • Item 38 The expression vector of item37 wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter.
  • Item 41 The expression vector of any of items 37-40 wherein the expression vector is an adenovirus, adeno-associated virus or lentivirus.
  • Item 42 The expression vector of any of items 37-41 wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter.
  • Item 43 The expression vector of any of items 37-41 wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO: 3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
  • Item 44 An expression vector, comprising a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl substantially as described herein.
  • compositions and methods described herein are presently representative of preferred embodiments, exemplary, and not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art. Such changes and other uses can be made without departing from the scope of the invention as set forth in the claims.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Plant Pathology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Virology (AREA)
  • Physics & Mathematics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Neurosurgery (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Neurology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)

Description

REGENERATING FUNCTIONAL NEURONS FOR TREATMENT OF DISEASE AND INJURY IN THE NERVOUS SYSTEM
REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority from U.S. Provisional Patent Application Serial Nos. 61/673,471, filed July 19, 2012 and 61/762,506, filed February 8, 2013, the entire content of which is incorporated herein by reference.
GOVERNMENT SUPPORT
[0002] This invention was made with government support under Grant No. MH083911, awarded by the National Institutes of Health. The Government has certain rights in the invention.
FIELD OF THE INVENTION
[0003] General aspects of the invention relate to the in situ conversion of glial cells to functional neuronal cells in the central nervous system (CNS), and the methods to transforming glial cells to neuronal cells both in vitro and in vivo.
BACKGROUND OF THE INVENTION
[0004] The central nervous system in mammals is largely unable to regenerate itself following injury. Neurons are often killed or injured as a result of an injury or neurological condition, such as a disease or other pathology. It is well known that glial cells become reactive following brain or spinal cord injury, after a stroke or neurodegenerative diseases such as Alzheimer' s disease. These reactive glial cells can proliferate and maintain a high number in the injury site, and eventually form a dense scar tissue called glial scar to prevent the growth of neurons.
[0005] Currently there is no method available to reverse glial scar for brain repair. There is an urgent need for methods of treatment of neurological conditions, particularly for generation of neurons in a subject having a neurological condition.
SUMMARY OF THE INVENTION [0006] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell. The glial cell may be human or non-human mammalian, in vitro or in vivo.
[0007] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering an expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[0008] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a viral expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[0009] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[0010] The neuronal phenotype produced in a glial cell in which NeuroDl is exogenous ly expression include one or more, or all, of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
[0011] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell and wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell. The glial cell may be human or non-human mammalian, in vitro or in vivo. [0012] The neuronal phenotype produced in a glial cell in which NeuroDl is the only exogenously expressed transcription factor include one or more, or all, of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
[0013] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering an expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[0014] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a viral expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[0015] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[0016] Methods of producing a neuronal phenotype in a glial cell are provided according to aspects of the present invention including expressing exogenous NeuroDl in the glial cell, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell and wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[0017] Compositions including an in vitro glial cell including exogenous NeuroDl are provided according to aspects of the present invention.
[0018] Compositions including an in vitro glial cell comprising an expression vector encoding NeuroDl are provided according to aspects of the present invention. [0019] Compositions including an in vitro glial cell including exogenous NeuroDl are provided according to aspects of the present invention which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
[0020] Compositions including an in vitro glial cell comprising an expression vector encoding NeuroDl are provided according to aspects of the present invention which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
[0021] Compositions including an in vitro glial cell including exogenous NeuroDl are provided according to aspects of the present invention, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell and which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
[0022] Compositions including an in vitro glial cell comprising an expression vector encoding NeuroDl are provided according to aspects of the present invention, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell and which have a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
[0023] Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
[0024] Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
[0025] Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: 1 or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
[0026] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention are methods of treating a neurological condition characterized by presence of reactive astrocytes.
[0027] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention are methods of treating an injury to the central or peripheral nervous system.
[0028] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention are methods of treating Alzheimer disease, Parkinson disease, amyotrophic lateral sclerosis (ALS), epilepsy and stroke.
[0029] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering a therapeutically effective dose of NeuroDl by local administration, systemic administration or a combination thereof.
[0030] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a ubiquitous promoter by local administration. [0031] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a ubiquitous promoter by local administration to a site of injury or disease in the nervous system of the subject where additional neurons and/or fewer glial cells or reactive glial cells are desirable.
[0032] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a cell type-specific promoter selected from the group consisting of: an astrocyte-specific promoter and an NG2 cell-specific promoter, by local administration to a site of injury or disease in the nervous system of the subject where additional neurons and/or fewer glial cells or reactive glial cells are desirable or by systemic administration to the subject.
[0033] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is a viral expression vector.
[0034] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is a retrovirus.
[0035] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is an adenovirus.
[0036] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is an adeno-associated virus.
[0037] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein the expression vector is a lentivirus.
[0038] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein administering the therapeutically effective dose of NeuroDl comprises administering NeuroDl protein.
[0039] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, wherein administering the therapeutically effective dose of NeuroDl comprises administering mRNA encoding NeuroDl protein.
[0040] Method of treating a neurological condition in a subject in need thereof according to aspects of the present invention include providing a viral expression vector comprising a nucleic acid encoding NeuroDl ; and delivering the viral expression vector to the central nervous system or peripheral nervous system of the subject, whereby the viral vector infects dividing cells of the central nervous system or peripheral nervous system, respectively, producing infected cells and whereby exogenous NeuroDl is expressed in the infected cells at a therapeutically effective level, wherein the expression of NeuroDl in the infected cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated.
[0041] Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include administering a therapeutically effective dose of NeuroDl to a glial cell of the subject, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
[0042] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl.
[0043] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein NeuroDl is the only transcription factor encoded by the nucleic acid.
[0044] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter.
[0045] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter and wherein the expression vector is a viral vector.
[0046] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter and wherein the expression vector is a retroviral expression vector.
[0047] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter and wherein the expression vector is an adenovirus, adeno-associated virus or lenti virus.
[0048] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter.
[0049] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the expression vector is a viral vector.
[0050] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the expression vector is a retroviral expression vector.
[0051] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the expression vector is an adenovirus, adeno-associated virus or lenti virus.
[0052] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
[0053] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
[0054] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter, wherein the expression vector is a viral vector and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
[0055] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter, wherein the expression vector is a retroviral vector and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71 , 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
[0056] Expression vectors are provided according to aspects of the present invention which include a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl, wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter, wherein the expression vector is an adenovirus, adeno-associated virus or lentivirus vector and wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
BRIEF DESCRIPTION OF THE DRAWINGS
[0057] Figure 1A shows representative images illustrating GFP fluorescence in the left panel, GFAP immunofluorescence in the same field, shown in the middle panel, and the overlap of GFP fluorescence and GFAP immunofluorescence in the same field, shown in the right panel;
[0058] Figure IB shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
[0059] Figure 1C shows representative images illustrating GFAP promoter-driven NeuroDl- GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of GFAP promoter-driven NeuroDl -GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
[0060] Figure ID shows representative images at 2DPI illustrating NeuroDl -GFP fluorescence in the left panel, NG2 immunofluorescence in the same field, shown in the middle panel, and DCX immunofluorescence shown in the right panel;
[0061] Figure IE shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
[0062] Figure IF shows a representative trace from cortical slice recordings showing Na+ and K+ currents in NeuroDl -converted neurons at 30 DPI. The NeuroDl -converted neurons were found to be capable of firing repetitive action potentials as well, n = 4;
[0063] Figure 1G shows a representative trace from cortical slice recordings showing repetitive action potentials in NeuroDl -converted neurons at 30 DPI;
[0064] Figure 1H shows representative traces showing spontaneous synaptic events in a
NeuroDl -converted neuron in cortical slice recording at 26 DPI, CNQX, 10 μΜ; Bic, 20 μΜ;
[0065] Figure II shows an enlarged view of the synaptic events from Figure 1H;
[0066] Figure 2A shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, immunofluorescence labels axons in the same fields, shown in the corresponding middle panels top and bottom;
[0067] Figure 2B is a graph showing results of quantitation of axon fibers in the injured region infected with retrovirus construct encoding NeuroDl-GFP showing NeuroDl -induced conversion;
[0068] Figure 2C shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, CSPG immunofluorescence in the same fields is shown in the corresponding middle panels top and bottom;
[0069] Figure 2D is a graph showing results of quantitation of CSPG in the injured region infected with retrovirus construct encoding NeuroDl-GFP showing NeuroDl -induced conversion; [0070] Figure 2E shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, Dextran- Texas Red (Dextran-TR) fluorescence labels blood vessels in the same fields, shown in the corresponding middle panels top and bottom;
[0071] Figure 2F is a graph showing results of quantitation of area of blood vessels in the injured region infected with retrovirus construct encoding NeuroDl-GFP showing NeuroDl- induced conversion;
[0072] Figure 2G shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, GFAP immunofluorescence in the same field, shown in the middle left panel, arrow, Cx43 immunofluorescence in the same field shown in the middle right panel, arrowheads, and the overlap of NeuroDl-GFP fluorescence, GFAP immunofluorescence and Cx43 immunofluorescence in the same field, shown in the right panel;
[0073] Figure 3A shows representative images illustrating GFAP immunofluorescence in wild-type mouse cortex in the left panel, GFAP immunofluorescence in 5xFAD mouse cortex, shown in the middle panel, and the overlap of GFAP immunofluorescence in 5xFAD mouse cortex and thioflavin-S immunofluorescence in the same field, shown in the right panel;
[0074] Figure 3B shows representative images illustrating NeuroDl-GFP fluorescence in 7- month old 5xFAD mouse cortex in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
[0075] Figure 3C shows representative images illustrating GFAP promoter-driven NeuroDl- GFP fluorescence in 5xFAD mouse cortex in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of GFAP promoter-driven NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel;
[0076] Figure 3D shows representative images illustrating NeuroDl-GFP fluorescence in 5xFAD mouse cortex in the top panel and VGlutl immunofluorescence, arrowhead, in the same field shown in the bottom panel;
[0077] Figure 3E shows representative images illustrating GAD65 immunofluorescence, arrow, in 5xFAD mouse cortex in the same field as in Figure 3D in the top panel and the overlap of NeuroDl-GFP fluorescence, VGlutl immunofluorescence and GAD65 immunofluorescence in the same field, shown in the bottom panel; [0078] Figure 3F shows representative traces of sodium and potassium currents of NeuroDl- converted neurons at 28 DPI with retrovirus construct encoding NeuroDl-GFP in AD cortical slices (5xFAD mouse cortex);
[0079] Figure 3G shows representative traces of spontaneous synaptic events recorded from NeuroDl -converted neurons at 28 DPI with retrovirus construct encoding NeuroDl-GFP in the AD cortical slices;
[0080] Figure 3H shows an enlarged view of two synaptic events shown in Figure 3G;
[0081] Figure 31 shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, at 15-17 DPI;
[0082] Figure 3J shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, at 15-17 DPI;
[0083] Figure 3K shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, at 15-17 DPI;
[0084] Figure 3L is a graph showing results of quantitation of Αβ in the region of 5xFAD mouse cortex infected with retrovirus construct encoding NeuroDl-GFP at 15-17 DPI;
[0085] Figure 3M is a graph showing results of quantitation of ApoE in the region of 5xFAD mouse cortex region infected with retrovirus construct encoding NeuroDl-GFP at 15-17 DPI;
[0086] Figure 3N is a graph showing results of quantitation of Gltl in the region of 5xFAD mouse cortex injured region infected with retrovirus construct encoding NeuroDl-GFP at 15-17 DPI;
[0087] Figure 4A is a representative immunofluorescence image showing that the majority of cultured human astrocytes were immunolabeled by SIOOP antibodies, scale bar, 50 μιη;
[0088] Figure 4B is a representative pair of phase contrast images showing NeuroDl - induced morphological change from astrocytes (left) to neurons at 45 DPI with a retrovirus encoding NeuroDl (right);
[0089] Figure 4C shows representative images illustrating GFP fluorescence in human astrocytes infected with a retrovirus construct encoding NeuroDl-GFP;
[0090] Figure 4D shows representative images illustrating GFP fluorescence in human astrocytes infected with a retrovirus construct encoding GFAP promoter-driven NeuroDl-GFP; [0091] Figure 4E shows representative images illustrating direct conversion of human astrocytes into neurons;
[0092] Figure 4F shows representative images of immunostained synaptic puncta (SV2, left) on the dendrites (MAP2, middle) of NeuroDl -converted human neurons at 45 DPI, NeuroDl - GFP fluorescence;
[0093] Figure 4G is a high magnification image showing vesicular glutamate transporter 1 (VGlutl) immunostained puncta co-localized with dendritic spines on NeuroDl -converted neurons;
[0094] Figure 4H is a representative trace of repetitive action potentials in NeuroDl - converted neurons at 20 DPI;
[0095] Figure 41 shows a representative trace showing the Na+ and K+ currents recorded from NeuroDl -converted neurons at 30 DPI;
[0096] Figure 4J shows a representative trace showing receptor currents induced by bath application of 100 μΜ glutamate;
[0097] Figure 4K shows a representative trace showing receptor currents induced by bath application of 100 μΜ GABA;
[0098] Figure 4L shows a representative trace showing receptor currents induced by bath application of 100 μΜ NMD A;
[0099] Figure 4M shows representative traces of spontaneous synaptic events in NeuroDl- converted neurons at 40 DPI;
[00100] Figure 5A is a set of low power images showing GFP retrovirus-infected reactive glial cells in the vicinity of injury core shown at 14 DPI;
[00101] Figure 5B shows NeuroDl -GFP fluorescence along with DCX immunostaining of the same field, middle and overlap of GFP fluorescence and DCX immunostaining of the same field, right;
[00102] Figure 5C shows low power images of DCX-positive cells infected by NeuroDl-GFP along the injection site at 14 DPI;
[00103] Figure 5D are high power images showing DCX-positive cells infected by NeuroDl - GFP along the injection site at 14 DPI;
[00104] Figure 5E shows images illustrating that GFAP::GFP retrovirus-infected astrocytes were DCX-negative; [00105] Figure 6A shows representative images illustrating that cultured mouse astrocytes were mostly immunopositive for astrocyte marker GFAP;
[00106] Figure 6B shows representative images illustrating that NeuroDl-GFP retrovirus infected cells were immunopositive for NeuN;
[00107] Figure 6B shows NeuroDl-GFP fluorescence at left, NeuN immunostaining of the same field is shown in the middle panel and NeuroDl immunostaining of the same field is shown in the panel at right;
[00108] Figure 6C shows representative images illustrating that GFAP::NeuroDl retrovirus- infected cells were also positive for NeuN (8 DPI);
[00109] Figure 6C shows NeuroDl-GFP fluorescence at left, NeuN immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and NeuN immunostaining of the same field is shown in the panel at right;
[00110] Figure 6D shows representative images illustrating that NeuroDl-GFP infected cells were mostly positive for cortical neuron marker Tbrl;
[00111] Figure 6D NeuroDl-GFP fluorescence is shown at left, Tbrl immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and Tbrl immunostaining of the same field is shown in the panel at right;
[00112] Figure 6E shows representative images illustrating that some NeuroDl -infected cells were also positive for dentate granule cell marker Proxl;
[00113] Figure 6E shows NeuroDl-GFP fluorescence at left, Proxl immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and Proxl immunostaining of the same field is shown in the panel at right;
[00114] Figure 6F is a graph showing quantitation of cultured mouse astrocytes immunopositive for GFAP, Ibal and NG2;
[00115] Figure 7A shows large receptor currents induced by bath application of GAB A (100 μΜ) in mouse astrocyte-converted neurons;
[00116] Figure 7B shows glutamate (100 μΜ) evoked currents;
[00117] Figure 7C shows NMDA (100 μΜ) evoked currents;
[00118] Figure 7D shows spontaneous synaptic currents recorded from NeuroDl -converted neurons;
[00119] Figure 8A shows representative images of cultured mouse NG2 cells showing NG2 immunostaining, left, Ibal immunostaining, middle, and GFAP immunostaining, right; [00120] Figure 8B shows GFP fluorescence at left, CNPase immunostaining at middle panel and the overlap of GFP fluorescence and CNPase immunostaining of the same field at right panel;
[00121] Figure 8C shows representative images illustrating that NG2 cells infected with a retrovirus encoding NeuroDl-GFP became NeuN-positive neurons;
[00122] Figure 8C shows NeuroDl-GFP fluorescence at left, NeuN immunostaining at the middle panel and the overlap of GFP fluorescence and NeuN immunostaining of the same field at right panel;
[00123] Figure 8D shows representative images illustrating that many NeuroDl -infected NG2 cells became GABAergic neurons;
[00124] Figure 8E shows representative images illustrating that NeuroDl -infected NG2 cells were mostly immunopositive for cortical neuron marker Tbrl;
[00125] Figure 8F shows representative images illustrating that NeuroDl -infected NG2 cells were either positive (arrow) or negative for Proxl (arrowhead);
[00126] Figure 8G is a graph showing quantitation of cultured mouse NG2 cells immunopositive for GFAP, Ibal and NG2;
[00127] Figure 9A shows representative images illustrating that numerous VGluTl puncta were detected on NG2 cells converted to neurons by NeuroDl after infecting mouse NG2 cultures with NeuroDl-GFP retrovirus;
[00128] Figure 9B is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large sodium and potassium currents;
[00129] Figure 9C is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed repetitive action potentials;
[00130] Figure 9D is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large glutamate-evoked current;
[00131] Figure 9E is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large GABA-evoked current;
[00132] Figure 9F is a representative trace showing that spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed glutamatergic components;
[00133] Figure 9G is a representative trace showing that spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed GABAergic components; [00134] Figure 10A is an image of NeuroDl-GFP fluorescence in clear dendritic spines (arrows) observed in 2-month old NeuroDl -converted neurons after viral injection;
[00135] Figure 10B is a representative trace showing large spontaneous synaptic events recorded from 2-month old NeuroDl -converted neurons in cortical slice recordings;
[00136] Figure IOC is a representative trace showing an expanded view of the synaptic events shown in Figure 10B;
[00137] Figure 11A shows representative images of BrdU immunostaining at 4 days post- injury, left panel, along with DCX immunostaining of the same field, middle panel, and the overlap of BrdU immunostaining and DCX immunostaining of the same field, right panel;
[00138] Figure 11B shows representative images of BrdU immunostaining at 1 month post- injury, left panel, along with NeuN immunostaining of the same field, middle panel, and the overlap of BrdU immunostaining and NeuN immunostaining of the same field, right panel;
[00139] Figure 12A shows representative images of immunostaining showing changes of GFAP (astrocyte), NG2 (NG2 cell), and Ibal (microglia) signal before (DO) and up to one month after brain stab injury;
[00140] Figure 12B shows representative images of TUNEL staining;
[00141] Figure 12C shows representative images indicating a significant decrease of astrocytic glutamate transporter Gltl and axon fibers;
[00142] Figure 12D shows bar graphs showing the quantified data of the immunostaining signal before and after brain injury;
[00143] Figure 13A includes images of GFP fluorescence, NeuroDl -GFP fluorescence, Cx43 immunostaining, and the overlap of GFP or NeuroDl-GFP and Cx43 immunostaining;
[00144] Figure 13A further includes a graph showing that astrocytic gap junctions (Cx43) decreased in NeuroDl -infected regions compared to the control GFP retrovirus -infected areas;
[00145] Figure 13B includes images of GFP fluorescence, NeuroDl-GFP fluorescence,
TUNEL staining, and the overlap of GFP or NeuroDl-GFP and TUNEL staining;
[00146] Figure 13B further includes a graph showing that TUNEL staining showed reduced cell death in the regions containing NeuroDl -converted neurons;
[00147] Figure 13C includes images of GFP fluorescence, NeuroDl-GFP fluorescence, VEGF immunostaining, and the overlap of GFP or NeuroDl-GFP and VEGF immunostaining;
[00148] Figure 13C further includes a graph showing that angiogenesis marker VEGF was significantly increased in the regions containing NeuroDl -converted neurons; [00149] Figure 13D shows representative images illustrating that in regions containing NeuroDl -converted neurons, astrocytes were closely contacting blood vessels;
[00150] Figure 13E shows representative images illustrating that in regions containing NeuroDl -converted neurons;
[00151] Figure 13E shows SMI312 immunostaining, MBP immunostaining and the overlap of SMI312 immunostaining and MBP immunostaining;
[00152] Figure 14A shows representative images of dialysis of sulforhodamine B into 1 day old NeuroDl -converted neuron;
[00153] Figure 14B shows representative images of NeuroDl -induced conversion of astrocytes into neurons;
[00154] Figure 14C is a graph showing quantitation of these results;
[00155] Figure 15 A shows representative images indicating that cells infected with a retrovirus encoding NeuroDl and GFP (14 DPI) were positive for NeuN in 7-month old WT mice;
[00156] Figure 15A shows NeuroDl -GFP fluorescence, NeuN immunostaining and the overlap of NeuroDl -GFP fluorescence and NeuN immunostaining in the same field;
[00157] Figure 15B shows representative images indicating that NeuroDl -converted neurons (16 DPI) showed robust dendrites in 14 month old animals;
[00158] Figure 15C shows NeuroDl-GFP fluorescencel, Αβ42 immunostaining and the overlap of NeuroDl -GFP fluorescence and Αβ42 immunostaining in the same field;
[00159] Figure 16 shows NeuroDl -GFP fluorescence, Musashi immunostaining and the overlap of NeuroDl -GFP fluorescence and Musashi immunostaining in the same field;
[00160] Figures 17A and 17B are representative images showing glutamate immunostaining in mouse cultured neurons;
[00161] Figures 17C and 17D are representative images showing GABA immunostaining in mouse cultured neurons;
[00162] Figures 17E and 17F are representative images showing Tbrl immunostaining in mouse cultured neurons;
[00163] Figure 18A shows representative images indicating that the majority of cells in human astrocyte cultures were immunopositive for astrocyte marker SIOOP;
[00164] Figure 18B shows representative images indicating that NeuroDl-GFP infected human astrocytes became immunopositive for NeuN; [00165] Figure 18C shows representative images indicating that NeuroDl -converted neurons generated by infection of human astrocytes with a retrovirus encoding NeuroDl were positive for Proxl ;
[00166] Figure 18D shows representative images indicating that the majority of cells in human microglia cultures were positive for Ibal ;
[00167] Figures 18E and 18F are representative images showing that human microglia could not be converted into neurons by NeuroDl ;
[00168] Figure 18G is a graph showing quantitation of cultured human astrocytes immunopositive for SIOOP;
[00169] Figure 18H is a graph showing quantitation of cultured human microglia immunopositive for GFAP, Ibal;
[00170] Figure 19A shows representative images obtained after injecting hNG2 :: NeuroDl - IRES-GFP retrovirus into one month old mouse cortex; and
[00171] Figure 19B shows representative images obtained after infecting cultured NG2 cells with hNG2::NeuroDl-IRES-GFP retrovirus.
DETAILED DESCRIPTION OF THE INVENTION
[00172] Unexpectedly, a single transcription factor, NeuroDl, converts astrocytes, reactive astrocytes, NG2 cells and reactive NG2 cells into functional neurons, as disclosed herein. NeuroDl converts astrocytes and reactive astrocytes into functional glutamatergic neurons and converts NG2 cells and reactive NG2 cells predominantly into functional GABAergic neurons, along with a few functional glutamatergic neurons.
[00173] Conversion of astrocytes, reactive astrocytes, NG2 cells and/or reactive NG2 cells to neurons in vitro, ex vivo and/or in vivo may be used to treat neurodegenerative disease and injury, replacing degenerated neurons and restoring neural function.
[00174] Provided by the present invention are methods for direct conversion of reactive glial cells into functional neurons by a single transcription factor, NeuroDl, to treat injury and/or disease of the nervous system.
[00175] Expression of NeuroDl in astrocytes and/or NG2 cells converts the astrocytes and NG2 cells into functional neurons and has several significant consequences on brain injury: 1) reduces the number of reactive glial cells in the injury site; 2) generates new functional neurons to connect with existing neurons; 3) axon fibers increase in the injury site; 4) blood vessels increase after conversion of astrocytes and NG2 cells into functional neurons; 5) cell death decreases after conversion of astrocytes and NG2 cells into functional neurons. Therefore, the entire landscape of the injury site is changed into a more neuro-permissive environment, which will be a critical step toward functional recovery.
[00176] NeuroDl -mediated direct conversion of glial cells into functional neurons not only occurs in young adult animals, but also in very old animals and even old animals with Alzheimer's disease, making it possible for brain repair in the adult brain. Moreover, reactive glial cells in an accepted model of Alzheimer' s disease are converted into functional neurons by the exogenous expression of a single transcription factor, NeuroDl, and such conversion was accompanied with reduced amyloid β peptide deposits.
[00177] Conversion of astrocytes, reactive astrocytes, NG2 cells and reactive NG2 cells into functional neurons by expression of exogenous NeuroDl alone, called NeuroDl converted neurons herein, represent the first in vitro and in vivo direct conversion of these cells to functional neurons. The NeuroDl converted neurons are characterized by long-term stability of the neuronal phenotype.
[00178] Methods for producing new neurons in the brain in vivo are provided according to aspects of the present invention which include introducing NeuroDl into a glial cell, particularly into an astrocyte, reactive astrocyte, NG2 cell or reactive NG2 cell, thereby "converting" the glial cell to a neuron, a "NeuroDl converted neuron."
[00179] Methods and compositions of the present invention have various uses, including for example, production of neurons in situ to treat a neurological condition of a subject.
[00180] Advantageously, in situ replacement of injured neuronal cells by conversion of endogenous reactive astrocytes into neurons eliminates the possibility of immunorejection such as can occur when a tissue/cell transplant is performed to replace damaged neuronal cells.
[00181] After brain/spinal cord injury or neurological disorders, glial cells such as astrocytes often over proliferate. Changing surplus glial cells into neurons will reduce the number of reactive glial cells, and in the mean while replenish lost neurons for internal brain repair.
[00182] Methods of producing a neuronal phenotype from a glial cell, such as an NG2 cell, reactive NG2 cell, astrocyte and/or reactive astrocyte, are provided according to aspects of the present invention which include expressing exogenous NeuroDl in the glial cell. [00183] The glial cell, such as an NG2 cell, reactive NG2 cell, astrocyte and/or reactive astrocyte, is in vitro, ex vivo or in vivo. Glial cells expressing exogenous NeuroDl may be transferred to a site of nervous system injury or disease to treat a subject in need thereof.
[00184] The glial cell, such as an NG2 cell, reactive NG2 cell, astrocyte and/or reactive astrocyte, may be human or non-human mammalian, but can be non-mammalian as well.
[00185] Scientific and technical terms used herein are intended to have the meanings commonly understood by those of ordinary skill in the art. Such terms are found defined and used in context in various standard references illustratively including J. Sambrook and D.W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; F.M. Asubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed., 2002; B. Alberts et al., Molecular Biology of the Cell, 4th Ed., Garland, 2002; D.L. Nelson and M.M. Cox, Lehninger Principles of Biochemistry, 4th Ed., W.H. Freeman & Company, 2004; Engelke, D.R., RNA Interference (RNAi): Nuts and Bolts of RNAi Technology, DNA Press LLC, Eagleville, PA, 2003; Herdewijn, p. (Ed.), Oligonucleotide Synthesis: Methods and Applications, Methods in Molecular Biology, Humana Press, 2004; A. Nagy, M. Gertsenstein, K. Vintersten, R. Behringer, Manipulating the Mouse Embryo: A Laboratory Manual, Cold Spring Harbor Laboratory Press,3rd Ed.; December 15, 2002,ISBN-10:0879695919; Kursad Turksen (Ed.), Embryonic Stem Cells: Methods and Protocols in Methods in Molecular Biology, 2002; 185, Human Press: Current Protocols in Stem Cell Biology, ISBN:9780470151808.
[00186] The singular terms "a," "an," and "the" are not intended to be limiting and include plural referents unless explicitly stated otherwise or the context clearly indicates otherwise.
[00187] The term "NeuroDl protein" refers to a bHLH proneural transcription factor involved in embryonic brain development and in adult neurogenesis, see Cho, J.H. et al., Mol, Neurobiol., 30:35-47, 2004; Kuwabara, T. et al., Nature Neurosci., 12: 1097-1105, 2009; and Gao, Z. et al., Nature Neurosci., 12: 1090-1092, 2009. NeuroDl is expressed late in development, mainly in the nervous system and is involved in neuronal differentiation, maturation and survival.
[00188] The term "NeuroDl protein" encompasses human NeuroDl protein, identified here as SEQ ID NO: 2 and mouse NeuroDl protein, identified here as SEQ ID NO: 4. In addition to the NeuroDl protein of SEQ ID NO: 2 and SEQ ID NO: 4, the term "NeuroDl protein" encompasses variants of NeuroDl protein, such as variants of SEQ ID NO: 2 and SEQ ID NO: 4, which may be included in methods of the present invention. As used herein, the term "variant" refers to naturally occurring genetic variations and recombinantly prepared variations, each of which contain one or more changes in its amino acid sequence compared to a reference NeuroDl protein, such as SEQ ID NO: 2 or SEQ ID NO: 4. Such changes include those in which one or more amino acid residues have been modified by amino acid substitution, addition or deletion. The term "variant" encompasses orthologs of human NeuroDl, including for example mammalian and bird NeuroDl, such as, but not limited to NeuroDl orthologs from a non-human primate, cat, dog, sheep, goat, horse, cow, pig, bird, poultry animal and rodent such as but not limited to mouse and rat. In a non-limiting example, mouse NeuroDl, exemplified herein as amino acid sequence SEQ ID NO: 4 is an ortholog of human NeuroDl.
[00189] Preferred variants have at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 2 or SEQ ID NO: 4.
[00190] Mutations can be introduced using standard molecular biology techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. One of skill in the art will recognize that one or more amino acid mutations can be introduced without altering the functional properties of the NeuroDl protein. For example, one or more amino acid substitutions, additions, or deletions can be made without altering the functional properties of the NeuroDl protein of SEQ ID NO: 2 or 4.
[00191] Conservative amino acid substitutions can be made in a NeuroDl protein to produce a NeuroDl protein variant. Conservative amino acid substitutions are art recognized substitutions of one amino acid for another amino acid having similar characteristics. For example, each amino acid may be described as having one or more of the following characteristics: electropositive, electronegative, aliphatic, aromatic, polar, hydrophobic and hydrophilic. A conservative substitution is a substitution of one amino acid having a specified structural or functional characteristic for another amino acid having the same characteristic. Acidic amino acids include aspartate, glutamate; basic amino acids include histidine, lysine, arginine; aliphatic amino acids include isoleucine, leucine and valine; aromatic amino acids include phenylalanine, glycine, tyrosine and tryptophan; polar amino acids include aspartate, glutamate, histidine, lysine, asparagine, glutamine, arginine, serine, threonine and tyrosine; and hydrophobic amino acids include alanine, cysteine, phenylalanine, glycine, isoleucine, leucine, methionine, proline, valine and tryptophan; and conservative substitutions include substitution among amino acids within each group. Amino acids may also be described in terms of relative size, alanine, cysteine, aspartate, glycine, asparagine, proline, threonine, serine, valine, all typically considered to be small. [00192] NeuroDl variants can include synthetic amino acid analogs, amino acid derivatives and/or non-standard amino acids, illustratively including, without limitation, alpha-aminobutyric acid, citrulline, canavanine, cyanoalanine, diaminobutyric acid, diaminopimelic acid, dihydroxy- phenylalanine, djenkolic acid, homoarginine, hydroxyproline, norleucine, norvaline, 3- phosphoserine, homoserine, 5-hydroxytryptophan, 1-methylhistidine, 3-methylhistidine, and ornithine.
[00193] To determine the percent identity of two amino acid sequences or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino acid or nucleic acid sequence). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., % identity=number of identical overlapping positions/total number of positions X 100%). In one embodiment, the two sequences are the same length.
[00194] The determination of percent identity between two sequences can also be accomplished using a mathematical algorithm. A preferred, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, 1990, PNAS 87:2264 2268, modified as in Karlin and Altschul, 1993, PNAS. 90:5873 5877. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al., 1990, J. Mol. Biol. 215:403. BLAST nucleotide searches are performed with the NBLAST nucleotide program parameters set, e.g., for score=100, wordlength=12 to obtain nucleotide sequences homologous to a nucleic acid molecules of the present invention. BLAST protein searches are performed with the XBLAST program parameters set, e.g., to score 50, wordlength=3 to obtain amino acid sequences homologous to a protein molecule of the present invention. To obtain gapped alignments for comparison purposes, Gapped BLAST are utilized as described in Altschul et al., 1997, Nucleic Acids Res. 25:3389 3402. Alternatively, PSI BLAST is used to perform an iterated search which detects distant relationships between molecules (Id.). When utilizing BLAST, Gapped BLAST, and PSI Blast programs, the default parameters of the respective programs (e.g., of XBLAST and NBLAST) are used (see, e.g., the NCBI website). Another preferred, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, 1988, CABIOS 4:11 17. Such an algorithm is incorporated in the ALIGN program (version 2.0) which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 is used.
[00195] The percent identity between two sequences is determined using techniques similar to those described above, with or without allowing gaps. In calculating percent identity, typically only exact matches are counted.
[00196] The term "NeuroDl protein" encompasses fragments of the NeuroDl protein, such as fragments of SEQ ID NOs. 2 and 4 and variants thereof, operable in methods and compositions of the present invention.
[00197] NeuroDl proteins and nucleic acids may be isolated from natural sources, such as the brain of an organism or cells of a cell line which expresses NeuroDl. Alternatively, NeuroDl protein or nucleic acid may be generated recombinantly, such as by expression using an expression construct, in vitro or in vivo. NeuroDl proteins and nucleic acids may also be synthesized by well-known methods.
[00198] NeuroDl included in methods and compositions of the present invention is preferably produced using recombinant nucleic acid technology. Recombinant NeuroDl production includes introducing a recombinant expression vector encompassing a DNA sequence encoding NeuroDl into a host cell.
[00199] A nucleic acid sequence encoding NeuroDl introduced into a host cell to produce NeuroDl according to embodiments of the invention encodes SEQ ID NO: 2, SEQ ID NO: 4, or a variant thereof.
[00200] According to aspects of the present invention, the nucleic acid sequence identified herein as SEQ ID NO: 1 encodes SEQ ID NO: 2 and is included in an expression vector and expressed to produce NeuroDl. According to aspects of the present invention, the nucleic acid sequence identified herein as SEQ ID NO: 3 encodes SEQ ID NO: 4 and is included in an expression vector and expressed to produce NeuroDl.
[00201] It is appreciated that due to the degenerate nature of the genetic code, nucleic acid sequences substantially identical to SEQ ID NOs. 1 and 3 encode NeuroDl and variants of NeuroDl, and that such alternate nucleic acids may be included in an expression vector and expressed to produce NeuroDl and variants of NeuroDl. One of skill in the art will appreciate that a fragment of a nucleic acid encoding NeuroDl protein can be used to produce a fragment of a NeuroDl protein.
[00202] The term "expression vector" refers to a recombinant vehicle for introducing a nucleic acid encoding NeuroDl into a host cell in vitro or in vivo where the nucleic acid is expressed to produce NeuroDl. In particular embodiments, an expression vector including SEQ ID NO: 1 or 3 or a substantially identical nucleic acid sequence is expressed to produce NeuroDl in cells containing the expression vector. The term "recombinant" is used to indicate a nucleic acid construct in which two or more nucleic acids are linked and which are not found linked in nature. Expression vectors include, but are not limited to plasmids, viruses, BACs and YACs. Particular viral expression vectors illustratively include those derived from adenovirus, adeno-associated virus, retrovirus, and lenti virus.
[00203] An expression vector contains a nucleic acid that includes segment encoding a polypeptide of interest operably linked to one or more regulatory elements that provide for transcription of the segment encoding the polypeptide of interest. The term "operably linked" as used herein refers to a nucleic acid in functional relationship with a second nucleic acid. The term "operably linked" encompasses functional connection of two or more nucleic acid molecules, such as a nucleic acid to be transcribed and a regulatory element. The term "regulatory element" as used herein refers to a nucleotide sequence which controls some aspect of the expression of an operably linked nucleic acid. Exemplary regulatory elements include an enhancer, such as, but not limited to: woodchuck hepatitis virus posttranscriptional regulatory element (WPRE); an internal ribosome entry site (IRES) or a 2 A domain; an intron; an origin of replication; a polyadenylation signal (pA); a promoter; a transcription termination sequence; and an upstream regulatory domain, which contribute to the replication, transcription, posttranscriptional processing of an operably linked nucleic acid sequence. Those of ordinary skill in the art are capable of selecting and using these and other regulatory elements in an expression vector with no more than routine experimentation.
[00204] The term "promoter" as used herein refers to a DNA sequence operably linked to a nucleic acid sequence to be transcribed such as a nucleic acid sequence encoding NeuroDl. A promoter is generally positioned upstream of a nucleic acid sequence to be transcribed and provides a site for specific binding by RNA polymerase and other transcription factors. In specific embodiments, a promoter is generally positioned upstream of the nucleic acid sequence transcribed to produce the desired molecule, and provides a site for specific binding by RNA polymerase and other transcription factors.
[00205] As will be recognized by the skilled artisan, the 5 ' non-coding region of a gene can be isolated and used in its entirety as a promoter to drive expression of an operably linked nucleic acid. Alternatively, a portion of the 5' non-coding region can be isolated and used to drive expression of an operably linked nucleic acid. In general, about 500-6000 bp of the 5' non- coding region of a gene is used to drive expression of the operably linked nucleic acid. Optionally, a portion of the 5' non-coding region of a gene containing a minimal amount of the 5' non-coding region needed to drive expression of the operably linked nucleic acid is used. Assays to determine the ability of a designated portion of the 5' non-coding region of a gene to drive expression of the operably linked nucleic acid are well-known in the art.
[00206] Particular promoters used to drive expression of NeuroDl according to methods described herein are "ubiquitous" or "constitutive" promoters, that drive expression in many, most, or all cell types of an organism into which the expression vector is transferred. Non- limiting examples of ubiquitous promoters that can be used in expression of NeuroDl are cytomegalovirus promoter, simian virus 40 (SV40) early promoter, rous sarcoma virus promoter, adenovirus major late promoter, beta actin promoter , glyceraldehyde 3-phosphate dehydrogenase, glucose-regulated protein 78 promoter, glucose-regulated protein 94 promoter, heat shock protein 70 promoter, beta-kinesin promoter, ROSA promoter, ubiquitin B promoter, eukaryotic initiation factor 4A1 promoter and elongation Factor I promoter, all of which are well-known in the art and which can be isolated from primary sources using routine methodology or obtained from commercial sources.
[00207] Promoters can be derived entirely from a single gene or can be chimeric, having portions derived from more than one gene.
[00208] Combinations of regulatory sequences may be included in an expression vector and used to drive expression of NeuroDl. A non-limiting example included in an expression vector to drive expression of NeuroDl is the CAG promoter which combines the cytomegalovirus CMV early enhancer element and chicken beta- actin promoter.
[00209] Particular promoters used to drive expression of NeuroDl according to methods described herein are those that drive expression preferentially in glial cells, particularly astrocytes and/or NG2 cells. Such promoters are termed "astrocyte-specific" and/or "NG2 cell- specific" promoters. [00210] Non-limiting examples of astrocyte-specific promoters are glial fibrillary acidic protein (GFAP) promoter and aldehyde dehydrogenase 1 family, member LI (AldhlLl) promoter.
[00211] Human GFAP promoter is shown herein as SEQ ID NO:6. Mouse AldhlLl promoter is shown herein as SEQ ID NO:7.
[00212] A non-limiting example of an NG2 cell-specific promoter is the promoter of the chondroitin sulfate proteoglycan 4 gene, also known as neuron-glial antigen 2 (NG2). Human NG2 promoter is shown herein as SEQ ID NO:8.
[00213] Particular promoters used to drive expression of NeuroDl according to methods described herein are those that drive expression preferentially in reactive glial cells, particularly reactive astrocytes and/or reactive NG2 cells. Such promoters are termed "reactive astrocyte- specific" and/or "reactive NG2 cell-specific" promoters.
[00214] A non-limiting example of a "reactive astrocyte-specific" promoter is the promoter of the lipocalin 2 (lcn2) gene. Mouse lcn2 promoter is shown herein as SEQ ID NO:5.
[00215] Homologues and variants of ubiquitous and cell type-specific promoters may be used in expressing NeuroDl.
[00216] Promoter homologues and promoter variants can be included in an expression vector for expressing NeuroDl according to the present invention. The terms "promoter homologue" and "promoter variant" refer to a promoter which has substantially similar functional properties to confer the desired type of expression, such as cell type-specific expression of NeuroDl or ubiquitous expression of NeuroDl, on an operably linked nucleic acid encoding NeuroDl compared to those disclosed herein. For example, a promoter homologue or variant has substantially similar functional properties to confer cell type-specific expression on an operably linked nucleic acid encoding NeuroDl compared to GFAP, AldhlLl, NG2, lcn2 and CAG promoters.
[00217] One of skill in the art will recognize that one or more nucleic acid mutations can be introduced without altering the functional properties of a given promoter. Mutations can be introduced using standard molecular biology techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis, to produce promoter variants. As used herein, the term "promoter variant" refers to either an isolated naturally occurring or a recombinantly prepared variation of a reference promoter, such as, but not limited to, GFAP, AldhlLl, NG2, lcn2 and pCAG promoters. [00218] It is known in the art that promoters from other species are functional, e.g. the mouse AldhlLlpromoter is functional in human cells. Homologues and homologous promoters from other species can be identified using bioinformatics tools known in the art, see for example, Xuan et al., 2005, Genome Biol 6:R72; Zhao et al., 2005, Nucl Acid Res 33:D103-107; and Halees et al. 2003, Nucl. Acids. Res. 2003 31 : 3554-3559.
[00219] Structurally, homologues and variants of cell type-specific expression of NeuroDl or and/or ubiquitous promoters have at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, nucleic acid sequence identity to the reference developmentally regulated and/or ubiquitous promoter and include a site for binding of RNA polymerase and, optionally, one or more binding sites for transcription factors.
[00220] A nucleic acid sequence which is substantially identical to SEQ ID NO: 1 or 3 is characterized as having a complementary nucleic acid sequence capable of hybridizing to SEQ ID NO: 1 or 3 under high stringency hybridization conditions.
[00221] In addition to one or more nucleic acids encoding NeuroDl, one or more nucleic acid sequences encoding additional proteins can be included in an expression vector. For example, such additional proteins include non-NeuroDl proteins such as reporters, including, but not limited to, beta-galactosidase, green fluorescent protein and antibiotic resistance reporters.
[00222] In particular embodiments, the recombinant expression vector encodes at least NeuroDl of SEQ ID NO: 2, a protein having at least 95% identity to SEQ ID NO: 2, or a protein encoded by a nucleic acid sequence substantially identical to SEQ ID NO: 1.
[00223] In particular embodiments, the recombinant expression vector encodes at least NeuroDl of SEQ ID NO: 4, a protein having at least 95% identity to SEQ ID NO: 4, or a protein encoded by a nucleic acid sequence substantially identical to SEQ ID NO: 2.
[00224] SEQ ID NO: 9 is an example of a nucleic acid including CAG promoter operably linked to a nucleic acid encoding NeuroDl, and further including a nucleic acid sequence encoding EGFP and an enhancer, WPRE. An IRES separates the nucleic acid encoding NeuroDl and the nucleic acid encoding EGFP. SEQ ID NO:9 is inserted into an expression vector for expression of NeuroDl and the reporter gene EGFP. Optionally, the IRES and nucleic acid encoding EGFP are removed and the remaining CAG promoter and operably linked nucleic acid encoding NeuroDl is inserted into an expression vector for expression of NeuroDl. The WPRE or another enhancer is optionally included. [00225] Optionally, a reporter gene is included in a recombinant expression vector encoding NeuroDl. A reporter gene may be included to produce a peptide or protein that serves as a surrogate marker for expression of NeuroDl from the recombinant expression vector. The term "reporter gene" as used herein refers to gene that is easily detectable when expressed, for example by chemiluminescence, fluorescence, colorimetric reactions, antibody binding, inducible markers and/or ligand binding assays. Exemplary reporter genes include, but are not limited to, green fluorescent protein (GFP), enhanced green fluorescent protein (eGFP), yellow fluorescent protein (YFP), enhanced yellow fluorescent protein (eYFP), cyan fluorescent protein (CFP), enhanced cyan fluorescent protein (eCFP), blue fluorescent protein (BFP), enhanced blue fluorescent protein (eBFP), MmGFP (Zernicka-Goetz et al., Development, 124: 1133-1137, 1997, dsRed, luciferase and beta-galactosidase (lacZ).
[00226] The process of introducing genetic material into a recipient host cell, such as for transient or stable expression of a desired protein encoded by the genetic material in the host cell is referred to as "transfection." Transfection techniques are well-known in the art and include, but are not limited to, electroporation, particle accelerated transformation also known as "gene gun" technology, liposome-mediated transfection, calcium phosphate or calcium chloride co- precipitation-mediated transfection, DEAE-dextran-mediated transfection, microinjection, polyethylene glycol mediated transfection, heat shock mediated transfection and virus -mediated transfection. As noted herein, virus-mediated transfection may be accomplished using a viral vector such as those derived from adenovirus, adeno-associated virus and lenti virus.
[00227] Optionally, a host cell is transfected ex-vivo and then re-introduced into a host organism. For example, cells or tissues may be removed from a subject, transfected with an expression vector encoding NeuroDl and then returned to the subject.
[00228] Introduction of a recombinant expression vector including a nucleic acid encoding NeuroDl. or a functional fragment thereof, into a host glial cell in vitro or in vivo for expression of exogenous NeuroDl in the host glial cell to convert the glial cell to a neuron is accomplished by any of various transfection methodologies.
[00229] Expression of exogenous NeuroDl in the host glial cell to convert the glial cell to a neuron is optionally achieved by introduction of mRNA encoding NeuroDl, or a functional fragment thereof, to the host glial cell in vitro or in vivo. [00230] Expression of exogenous NeuroDl in the host glial cell to convert the glial cell to a neuron is optionally achieved by introduction of NeuroDl protein to the host glial cell in vitro or in vivo.
[00231] Details of these and other techniques are known in the art, for example, as described in J. Sambrook and D.W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; F.M. Ausubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed., 2002; and Engelke, D.R., RNA Interference (RNAi): Nuts and Bolts of RNAi Technology, DNA Press LLC, Eagleville, PA, 2003.
[00232] An expression vector including a nucleic acid encoding NeuroDl or a functional fragment thereof, mRNA encoding NeuroDl or a functional fragment thereof, and/or NeuroDl protein, full-length or a functional fragment thereof, is optionally associated with a carrier for introduction into a host cell in- vitro or in- vivo.
[00233] In particular aspects, the carrier is a particulate carrier such as lipid particles including liposomes, micelles, unilamellar or mulitlamellar vesicles; polymer particles such as hydrogel particles, polyglycolic acid particles or polylactic acid particles; inorganic particles such as calcium phosphate particles such as described in for example U.S. Patent No. 5,648,097; and inorganic/organic particulate carriers such as described for example in U.S. Patent No. 6,630,486.
[00234] A particulate carrier can be selected from among a lipid particle; a polymer particle; an inorganic particle; and an inorganic/organic particle. A mixture of particle types can also be included as a particulate pharmaceutically acceptable carrier.
[00235] A particulate carrier is typically formulated such that particles have an average particle size in the range of about 1 nm - 10 microns. In particular aspects, a particulate carrier is formulated such that particles have an average particle size in the range of about 1 nm - 100 nm.
[00236] Further description of liposomes and methods relating to their preparation and use may be found in Liposomes: A Practical Approach (The Practical Approach Series, 264), V. P. Torchilin and V. Weissig (Eds.), Oxford University Press; 2nd ed., 2003. Further aspects of nanoparticles are described in S.M. Moghimi et al., FASEB J. 2005, 19, 311-30.
[00237] Expression of NeuroDl using a recombinant expression vector is accomplished by introduction of the expression vector into a eukaryotic or prokaryotic host cell expression system such as an insect cell, mammalian cell, yeast cell, bacterial cell or any other single or multicellular organism recognized in the art. Host cells are optionally primary cells or immortalized derivative cells. Immortalized cells are those which can be maintained in- vitro for at least 5 replication passages.
[00238] Host cells containing the recombinant expression vector are maintained under conditions wherein NeuroDl is produced. Host cells may be cultured and maintained using known cell culture techniques such as described in Celis, Julio, ed., 1994, Cell Biology Laboratory Handbook, Academic Press, N.Y. Various culturing conditions for these cells, including media formulations with regard to specific nutrients, oxygen, tension, carbon dioxide and reduced serum levels, can be selected and optimized by one of skill in the art.
[00239] According to aspects of the present invention, a recombinant expression vector including a nucleic acid encoding NeuroDl is introduced into glial cells of a subject. Expression of exogenous NeuroDl in the glial cells "converts" the glial cells into neurons.
[00240] According to aspects of the present invention, a recombinant expression vector including a nucleic acid encoding NeuroDl or a functional fragment thereof is introduced into astrocytes of a subject. Expression of exogenous NeuroDl in the glial cells "converts" the astrocytes into neurons.
[00241] According to aspects of the present invention, a recombinant expression vector including a nucleic acid encoding NeuroDl or a functional fragment thereof is introduced into reactive astrocytes of a subject. Expression of exogenous NeuroDl or a functional fragment thereof in the reactive astrocytes "converts" the reactive astrocytes into neurons.
[00242] According to aspects of the present invention, a recombinant expression vector including a nucleic acid encoding NeuroDl or a functional fragment thereof is introduced into NG2 cells of a subject. Expression of exogenous NeuroDl or a functional fragment thereof in the NG2 cells "converts" the NG2 cells into neurons.
[00243] Detection of expression of exogenous NeuroDl following introduction of a recombinant expression vector including a nucleic acid encoding the exogenous NeuroDl or a functional fragment thereof is accomplished using any of various standard methodologies including, but not limited to, immunoassays to detect NeuroDl, nucleic acid assays to detect NeuroDl nucleic acids and detection of a reporter gene co-expressed with the exogenous NeuroDl.
[00244] The terms "converts" and "converted" are used herein to describe the effect of expression of NeuroDl or a functional fragment thereof resulting in a change of a glial cell, astrocyte or reactive astrocyte phenotype to a neuronal phenotype. Similarly, the phrases "NeuroDl converted neurons" and "converted neurons" are used herein to designate a cell including exogenous NeuroDl protein or a functional fragment thereof which has consequent neuronal phenotype.
[00245] The term "phenotype" refers to well-known detectable characteristics of the cells referred to herein. The neuronal phenotype can be, but is not limited to, one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiological characteristics of neurons, synapse formation and release of neurotransmitter. For example, neuronal phenotype encompasses but is not limited to: characteristic morphological aspects of a neuron such as presence of dendrites, an axon and dendritic spines; characteristic neuronal protein expression and distribution, such as presence of synaptic proteins in synaptic puncta, presence of MAP2 in dendrites; and characteristic electrophysiological signs such as spontaneous and evoked synaptic events.
[00246] In a further example, glial phenotype such as astrocyte phenotype and reactive astrocyte phenotypes encompasses but is not limited to: characteristic morphological aspects of astrocytes and reactive astrocytes such as a generally "star-shaped" morphology; and characteristic astrocyte and reactive astrocyte protein expression, such as presence of glial fibrillary acidic protein (GFAP).
[00247] The term "NeuroDl nucleic acid" refers to an isolated NeuroDl nucleic acid molecule.
[00248] The term "nucleic acid" refers to RNA or DNA molecules having more than one nucleotide in any form including single- stranded, double-stranded, oligonucleotide or polynucleotide. The term "nucleotide sequence" refers to the ordering of nucleotides in an oligonucleotide or polynucleotide in a single- stranded form of nucleic acid.
[00249] The term "NeuroDl nucleic acid" encompasses isolated NeuroDl nucleic acids having a sequence that has at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the DNA sequence set forth in SEQ ID NO: 1 or SEQ ID NO: 3, or the complement thereof, or a fragment thereof, or an isolated DNA molecule having a sequence that hybridizes under high stringency hybridization conditions to the nucleic acid set forth as SEQ ID NO: 1 or SEQ ID NO: 3, a complement thereof or a fragment thereof. The nucleic acid of SEQ ID NO: 3 is an example of an isolated DNA molecule having a sequence that hybridizes under high stringency hybridization conditions to the nucleic acid set forth in SEQ ID NO: 1. A fragment of a NeuroDl nucleic acid is any fragment of a NeuroDl nucleic acid that is operable in aspects of the present invention including a NeuroDl nucleic acid.
[00250] A nucleic acid probe or primer able to hybridize to a target NeuroDl mRNA or cDNA can be used for detecting and/or quantifying mRNA or cDNA encoding NeuroDl protein. A nucleic acid probe can be an oligonucleotide of at least 10, 15, 30, 50 or 100 nucleotides in length and sufficient to specifically hybridize under stringent conditions to NeuroDl mRNA or cDNA or complementary sequence thereof. A nucleic acid primer can be an oligonucleotide of at least 10, 15 or 20 nucleotides in length and sufficient to specifically hybridize under stringent conditions to the mRNA or cDNA, or complementary sequence thereof.
[00251] The terms "complement" and "complementary" refers to Watson-Crick base pairing between nucleotides and specifically refers to nucleotides hydrogen bonded to one another with thymine or uracil residues linked to adenine residues by two hydrogen bonds and cytosine and guanine residues linked by three hydrogen bonds. In general, a nucleic acid includes a nucleotide sequence described as having a "percent complementarity" to a specified second nucleotide sequence. For example, a nucleotide sequence may have 80%, 90%, or 100% complementarity to a specified second nucleotide sequence, indicating that 8 of 10, 9 of 10 or 10 of 10 nucleotides of a sequence are complementary to the specified second nucleotide sequence. For instance, the nucleotide sequence 3'-TCGA-5' is 100% complementary to the nucleotide sequence 5'-AGCT-3'. Further, the nucleotide sequence 3'-TCGA- is 100% complementary to a region of the nucleotide sequence 5 ' -TTAGCTGG-3 ' .
[00252] The terms "hybridization" and "hybridizes" refer to pairing and binding of complementary nucleic acids. Hybridization occurs to varying extents between two nucleic acids depending on factors such as the degree of complementarity of the nucleic acids, the melting temperature, Tm, of the nucleic acids and the stringency of hybridization conditions, as is well known in the art. The term "stringency of hybridization conditions" refers to conditions of temperature, ionic strength, and composition of a hybridization medium with respect to particular common additives such as formamide and Denhardt's solution. Determination of particular hybridization conditions relating to a specified nucleic acid is routine and is well known in the art, for instance, as described in J. Sambrook and D.W. Russell, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; 3rd Ed., 2001; and F.M. Ausubel, Ed., Short Protocols in Molecular Biology, Current Protocols; 5th Ed., 2002. High stringency hybridization conditions are those which only allow hybridization of substantially complementary nucleic acids. Typically, nucleic acids having about 85-100% complementarity are considered highly complementary and hybridize under high stringency conditions. Intermediate stringency conditions are exemplified by conditions under which nucleic acids having intermediate complementarity, about 50-84% complementarity, as well as those having a high degree of complementarity, hybridize. In contrast, low stringency hybridization conditions are those in which nucleic acids having a low degree of complementarity hybridize.
[00253] The terms "specific hybridization" and "specifically hybridizes" refer to hybridization of a particular nucleic acid to a target nucleic acid without substantial hybridization to nucleic acids other than the target nucleic acid in a sample.
[00254] Stringency of hybridization and washing conditions depends on several factors, including the Tm of the probe and target and ionic strength of the hybridization and wash conditions, as is well-known to the skilled artisan. Hybridization and conditions to achieve a desired hybridization stringency are described, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, 2001; and Ausubel, F. et al., (Eds.), Short Protocols in Molecular Biology, Wiley, 2002.
[00255] An example of high stringency hybridization conditions is hybridization of nucleic acids over about 100 nucleotides in length in a solution containing 6X SSC, 5X Denhardt's solution, 30% formamide, and 100 micrograms/ml denatured salmon sperm at 37°C overnight followed by washing in a solution of 0.1X SSC and 0.1% SDS at 60°C for 15 minutes. SSC is 0.15M NaCl/0.015M Na citrate. Denhardt's solution is 0.02% bovine serum albumin/0.02% FICOLL/0.02% polyvinylpyrrolidone. Under highly stringent conditions, SEQ ID NO: 1 and SEQ ID NO: 3 will hybridize to the complement of substantially identical targets and not to unrelated sequences.
[00256] Methods of treating a neurological condition
[00257] Methods of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include delivering a therapeutically effective amount of NeuroDl to glial cells of the central nervous system or peripheral nervous system of the subject, the therapeutically effective amount of NeuroDl in the glial cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated. [00258] The conversion of reactive glial cells into neurons also reduces neuroinflammation and neuroinhibitory factors associated with reactive glial cells, thereby making the glial scar tissue more permissive to neuronal growth so that neurological condition is alleviated.
[00259] The term "neurological condition" as used herein refers to any condition of the central and/or peripheral nervous system of a subject which is alleviated, ameliorated or prevented by additional neurons. Injuries or diseases which result in loss or inhibition of neurons and/or loss or inhibition of neuronal function are neurological conditions for treatment by methods according to aspects of the present invention.
[00260] Injuries or diseases which result in loss or inhibition of glutamatergic neurons and/or loss or inhibition of glutaminergic neuronal functions are neurological conditions for treatment by methods according to aspects of the present invention. Loss or inhibition of other types of neurons, such as GABAergic, cholinergic, dopaminergic, norepinephrinergic, or seratonergic neurons can be treated with the similar method.
[00261] Thus, for example, injuries or diseases which result in loss or inhibition of neurons and/or loss or inhibition of neuronal functions including, but not limited to, Alzheimer's disease, Parkinson disease, Amyotrophic lateral sclerosis (ALS), stroke, epilepsy, physical injury such as brain or spinal cord injury, and tumor, are neurological conditions for treatment by methods according to aspects of the present invention.
[00262] The term "therapeutically effective amount" as used herein is intended to mean an amount of an inventive composition which is effective to alleviate, ameliorate or prevent a symptom or sign of a neurological condition to be treated. In particular embodiments, a therapeutically effective amount is an amount which has a beneficial effect in a subject having signs and/or symptoms of a neurological condition.
[00263] The terms "treat," "treatment," and "treating" as used herein refer to alleviating, inhibiting or ameliorating a neurological condition, symptoms or signs of a neurological condition, and preventing symptoms or signs of a neurological condition, and include, but are not limited to therapeutic and/or prophylactic treatments.
[00264] Signs and symptoms of neurological conditions are well-known in the art along with methods of detection and assessment of such signs and symptoms.
[00265] Method of treating a neurological condition in a subject in need thereof are provided according to aspects of the present invention which include providing a viral vector comprising a nucleic acid encoding NeuroDl; and delivering the viral vector to the central nervous system or peripheral nervous system of the subject, whereby the viral vector infects glial cells of the central nervous system or peripheral nervous system, respectively, producing infected glial cells and whereby exogenous NeuroDl is expressed in the infected glial cells at a therapeutically effective level, wherein the expression of NeuroDl in the infected cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated. In addition to the generation of new neurons, the number of reactive glial cells will also be reduced, resulting in less neuroinhibitory factors released, thereby making local environment more permissive to neuronal growth or axon penetration, hence alleviating neurological conditions.
[00266] Administration of a pharmaceutical composition to the central nervous system or peripheral nervous system of a subject is accomplished by methods including systemic or local administration.
[00267] According to aspects of the present invention, a viral vector comprising a nucleic acid encoding NeuroDl is delivered by injection into the central nervous system or peripheral nervous system of a subject, such as by intracerebral injection, spinal cord injection and/or injection into the cerebrospinal fluid. Alternative viral delivery methods include but not limited to intravenous injection and intraperitoneal injection.
[00268] Combinations of therapies for a neurological condition of a subject are administered according to aspects of the present invention.
[00269] The term "subject" refers to humans and also to non-human mammals such as, but not limited to, non-human primates, cats, dogs, sheep, goats, horses, cows, pigs and rodents, such as but not limited to, mice and rats; as well as to non-mammalian animals such as, but not limited to, birds, poultry, reptiles, amphibians.
[00270] Embodiments of inventive compositions and methods are illustrated in the following examples. These examples are provided for illustrative purposes and are not considered limitations on the scope of inventive compositions and methods.
EXAMPLES
[00271] Example 1
[00272] Mouse cortical astrocyte and NG2 culture
[00273] For astrocyte culture, postnatal (P3-P5) mouse cortical tissue was dissociated and plated onto 25 cm2 flasks. Cells were cultured for 5-6 days, and flasks were rigorously shaken daily to remove neurons and non-astrocytic cells. After reaching confluence, astrocytes were centrifuged for 5 min at 1,000 rpm, re-suspended, and plated on poly-D-lysine (Sigma) coated coverslips (12 mm). Astrocyte culture medium contained DMEM/F12 (Gibco), 10% fetal bovine serum (Gibco), penicillin/ streptomycin (Gibco), 3.5 mM glucose (Sigma), and supplemented with B27 (Gibco), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen).
[00274] For mouse NG2 culture, the cortical tissue of postnatal mice (P3-P5) was dissociated and plated in 25 cm2 flasks coated with poly-D-lysine (Sigma). The cells were maintained in DMEM/F12 (Gibco) with 10% fetal bovine serum (Gibco) for 9 days, with a medium change every 3 days. On the 9th day, the flasks were shaken rigorously and the supernatant was collected and centrifuged to harvest NG2 cells with a small number of neurons and microglia cells. After centrifuge, cells were resuspended and seeded on poly-D-lysine (Sigma) coated coverslips (12 mm). The cells were cultured in serum-free DMEM medium (Gibco) with N2 supplements (STEMCELL™) and 10 ng/ml platelet-derived growth factor (PDGF, Invitrogen), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen) for 3 days. Cells were maintained at 37°C in humidified air with 5% C02. Mouse neuronal culture was the same as described in Wu, X. et al., J. Biol. Chem., 287(33):27417- 27430, 2012.
[00275] Example 2
[00276] Human cortical astrocyte and microglia culture
[00277] Human cortical astrocytes (HA 1800) were purchased from ScienCell (California). Cells were subcultured when they were over 90% confluent. For subculture, cells were trypsinized by TrypLE™ Select (Invitrogen), centrifuged for 5 min at 1,000 rpm, re-suspended, and plated in a medium consisting of DMEM/F12 (Gibco), 10% fetal bovine serum (Gibco), penicillin/ streptomycin (Gibco), 3.5 mM glucose (Sigma), and supplemented with B27 (Gibco), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen). The astrocytes were cultured on poly-D-lysine (Sigma) coated coverslips (12 mm) at a density of 50,000 cells per coverslip in 24-well plates (BD Biosciences). Human primary microglial cells were obtained from Clonexpress, Inc. (Maryland). The cells were cultured in DMEM/F-12 (Gibco) supplemented with 5% FBS, 10 ng/ml of macrophage colony- stimulating factor (M-CSF, Invitrogen), 10 ng/mL epidermal growth factor (EGF, Invitrogen), and 10 ng/mL fibroblast growth factor 2 (FGF2, Invitrogen). Cells were maintained at 37°C in humidified air with 5% CO2.
[00278] Example 3
[00279] Retrovirus production
[00280] The mouse NeuroDl gene was subcloned from the pAd NeuroD-I-nGFP construct, described in Zhou, Q. et al., Nature 455(7213):627-632, 2008 (Addgene) and inserted into a pCAG-GFP-IRES-GFP retroviral vector described in Zhao, C. et al., J. Neurosci., 26(1):3- 11,2006 to generate pCAG-NeuroDl-IRES-GFP retroviral vector. The sequence of CAG- NeuroDl-IRES-GFP is shown herein as SEQ ID NO:9. A control retrovirus construct, pCAG- GFP, encodes GFP and not NeuroD 1.
[00281] The human GFAP promoter gene was subcloned from hGFAP Promo ter-Cre-MP-1 (Addgene) and replaced the CAG promoter to generate pGFAP-NeuroDl-IRES-GFP and pGFAP-GFP-IRES-GFP retroviral vectors.
[00282] The human NG2 promoter was subcloned and replaced the CAG promoter to generate hNG2-NeuroD 1 -IRES-GFP and hNG2- GFP-IRES - GFP retroviral vectors.
[00283] The mouse Lcn2 promoter was subcloned and replaced the CAG promoter to generate mLcn2-NeuroDl-IRES-GFP and mLcn2-GFP-IRES-GFP retroviral vectors. Reactive glial cells typically have high expression of Lcn2, an inflammation marker after injury.
[00284] The mouse AldhlLl promoter was subcloned and replaced the CAG promoter to generate m Aldh 1 L 1 -NeuroD 1 -IRES-GFP and m Aldh 1 L 1 - GFP-IRES - GFP retroviral vectors. Reactive glial cells typically have high expression of AldhlLl.
[00285] The nucleic acid encoding GFP is not included for expression of NeuroDl without GFP. Similarly, when only NeuroDl is to be expressed, the IRES need not be included in the construct.
[00286] Viral particles were packaged in gpg helperfree HEK (human embryonic kidney) cells to generate VSV-G (vesicular stomatitis virus glycoprotein)-pseudotyped retroviruses encoding neurogenic factors in CellMax™ hollow fiber cell culture system (Spectrum Laboratories). The titer of viral particles was about 108 particles/μΐ, determined after transduction of HEK cells.
[00287] Example 4
[00288] Trans-differentiation of glial cells into neurons [00289] Twenty-four hours after infection of astrocytes, NG2 cells, or microglia with GFP or NeuroDl retrovirus, the culture medium was completely replaced by a differentiation medium including DMEM/F12 (Gibco), 0.5% FBS (Gibco), 3.5 mM glucose (Sigma), penicillin/streptomycin (Gibco), and N2 supplement (Gibco). Brain-derived neurotrophic factor (BDNF, 20 ng/mL, Invitrogen) was added to the cultures every four days during the differentiation to promote synaptic maturation as described in Song, H. et al., Nature, 417(6884):39-44, 2002. Due to the morphological change from astrocytes or NG2 cells to neurons during conversion, the empty space was filled with additional human or mouse astrocytes to support the functional development of converted neurons.
[00290] Example 5
[00291] Gap junction assay
[00292] Sulforhodamine B (SRB, 558 Da, 2 mM) was added to the pipette solution for dye dialysis into cells. Whole-cell recordings were made on newly converted neurons infected by
NeuroDl-GFP (1-3 DPI), and dye dialysis was held for a 20-min period. The dye spreading was observed under 40x objective lens. To block gap junctions, carbenoxolone (CBX, 100 μΜ,
Sigma) was added into differentiation medium and changed every 2 days. To induce cell death in astrocyte culture, cells were treated with 100 μΜ LPS for 6 hours.
[00293] Example 6
[00294] Animals and in vivo assays
[00295] In vivo experiments were conducted on wild-type C57/BL6 and a 5xFAD transgenic mouse model of Alzheimer disease, referred to herein as "AD transgenic mice." AD transgenic mice were purchased from The Jackson Laboratory (B6SJL-Tg
(APPSwFlLon,PSENl*M146L*L286V) 6799Vas/Mmjax), described in Oakley, H. et al., J.
Neurosci., 26(40): 10129-10140, 2006, and mated with C57/BL6 mice. Mice were housed in a 12 hr light/dark cycle and supplied with enough food and water.
[00296] Example 7
[00297] Stereotaxic viral injection
[00298] Surgeries were performed on 1, 5-7 and 14 months old WT mice, and on 5-7 and 14 month old AD mice for virus injection or pure stab injury. The mice were anesthetized by injecting 20 mL/kg 2.5% Avertin (a mixture of 25 mg/ml of Tribromoethylethanol and 25 μΐ/ml T-amyl-alcohol) into the peritoneum and then placed in a stereotaxic setup. Artificial eye ointment was applied to cover and protect the eye. The animals were operated with a midline scalp incision and a drilling hole on the skulls above somatosensory cortex. Each mouse received injection (site: AP 1.25 mm, ML 1.4 mm, DV -1.5 mm) of virus with a 5 μΐ syringe and a 34 gauge needle. The injection volume and flow rate were controlled as 3 μΐ at 0.2 μΐ/min, and the needle was moved up during the injection at speed of 0.1 mm/min. After injection, the needle was kept for at least 5 additional minutes and then slowly withdrawn. The needle injection itself was used as stab injury model.
[00299] Example 8
[00300] Immunocytochemistry
[00301] For brain section staining, the mice were anesthetized with 2.5% Avertin and then sequentially perfused, first with saline solution (0.9% NaCl) to wash the blood off and then with 4% paraformaldehyde (PFA) to fix the brain. The brains were removed and post fixed in 4% PFA overnight at 4°C, and then cut at 45 μιη sections by a vibratome (Leica). For analyzing blood vessel area, the animals were perfused by 10 KD Lysine Fixable dextran-Texas red (Invitrogen, 0.5 ml of 10 mg/ml) after fixation. Coronal brain sections were first pretreated in 0.3% Triton X-100 in phosphate-buffered saline (PBS, pH 7.4) for 1 hour, followed by incubation in 3% normal goat serum, 2% normal donkey serum and 0.1% Triton X-100 in PBS for 1 hour.
[00302] For cell culture staining, the cultures were fixed in 4% PFA in PBS for 15 min at room temperature. Cells were first washed three times by PBS and then pretreated in 0.1% Triton X-100 in PBS for 30 min, followed by incubation in 3% normal goat serum, 2% normal donkey serum and 0.1% Triton X-100 in PBS for 1 hour. Primary antibodies were incubated with either brain slices or cultures overnight at 4°C in 3% normal goat serum, 2% normal donkey serum and 0.1% Triton X-100 in PBS. After additional washing in PBS, the samples were incubated with appropriate secondary antibodies conjugated to Alexa Fluor 488, Alexa 546, Alexa 647 (1:300, Molecular Probes), FITC, TRITC, or Dylight (1:500, Jackson ImmunoResearch) for 1 h at room temperature, followed by extensive washing in PBS. Coverslips were finally mounted onto a glass slide with an anti-fading mounting solution with DAPI (Invitrogen). Slides were first examined with an epifluorescent microscope (Nikon TE-2000-S) and further analyzed with a confocal microscope (Olympus FV1000). Z-stacks of digital images, which can either release single confocal images or collapse as one resulting picture, were acquired and analyzed using FV10-ASW 3.0 Viewer software (Olympus). [00303] The following primary antibodies were used: polyclonal anti-green fluorescent protein (GFP, chicken, 1: 1000, Abeam, AB 13970), polyclonal anti-Glial Fibrillary Acidic Protein (GFAP, rabbit, 1:500, Abeam, Z0334), polyclonal anti-Glial Fibrillary Acidic Protein (GFAP, chicken, 1:500, Millipore, AB5541), monoclonal anti S100 (mouse, 1:500, Abeam, ab66028)monoclonal anti-Red Fluorescent Protein (RFP, mouse, 1:300, CELL BIOLABS), polyclonal anti-Red Fluorescent Protein (RFP, rabbit, 1:2000, Rockland), polyclonal anti- vesicular glutamate transporter 1 (vGluTl, rabbit, 1:500, Synaptic Systems), polyclonal anti- vesicular glutamate transporter (SV2, rabbit, 1:2000, Developmental Studies Hybridoma Bank, Iowa City), polyclonal anti-Microtubule Associated Protein 2 (MAP2, Chicken, 1:1000, Abeam, AB5392), polyclonal anti-Microtubule Associated Protein 2 (MAP2, rabbit, 1:500, Chemicon, AB5622), polyclonal anti-T-box, brain, 1 (Tbrl, 1:300, rabbit, Abeam, AB31940), polyclonal anti-Proxl (rabbit, 1:1000, ReliaTech GmbH, 102-PA32), polyclonal anti-musashi-1 (rabbit, 1:300, Neuromics, RA14128), monoclonal anti-SRY (sex determining region Y)-box 2 (Sox-2, mouse , 1:300, Abeam, AB79351), polyclonal anti-SRY (sex determining region Y)-box 2 (Sox- 2, rabbit, 1:500, Millipore, AB5603), monoclonal anti-GAD6, monoclonal anti-βΙΙΙ tubulin (Tuj l, mouse, 1:500, COVANCE, MMS-435P), polyclonal anti-Doublecortin (DCX, rabbit, 1:500, Abeam, AB18723), monoclonal anti-beta Amyloid (Αβ, mouse, 1:200, Abeam, AB11132), monoclonal anti-beta Amyloid 1-42 (rabbit, 1:1000, Invitrogen, 700524), monoclonal anti-ApoE [D6E10] (mouse, 1:200, Abeam, AB1906) polyclonal anti-NeuN (rabbit, 1:500, Millipore, ABN78), monoclonal anti-NG2 (mouse, 1:200, Abeam, AB50009), polyclonal anti- Ibal (goat, 1:200, Abeam, AB5076), polyclonal anti-Ibal (rabbit, 1:1000, Wako, 019-19741), monoclonal anti-CNPase (mouse, 1:200, Abeam, AB6319), monoclonal anti-Chondroitin sulfate proteoglycan (CSPG, 1:200, mouse, Sigma, C8035), monoclonal anti- Vascular endothelial growth factor (VEGF, 1:500, mouse, Abeam, AB1316), monoclonal anti-Pan- Axonal Neurofilament Marker (SMI 312, 1: 1000, mouse, Covance, SMI-312R), polyclonal anti-Glial Glutamate Transporter GLT-1 (EAAT2) (Gltl, Guinea pig, 1:2000, Millipore, AB1783), polyclonal anti-Connexin 43 (Cx43, rabbit, 1:1000, Abeam, AB 11370), monoclonal anti-BrdU (mouse, 1:500, Dako, 074401-8), monoclonal anti-NeuroDl (mouse, 1: 1000, Abeam, ab60704), polyclonal-MBP (rabbit, 1:300, Millipore, AB908), polyclonal anti-GABA (rabbit, 1:2000, Sigma, A2052), and monoclonal anti-glutamate (mouse, 1:500, Sigma, G9282).
[00304] Example 9
[00305] BrdU immunohistochemistry [00306] 100 mg/kg of BrdU (5-bromo-2-deoxyuridine; Invitrogen) was administered to stab- injured mice through intraperitoneal injection for 3 consecutive days starting from 2 days post injury (DPI) to 4 DPI. Mice were euthanized at 4 DPI or 1 month post injury. Floating brain sections were immersed in 85-90°C IX citrate buffer (Sigma # C9999) for 15 min and cool down to room temperature (RT) for 20 min. After wash with PBS for 3 times, brain sections were treated with 2 M HC1 at 37°C for 20 min and washed with PBS for 6 times. Then, brain slices were permeabilized with 0.3% triton in PBS at RT for 2 hours and blocked in blocking buffer (2.5% normal donkey serum, 2.5% normal goat serum, 0.1% triton in PBS) for 1 hour at RT. Sections were incubated in primary anti-BrdU (Dako, 1:500) antibody overnight at 4°C overnight.
[00307] Example 10
[00308] TUNEL assay
[00309] The TUNEL assay was performed with floating brain sections or fixed cell culture to detect apoptotic cells. The In Situ Cell Death Detection Kit (Roche, Laval, Quebec, Canada) was used according to manufacturer's instruction. Briefly, enzyme solution and label solution were 1:9 mixed to obtain TUNEL reaction mixture. Brain sections were incubated with TUNEL reaction mixture at 37°C for 1 hour. After incubation, brain sections were rinsed with PBS for 3 times. TUNEL signal was detected under fluorescent microscope using the detection wavelength of 570-620 nm.
[00310] Example 11
[00311] Patch-clamp recordings in cell cultures
[00312] For NeuroDl -converted neurons, whole-cell recordings were performed using Multiclamp 700A patch-clamp amplifier (Molecular Devices, Palo Alto, CA) as described in Deng, L. et al., J. Neurosci., 27(40): 10860-10869, 2007, and the chamber was constantly perfused with a bath solution consisting of 128 mM NaCl, 30 mM glucose, 25 mM HEPES, 5 mM KCl, 2 mM CaCb, and 1 mM MgCl2. The pH of bath solution was adjusted to 7.3 with NaOH, and osmolality at 315-325 mOsm/L. Patch pipettes were pulled from borosilicate glass (4 - 5 ΜΩ) and filled with a pipette solution consisting of 135 mM KCl (or 10 mM KCl + 125 mM K-Gluconate), 5 mM Na-phosphocreatine, 10 mM HEPES, 2 mM EGTA, 4 mM MgATP, and 0.5 mM Na2GTP, pH 7.3 adjusted with KOH. To distinguish EPSCs versus IPSCs, 0 mM CI" (135 mM K-Gluconate) pipette solution was also used. The series resistance was typically 10-25 ΜΩ. For voltage-clamp experiments, the membrane potential was typically held at -70 or -80 mV. Drugs were applied through a gravity-driven drug delivery system (VC-6, Warner Hamden, CT). NMDA currents were recorded in Mg2+ free bath solution (128 mM NaCl, 30 mM D- glucose, 25 mM HEPES, 5 mM KC1, and 2 mM CaCh, pH 7.3, adjusted with NaOH) plus 10 μΜ glycine, 0.5 μΜ TTX, and 20 μΜ BIC. Data were acquired using pClamp 9 software (Molecular Devices, Palo Alto, CA), sampled at 10 kHz and filtered at 1 kHz. Na+ and K+ currents and action potentials were analyzed using pClamp 9 Clampfit software. Spontaneous synaptic events were analyzed using MiniAnalysis software (Synaptosoft, Decator, GA). All experiments were conducted at room temperature.
[00313] Example 12
[00314] Brain slice recordings
[00315] Cortical slices were prepared typically 1 month after virus injection and cut at 300 μιη thick coronal slices with a Leica vibratome in ice cold cutting solution (containing 75 mM sucrose, 87 mM NaCl, 2.5 mM KC1, 0.5 mM CaCb, 7 mM MgCl2, 25 mM NaHC03, 1.25 mM NaH2P04 and 20 mM glucose). Slices were maintained in artificial cerebral spinal fluid (ACSF) containing 119 mM NaCl, 2.5 mM KC1, 1.25mM NaH2P04, 26 mM NaHC03, 1.3 mM MgCl2, 2.5 mM CaCb and 10 mM glucose. Slices were incubated in ACSF, continuously bubbled with 95% 02 and 5% C02, first at 34°C for 30 minutes, and then at room temperature. Whole-cell recordings were performed using a pipette solution containing 135 mM K-Gluconate, 10 mM KC1, 5 mM Na-phosphocreatine, 10 mM HEPES, 2 mM EGTA, 4 mM MgATP, and 0.5 mM Na2GTP (pH 7.3 adjusted with KOH, 290 mOsm/L). Pipette resistance was 3-4 ΜΩ, and series resistance was typically 20 - 40 ΜΩ. The holding potential for voltage-clamp experiments was -70 mV. Data were collected using pClamp 9 software (Molecular Devices, Palo Alto, CA), sampled at 10 kHz and filtered at 1 kHz, analyzed with Clampfit and Synaptosoft softwares.
[00316] Example 13
[00317] Data analysis
[00318] Cell counts were performed by taking images of several randomly chosen views per coverslip and analyzed by Image J software. The intensity or pixel area was analyzed by Image J software. Data were represented as mean + SEM. Student's i-test (paired or unpaired) was used for statistical analysis. * P < 0.05, ** P < 0.01, *** P < 0.001.
[00319] Example 14
[00320] In vivo conversion of reactive astrocytes and NG2 cells into functional neurons after brain injury [00321] Injecting control retrovirus encoding only GFP into mouse cortex revealed GFAP- positive reactive astrocytes in the injury site at 14 days post injection, DPI. 52.1 + 4.3% of the GFP-positive cells were GFAP-positive, n = 3 animals, see Figure 1A and also Figure 5A. Figure 1A shows representative images illustrating GFP fluorescence in the left panel, GFAP immunofluorescence in the same field, shown in the middle panel, and the overlap of GFP fluorescence and GFAP immunofluorescence in the same field, shown in the right panel, scale bar, 20 μιη.
[00322] Cells infected with a retrovirus construct encoding both NeuroDl and GFP showed extensive neurites and were immunopositive for neuronal marker NeuN at 7 DPI, Figure IB, see also Figure 5B-D; n = 6 animals. Figure IB shows representative images illustrating NeuroDl- GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel, scale bar, 20 μιη. The term "NeuroDl-GFP fluorescence" as used in the Examples herein refers to GFP fluorescence detected in cells infected with a retrovirus construct encoding both NeuroDl and GFP, such that the GFP fluorescence is a surrogate marker for expression of NeuroDl. In particular cases, expression of NeuroDl was independently verified using an anti-NeuroDl antibody assay, examples of which are described and/or shown herein. Note the significant number of NeuN-positive neurons in the injury site after infection with retrovirus construct pCAG-NeuroDl-IRES-GFP.
[00323] Following injection of a retrovirus encoding NeuroDl under the control of human GFAP promoter, called hGFAP: :NeuroDl-IRES-GFP, into adult mouse cortex, which typically has no adult neural stem cells, NeuroDl -infected cells with clear neuronal morphology and immunopositive for NeuN were found, see Figure 1C; n = 3 animals. Cells infected with hGFAP : : NeuroD 1 -IRES - GFP in which GFAP promoter-driven NeuroDl and GFP were produced were immunopositive for NeuN and extended long neurites at 7 DPI. Figure 1C shows representative images illustrating GFAP promoter-driven NeuroDl-GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of GFAP promoter-driven NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel, scale bar, 40 μιη. In contrast, injecting control retrovirus hGFAP::GFP which encodes GFP and not NeuroDl did not result in any neuronal conversion, see Figure 5E; n = 3 animals. [00324] Besides reactive astrocytes, brain injury also activates other two types of reactive glial cells, NG2 cells and microglia. Both astrocytes and NG2 cells are originated from neural stem cell lineage, while microglia is generated by hematopoietic stem cells and infiltrated into the brain through blood vessels. A small percentage (4.7 + 2 %, n = 7 animals) of cells newly infected by retroviral vector pCAG-NeuroDl-IRES-GFP, i.e. at 2 DPI, were found to be immunopositive for both NG2 and Doublecortin (DCX, an immature neuronal marker). Figure ID shows representative images at 2DPI illustrating NeuroDl -GFP fluorescence in the left panel, NG2 immunofluorescence in the same field, shown in the middle panel, and DCX immunofluorescence shown in the right panel, scale bar, 20 μιη.
[00325] After 21 DPI, the in-vivo NeuroDl -converted neurons after brain injury were NeuN- positive and showed robust dendrites and potential axons. Figure IE shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel. NeuroDl -converted neurons are shown to be NeuN-positive, arrowhead, having robust dendrites and a potential axon is shown at the arrow, scale bar, 20 μιη.
[00326] NeuroDl -converted neurons were found to be functional. Cortical slice recordings were performed on cells infected with retroviral vector pCAG-NeuroDl-IRES-GFP, which were identified as green under fluorescent microscope. The NeuroDl -converted neurons showed large sodium currents (3840 + 302 pA, n = 5) and potassium currents (4672 + 602 pA, n = 5). Figure IF shows a representative trace from cortical slice recordings showing Na+ and K+ currents in NeuroDl -converted neurons at 30 DPI. The NeuroDl -converted neurons were found to be capable of firing repetitive action potentials as well, n = 4. Figure 1G shows a representative trace from cortical slice recordings showing repetitive action potentials in NeuroDl -converted neurons at 30 DPI. Moreover, robust spontaneous synaptic events in NeuroDl -converted neurons were recorded in cortical slice recordings; frequency, 1.96 + 0.43 Hz; amplitude, 23.7 + 2.0 pA; n = 8; 25-31 DPI, suggesting that they have been functionally incorporated into existing neural circuits. Figure 1H shows representative traces showing spontaneous synaptic events in a NeuroDl -converted neuron in cortical slice recording at 26 DPI, CNQX, 10 μΜ; Bic, 20 μΜ. Figure II shows an enlarged view of the synaptic events from Figure 1H.
[00327] Example 15 [00328] Beneficial effects of converting reactive astrocytes and NG2 cells into functional neurons after brain injury
[00329] The effects of reactive glia-neuron conversion on the injury areas were examined. Axon fibers increased significantly in the injured region with infected with retrovirus construct pCAG-NeuroDl-IRES-GFP, compared to control areas infected with retrovirus construct pCAG- GFP. Consistent with the generation of new neurons in the injury site, axon fibers labeled by SMI312 increased significantly in the region infected with retroviral vector pCAG-NeuroDl- IRES-GFP compared to the region infected with the GFP control vector, n = 9 animals. Figure 2A shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, pCAG-GFP, top left or in cells infected with retroviral vector pCAG-NeuroDl-IRES-GFP, bottom left, at 12-16 DPI. SMI 312 immunofluorescence labels axons in the same fields, shown in the corresponding middle panels top and bottom. The overlap of GFP fluorescence and SMI 312 immunofluorescence in the same field is shown in the corresponding right panels, scale bar, 20 μιη. Figure 2B is a graph showing results of quantitation of axon fibers in the injured region infected with retrovirus vector pCAG-NeuroDl- IRES-GFP showing NeuroDl -induced conversion, compared to the control injured region infected with pCAG-GFP, showing a significant increase in axon fibers in the injured region infected with retrovirus construct encoding NeuroDl -GFP (n = 9).
[00330] Glial cell secreted CSPG significantly decreased after NeuroDl -induced conversion, n = 9 animals. Figure 2C shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with retrovirus vector pCAG-NeuroDl-IRES-GFP, bottom left, at 12-16 DPI. CSPG immunofluorescence in the same fields is shown in the corresponding middle panels top and bottom. The overlap of GFP fluorescence and CSPG immunofluorescence in the same field is shown in the corresponding right panels, scale bar, 20 μιη. Figure 2D is a graph showing results of quantitation of CSPG in the injured region infected with retrovirus vector pCAG-NeuroDl- IRES-GFP showing NeuroDl -induced conversion, compared to the control injured region infected with retrovirus construct encoding GFP alone, showing a significant decrease in CSPG in the injured region infected with retrovirus vector pCAG-NeuroDl-IRES-GFP (n = 9).
[00331] In contrast, the blood vessels, labeled by dextran- Texas Red, significantly increased in the region infected with retrovirus vector pCAG-NeuroDl-IRES-GFP compared to the GFP control, n = 6 animals. Figure 2E shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or in cells infected with retrovirus construct pCAG-NeuroDl-IRES-GFP, bottom left, at 12-16 DPI. Dextran-Texas Red (Dextran-TR) fluorescence labels blood vessels in the same fields, shown in the corresponding middle panels top and bottom. The overlap of GFP fluorescence and Dextran-TR fluorescence in the same field is shown in the corresponding right panels, scale bar, 20 μιη. Figure 2F is a graph showing results of quantitation of area of blood vessels in the injured region infected with retrovirus construct pCAG-NeuroDl-IRES-GFP showing NeuroDl -induced conversion, compared to the control injured region infected with retrovirus construct encoding GFP alone, showing a significant increase in area of blood vessels in the injured region infected with retrovirus construct pCAG-NeuroDl-IRES-GFP (n = 6).
[00332] At early stage of conversion, at 2 DPI, some cells infected with retrovirus construct pCAG-NeuroDl-IRES-GFP showed weak but clear GFAP expression (arrow). Gap junctions were detected at 2DPI between astrocytes and newly converted neurons. Figure 2G shows representative images illustrating NeuroDl-GFP fluorescence in the left panel, GFAP immunofluorescence in the same field, shown in the middle left panel, arrow, Cx43 immunofluorescence in the same field shown in the middle right panel, arrowheads, and the overlap of NeuroDl -GFP fluorescence, GFAP immunofluorescence and Cx43 immunofluorescence in the same field, shown in the right panel, scale bar, 10 μιη.
[00333] Example 16
[00334] NeuroDl converts reactive astrocytes and NG2 cells into functional neurons (NeuroDl -converted neurons) in AD mouse brain in vivo
[00335] Reactive astrocytes have been widely reported in the cortex of Alzheimer's disease patients or animal models, see Steele, M.L. et al., Neurobiol .Aging, 33(2):423 e421-413, 2010; and Rodriguez, J.J. et al., Cell Death Differ., 16(3):378-385, 2009. A transgenic mouse model with AD, 5xFAD, described in Oakley, H. et al., J. Neurosci., 26(40):10129-10140, 2006, was used in this example to test whether reactive astrocytes in the AD brain can be converted into functional neurons. Confirmation that there were indeed many reactive astrocytes in the cortex of 5xFAD mice (5 month old) compared to the WT was obtained. Figure 3A shows representative images illustrating GFAP immunofluorescence in wild-type mouse cortex in the left panel, GFAP immunofluorescence in 5xFAD mouse cortex, shown in the middle panel, and the overlap of GFAP immunofluorescence in 5xFAD mouse cortex and thioflavin-S immunofluorescence in the same field, shown in the right panel, scale bar, 20 μιη. Thioflavin-S labels Αβ plaques. Reactive astrocytes (labeled by GFAP) in 5xFAD mouse cortex were significantly increased compared to wild-type mouse cortex.
[00336] Retrovirus pCAG-NeuroDl-IRES-GFP was injected into the cortex of 5xFAD mice and NeuN-positive neuron-like cells were subsequently found in the AD brain. Cells infected with retrovirus construct pCAG-NeuroDl-IRES-GFP at 14 DPI in AD mouse cortex (7-month old 5xFAD mouse cortex) showed clear neuron-like morphology and NeuN staining. Figure 3B shows representative images at 14 DPI illustrating NeuroDl-GFP fluorescence in 7-month old 5xFAD mouse cortex in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel, scale bar, 40 μιη.
[00337] A retrovirus construct encoding NeuroDl-GFP driven by the human GFAP promoter, hGFAP::NeuroDl-GFP, was used to infect astrocytes specifically. NeuroDl -converted neurons labeled by NeuN in the AD brain were subsequently observed. AD cortex (5xFAD mouse cortex) infected by retrovirus encoding GFAP promoter-driven NeuroDl-GFP showed neuronal morphology and NeuN labeling at 7 DPI. Figure 3C shows representative images illustrating GFAP promoter-driven NeuroDl-GFP fluorescence in 5xFAD mouse cortex in the left panel, NeuN immunofluorescence in the same field, shown in the middle panel, and the overlap of GFAP promoter-driven NeuroDl-GFP fluorescence and NeuN immunofluorescence in the same field, shown in the right panel, scale bar, 20 μιη.
[00338] NeuroDl -converted neurons in the AD brain were innervated by glutamatergic (VGluTl immunopositive) and GABAergic (GAD65 immunopositive) terminals. Figure 3D shows representative images illustrating NeuroDl-GFP fluorescence in 5xFAD mouse cortex in the top panel and VGlutl immunofluorescence, arrowhead, in the same field shown in the bottom panel, scale bar, 5 μιη. Figure 3E shows representative images illustrating GAD65 immunofluorescence, arrow, in 5xFAD mouse cortex in the same field as in Figure 3D in the top panel and the overlap of NeuroDl-GFP fluorescence, VGlutl immunofluorescence and GAD65 immunofluorescence in the same field, shown in the bottom panel, scale bar, 5 μιη.
[00339] Cortical slice recording demonstrated that the NeuroDl -converted neurons in the AD brain were functional, with the peak amplitude of INB at 2270 + 282 pA (n = 5) and IK at 5498 + 706 pA (n = 5). Figure 3F shows representative traces of sodium and potassium currents of NeuroDl -converted neurons at 28 DPI with retrovirus construct encoding NeuroDl-GFP in AD cortical slices (5xFAD mouse cortex). [00340] Spontaneous synaptic events in NeuroDl -converted neurons were recorded; frequency, 2.80 + 0.95 Hz; amplitude, 20.5 + 2.7 pA; n = 7, suggesting that these newly converted neurons have been integrated into the neural circuits. Figure 3G shows representative traces of spontaneous synaptic events recorded from NeuroDl -converted neurons at 28 DPI with retrovirus construct encoding NeuroDl-GFP in the AD cortical slices (5xFAD mouse cortex). All synaptic events were blocked by the mixture of AMPA/kainate receptor blocker CNQX (10 μΜ) and GABAA receptor blocker BIC (20 μΜ). Figure 3H shows an enlarged view of two synaptic events shown in Figure 3G.
[00341] Beneficial effects of the conversion of reactive glial cells to neurons by NeuroDl on the AD brain were examined.
[00342] Immunostaining with Αβ1-42 showed a significant decrease of Αβ deposit in NeuroDl -converted region compared to GFP control. Αβ deposit decreased in region of 5xFAD mouse cortex infected with a retrovirus construct pCAG-NeuroDl-IRES-GFP, n = 8. Figure 31 shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct pCAG-NeuroDl-IRES-GFP, bottom left, at 15-17 DPI. Αβ42 immunofluorescence in the same fields is shown in the corresponding middle panels top and bottom. The overlap of GFP fluorescence or NeuroDl-GFP fluorescence and Αβ42 immunofluorescence in the same field is shown in the corresponding right panels, scale bar, 100 μιη.
[00343] The ApoE signal was also significantly decreased in the AD cortex after NeuroDl infection, see Figure 3J, quantified in Figure 3M. ApoE signal decreased in region of 5xFAD mouse cortex infected with retrovirus construct pCAG-NeuroDl-IRES-GFP, n = 8. Figure 3J shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with retrovirus construct pCAG-NeuroDl-IRES-GFP, bottom left, at 15-17 DPI. ApoE immunofluorescence in the same fields is shown in the corresponding middle panels top and bottom. The overlap of GFP fluorescence or NeuroDl-GFP fluorescence and ApoE immunofluorescence in the same field is shown in the corresponding right panels, scale bar, 100 μιη
[00344] Interestingly, the astrocytic glutamate transporter Gltl, which typically decreases after injury or disease, was significantly increased in the NeuroDl -converted region, see Figure 3K, quantified in Figure 3N. Astrocytic glutamate transporter Gltl increased in region of 5xFAD mouse cortex infected with a retrovirus construct encoding NeuroDl-GFP, n = 7. Figure 3K shows representative images illustrating GFP fluorescence in cells infected with a retrovirus construct encoding GFP alone, top left or NeuroDl-GFP fluorescence in cells infected with a retrovirus construct encoding NeuroDl-GFP, bottom left, at 15-17 DPI. Gltl immunofluorescence in the same fields is shown in the corresponding middle panels top and bottom. The overlap of GFP fluorescence or NeuroDl-GFP fluorescence and Gltl immunofluorescence in the same field is shown in the corresponding right panels, scale bar, 40 μιη.
[00345] Figure 3L is a graph showing results of quantitation of Αβ in the region of 5xFAD mouse cortex infected with retrovirus construct pCAG-NeuroDl-IRES-GFP at 15-17 DPI, showing NeuroDl -induced conversion, compared to the control injured region infected with retrovirus construct encoding GFP alone, showing a significant decrease in Αβ in the injured region infected with retrovirus construct encoding NeuroDl-GFP, n = 8.
[00346] Figure 3M is a graph showing results of quantitation of ApoE in the region of 5xFAD mouse cortex region infected with retrovirus construct pCAG-NeuroDl-IRES-GFP at 15-17 DPI, showing NeuroDl -induced conversion, compared to the control injured region infected with retrovirus construct encoding GFP alone, showing a significant decrease in ApoE in the injured region infected with retrovirus construct encoding NeuroDl-GFP, n = 8.
[00347] Figure 3N is a graph showing results of quantitation of Gltl in the region of 5xFAD mouse cortex injured region infected with retrovirus construct encoding NeuroDl-GFP at 15-17 DPI, showing NeuroDl -induced conversion, compared to the control injured region infected with retrovirus construct encoding GFP alone, showing a significant increase in Gltl in the injured region infected with retrovirus construct encoding NeuroDl-GFP, n = 7.
[00348] Example 17
[00349] Direct conversion of cultured human astrocytes into functional neurons
[00350] Human cortical astrocytes (ScienCell, California) in vitro culture were infected with retrovirus construct pCAG-NeuroDl-IRES-GFP. The cultured human astrocytes were mostly immunopositive for S100 , 94.3 + 0.7 %, n = 12, and rarely stained for NG2. Figure 4A is a representative immunofluorescence image showing that the majority of cultured human astrocytes were immunolabeled by SIOO antibodies, scale bar, 50 μιη. [00351] Infection by retrovirus construct pCAG-NeuroDl-IRES-GFP significantly changed the cell morphology from astrocytes to neurons. Figure 4B is a representative pair of phase contrast images showing NeuroDl -induced morphological change from astrocytes (left) to neurons at 45 DPI with retrovirus construct pCAG-NeuroDl-IRES-GFP (right), scale bar, 20 μιη.
[00352] After NeuroDl -infection, the majority of cells became immunopositive for a neuronal marker MAP2. Figure 4C shows representative images illustrating GFP fluorescence in human astrocytes infected with retrovirus construct pCAG-NeuroDl-IRES-GFP, left, at 30 DPI, converted into MAP2 -positive neurons, same field, middle and overlap of the left and middle images further showing DAPI fluoresence, scale bar, 50 μιη.
[00353] Cultured human astrocytes were infected with a retrovirus encoding NeuroDl under control of the human GFAP promoter, GFAP::NeuroDl-IRES-GFP, resulting in conversion of the majority of NeuroDl -infected cells to NeuN-positive neurons. Figure 4D shows representative images illustrating GFP fluorescence in human astrocytes infected with a retrovirus construct encoding GFAP promoter-driven NeuroDl -GFP, left, at 12 DPI and showing that infected human astrocytes were also immunopositive for NeuN, same field, right, scale bar, 40 μιη.
[00354] Quantitatively, among all human astrocytes infected with GFAP::NeuroDl-IRES- GFP (n = 976 with 4 independent repeats), about 95.4 + 1% cells were converted into neurons (NeuN positive).
[00355] The trans -differentiation process of conversion of human astrocytes to neurons following expression of exogenous NeuroDl was examined from 24 hours until 5 days after infection of the human astrocytes with a retrovirus encoding NeuroDl. No transient increase in the expression level of neural stem cell marker Sox2 or Musashi occurred during the early conversion period. Figure 4E shows representative images illustrating direct conversion of human astrocytes into neurons by introduction of exogenous NeuroDl into the astrocytes by expression of a retrovirus construct encoding NeuroDl, without transition through the Sox2- positive neuroprogenitor stage. After only 1 - 3 days of infection by NeuroDl, some astrocytes already became neuron-like cells with clearly extended neurites (Figure 4E, arrows). Astrocytes usually had low level of Sox2 expression but astrocytes infected with GFAP::NeuroDl-IRES- GFP (arrows) were devoid of Sox2 signal. DAPI staining of the cell nucleus shows the total number of cells in the imaging field. Images at left show NeuroDl -GFP fluorescence, images in middle panels show Sox2 immunofluorescence and images at right show overlap of NeuroDl - GFP fluorescence, Sox2 immunofluorescence and DAPI fluorescence in the same field, scale bar, 20 μιη.
[00356] Human astrocytes converted into neurons by expression of exogenous NeuroDl by infection with GFAP: :NeuroDl-IRES-GFP were immunopositive for glutamate but not for GAB A (Figure 17). Cultured human microglia were infected with retrovirus encoding NeuroDl - GFP, but no DCX-positive neurons were detected (Figures 18D-18F). Therefore, human astrocytes, but not microglia, can be directly converted into neurons by induced NeuroDl expression.
[00357] Immunostaining with synaptic marker SV2 and glutamatergic synapse marker VGluTl was performed to determine whether NeuroDl -converted human neurons are functionally connected. Numerous SV2 puncta were observed on MAP2-labeled neuronal dendrites following infection of astrocytes with retrovirus encoding NeuroDl. Figure 4F shows representative images of immunostained synaptic puncta (SV2, left) on the dendrites (MAP2, middle) of NeuroDl -converted human neurons at 45 DPI, NeuroDl-GFP fluorescence, right, scale bar, 20 μιη.
[00358] Some neurons showed mushroom-like mature spines, which were co-localized with VGluTl puncta. Figure 4G is a high magnification image showing vesicular glutamate transporter 1 (VGlutl) immunostained puncta co-localized with dendritic spines on NeuroDl- converted neurons, scale bar, 10 μιη.
[00359] Patch clamp recordings were used to test the function of human astrocytes converted to human neurons. After 20 DPI, repetitive action potential firing, n = 15, and large sodium (IN3) and potassium currents (IK), n = 12, were recorded. Figure 4H is a representative trace of repetitive action potentials in NeuroDl -converted neurons at 20 DPI. Figure 41 shows a representative trace showing the Na+ and K+ currents recorded from NeuroDl -converted neurons at 30 DPI.
[00360] Large glutamate receptor currents (31-35 DPI, 548 + 138 pA, n = 7), GABAA receptor currents (31-35 DPI, 599 + 114 pA, n = 8), and NMDA-evoked currents (40 DPI, 966 + 101 pA, n = 8) were also detected. Figure 4J shows a representative trace showing receptor currents induced by bath application of 100 μΜ glutamate. Figure 4K shows a representative trace showing receptor currents induced by bath application of 100 μΜ GAB A. Figure 4L shows a representative trace showing receptor currents induced by bath application of 100 μΜ NMDA. [00361] Furthermore, functional synaptic events in NeuroDl -converted neurons (frequency, 1.6 ± 0.3 Hz; and amplitude, 23.2 + 0.8 pA; n = 13), which were completely blocked by AMPA/kainate receptor antagonist CNQX (10 μΜ) but not by GABAA receptor antagonist bicuculline (20 μΜ) were detected. Figure 4M shows representative traces of spontaneous synaptic events in NeuroDl -converted neurons at 40 DPI. Note that all synaptic events were blocked by CNQX (10 μΜ) but not by Bic (20 μΜ), suggesting that the human astrocytes converted to human neurons by expression of exogenous NeuroDl were glutamatergic.
[00362] Example 18
[00363] Cells Infected With A Retrovirus Encoding NeuroDl Are Doublecortin (DCX)- Positive Neurons.
[00364] Figure 5 A is a set of low power images showing reactive glial cells infected with a retrovirus encoding only GFP in the vicinity of injury core shown at *, 14 DPI. GFP fluorescence is shown at left, along with GFAP immunostaining of the same field, middle and overlap of GFP fluorescence, GFAP immunostaining and DAPI fluorescence of the same field, right, scale bar, 40 μιη.
[00365] At 4DPI, cells infected with a retrovirus encoding NeuroDl and GFP were mostly positive for DCX, an immature neuronal marker. In Figure 5B, NeuroDl-GFP fluorescence is shown at left, along with DCX immunostaining of the same field, middle and overlap of GFP fluorescence and DCX immunostaining of the same field, right, scale bar, 40 μιη. Note a significant number of DCX-positive neurons after NeuroDl infection.
[00366] Figure 5C are low power images showing DCX-positive cells infected with a retrovirus encoding NeuroDl and GFP along the injection site at 14 DPI. NeuroDl-GFP fluorescence is shown at left, along with DCX immunostaining of the same field, middle and overlap of NeuroDl-GFP fluorescence, DCX immunostaining and DAPI fluorescence in the same field, right, scale bar, 100 μιη. Note that the injury site was in the cortical areas above the hippocampus delineated by DAPI staining. Figure 5D are high power images showing DCX- positive cells infected with a retrovirus encoding NeuroDl and GFP along the injection site at 14 DPI. NeuroDl-GFP fluorescence is shown at left, along with DCX immunostaining of the same field, middle and overlap of NeuroDl-GFP fluorescence, DCX immunostaining and DAPI fluorescence in the same field, right. Note that the injury site was in the cortical areas above the hippocampus delineated by DAPI staining, scale bar, 20 μιη. [00367] Figure 5E show images illustrating that GFAP::GFP retrovirus-infected astrocytes were DCX-negative, scale bar, 40 μιη.
[00368] Example 19
[00369] NeuroDl converts cultured mouse astrocytes into neurons
[00370] A retrovirus encoding NeuroDl was used to infect cultured mouse astrocytes and NG2 cells. NeuroDl efficiently converted cultured mouse astrocytes into neurons. Figure 6 A shows representative images illustrating that cultured mouse astrocytes were mostly immunopositive for astrocyte marker GFAP (left, 87.8 + 1.4%), with a few positive for Ibal (middle) but rarely NG2 (right).
[00371] Figure 6B shows representative images illustrating that NeuroDl-GFP retrovirus infected cells were immunopositive for NeuN. NeuroDl expression was confirmed by NeuroDl staining (8 DPI). In Figure 6B NeuroDl-GFP fluorescence is shown at left, NeuN immunostaining of the same field is shown in the middle panel and NeuroDl immunostaining of the same field is shown in the panel at right, scale bar, 40 μιη.
[00372] Figure 6C shows representative images illustrating that GFAP::NeuroDl retrovirus- infected cells were also positive for NeuN (8 DPI). In Figure 6C NeuroDl-GFP fluorescence is shown at left, NeuN immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and NeuN immunostaining of the same field is shown in the panel at right, scale bar, 40 μιη.
[00373] Figure 6D shows representative images illustrating that cells infected with a retrovirus construct encoding NeuroDl were mostly positive for cortical neuron marker Tbrl. In Figure 6D NeuroDl-GFP fluorescence is shown at left, Tbrl immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and Tbrl immunostaining of the same field is shown in the panel at right, scale bar, 40 μιη.
[00374] Figure 6E shows representative images illustrating that some cells infected with a retrovirus construct encoding NeuroDl were also positive for dentate granule cell marker Proxl (8 DPI). In Figure 6E NeuroDl-GFP fluorescence is shown at left, Proxl immunostaining of the same field is shown in the middle panel and overlap of the NeuroDl-GFP fluorescence and Proxl immunostaining of the same field is shown in the panel at right, scale bar, 40 μιη. Figure 6F is a graph showing quantitation of cultured mouse astrocytes immunopositive for GFAP, Ibal and NG2.
[00375] Example 20 [00376] Functional characterization of NeuroDl-converted neurons generated by infection of mouse astrocytes with a retrovirus encoding NeuroDl
[00377] NeuroDl-converted neurons generated by infection of mouse astrocytes with a retrovirus encoding NeuroDl showed large GABA, glutamate and NMDA currents, as well as spontaneous synaptic events which were blocked by CNQX but not BIC, suggesting that they were glutamatergic neurons. Figure 7A shows large receptor currents induced by bath application of GABA (100 μΜ) in mouse astrocyte-converted neurons, 7 DPI: 405 + 97 pA; 14 DPI: 861 + 55 pA; n = 8.
[00378] Figure 7B shows glutamate (100 μΜ) evoked currents (7 DPI: 517 + 145 pA; 14 DPI: 1061 + 159 pA; n = 8). Figure 7C shows NMDA (100 μΜ) evoked currents (7 DPI: 676 + 118 pA; 14 DPI: 1315 + 95; n = 9). Figure 7D shows spontaneous synaptic currents recorded from NeuroDl-converted neurons (14 DPI; frequency, 1.15 + 0.24 Hz, amplitude, 21.5 + 0.7 pA, n = 13). Note that synaptic events were blocked by CNQX (10 μΜ), glutamate receptor blocker, but not by GABAA receptor blocker bicuculline (Bic, 20 μΜ), suggesting that astrocyte-converted neurons by NeuroDl were glutamatergic.
[00379] Example 21
[00380] NeuroDl converts NG2 cells into neurons
[00381] NeuroDl also converted NG2 cells into NeuN-positive neurons, confirming the in vivo observation described herein. However, different from astrocyte conversion, many NG2- converted neurons were immunopositive for GABA. Figure 8A shows representative images of cultured mouse NG2 cells showing NG2 immunostaining, left, Ibal immunostaining, middle, and GFAP immunostaining, right, indicating that the majority of cells in the mouse NG2 cultures were immunopositive for NG2 (79.2 + 3.2%), scale bar, 40 μιη. Cultured mouse NG2 cells had many oligodendrocytes as identified immunopositive for CNPase at 5 DPI with a retrovirus construct encoding GFP without NeuroDl. In Figure 8B GFP fluorescence is shown at left, CNPase immunostaining is shown in the middle panel and the overlap of GFP fluorescence and CNPase immunostaining of the same field is shown in the right panel, scale bar, 40 μιη. NG2 cells are oligodendrocyte precursor cells. Figure 8C shows representative images illustrating that NG2 cells infected with a retrovirus encoding NeuroDl-GFP became NeuN-positive neurons, shown at 5 DPI. In Figure 8C NeuroDl -GFP fluorescence is shown at left, NeuN immunostaining is shown in the middle panel and the overlap of GFP fluorescence and NeuN immunostaining of the same field is shown in the right panel, scale bar, 40 μιη. Figure 8D shows representative images illustrating that, different from astrocytes, many NG2 cells infected with a retrovirus construct encoding NeuroDl became GABAergic neurons,7 DPI; 72.7 + 9.2%, n=7. In Figure 8D NeuroDl -GFP fluorescence is shown at left, GAB A immunostaining is shown in the middle panel and the overlap of GFP fluorescence and GABA immunostaining of the same field is shown in the right panel, scale bar, 40 μιη. Arrows in Figure 8D point to GABAergic neurons, arrowhead points to a non-GABAergic neuron. Figure 8E shows representative images illustrating that NG2 cells infected with a retrovirus construct encoding NeuroDl were mostly immunopositive for cortical neuron marker Tbrl, 5 DPI. In Figure 8E NeuroDl-GFP fluorescence is shown at left, Tbrl immunostaining is shown in the middle panel and the overlap of GFP fluorescence and Tbrl immunostaining of the same field is shown in the right panel, scale bar, 40 μιη. Figure 8F shows representative images illustrating that NG2 cells infected with a retrovirus construct encoding NeuroDl were either positive (arrow) or negative for Proxl (arrowhead, 5 DPI). In Figure 8F NeuroDl-GFP fluorescence is shown at left, Proxl immunostaining is shown in the middle panel and the overlap of GFP fluorescence and Proxl immunostaining of the same field is shown in the right panel, scale bar, 40 μιη. Figure 8G is a graph showing quantitation of cultured mouse NG2 cells immunopositive for GFAP, Ibal and NG2.
[00382] Example 22
[00383] Functional characterization of NG2 cells converted to neurons by NeuroDl
[00384] Patch-clamp recordings also revealed both glutamatergic and GABAergic events in NeuroDl -converted neurons generated by infection of NG2 cells with a retrovirus encoding NeuroDl. Figure 9 A shows representative images illustrating that numerous VGluTl puncta were detected on NG2 cells converted to neurons by NeuroDl after infecting mouse NG2 cultures with NeuroDl-GFP retrovirus. In Figure 9A, NeuroDl-GFP fluorescence is shown in the left panel, vGlutl immunostaining is shown in the middle panel and the overlap of NeuroDl- GFP fluorescence and vGlutl immunostaining in the same field is shown in the right panel, scale bar, 20 μιη. Figure 9B is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large sodium and potassium currents (n = 10). Figure 9C is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed repetitive action potentials (n = 9). Figure 9D is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large glutamate-evoked current (n = 7). Figure 9E is a representative trace showing that NG2 cells converted to neurons by NeuroDl showed large GABA-evoked current (n = 9). Spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed both glutamatergic and GABAergic components, confirming that NeuroDl can convert NG2 cells into both excitatory and inhibitory neurons. Figure 9F is a representative trace showing that spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed glutamatergic components (n = 8). Figure 9G is a representative trace showing that spontaneous synaptic events recorded from NG2 cells converted to neurons by NeuroDl showed GABAergic components (n = 7).
[00385] Example 23
[00386] Long survival of NeuroDl-converted neurons in mouse brain in vivo
[00387] It was found that NeuroDl-converted neurons can survive very long in the mouse brain, at least 2 months after retroviral injection, and these converted neurons showed many dendritic spines and large spontaneous synaptic events, n = 3 animals. Figure 10A is an image of NeuroDl-GFP fluorescence in clear dendritic spines (arrows) observed in 2-month old NeuroDl- converted neurons after viral injection, scale bar, 4 μιη. Figure 10B is a representative trace showing large spontaneous synaptic events recorded from 2-month old NeuroDl-converted neurons in cortical slice recordings. Figure IOC is a representative trace showing an expanded view of the synaptic events shown in Figure 10B.
[00388] Example 24
[00389] Lack of endogenous newborn neurons in mouse cortex after stab injury
[00390] The number of NeuroDl-converted neurons in the injury areas was far more than the few newborn neurons found in the injury site without NeuroDl infection. Immunostaining of BrdU was performed at 4 days and 1 month post injury. Figure 11 A shows representative images of BrdU immunostaining at 4 days post-injury, left panel, along with DCX immunostaining of the same field, middle panel, and the overlap of BrdU immunostaining and DCX immunostaining of the same field, right panel, scale bar, 20 μΜ. Figure 11B shows representative images of BrdU immunostaining at 1 month post-injury, left panel, along with NeuN immunostaining of the same field, middle panel, and the overlap of BrdU immunostaining and NeuN immunostaining of the same field, right panel, scale bar, 20 μΜ. The majority of BrdU-positive cells were not neurons (arrowhead), with only a few exceptions (arrow), n = 3 animals. Quantitatively, BrdU-labeled endogenous NeuN-positive neurons induced by stab injury were only 26 + 4 per mm2 (n = 3 animals), whereas our NeuroDl-GFP infected NeuN- positive neurons after stab injury were 294 + 22 per mm2 (n = 6 animals). These results demonstrate that NeuroDl can convert a significant number of reactive glial cells, including both reactive astrocytes and NG2 cells, into functional neurons in vivo after brain injury. BrdU (100 mg/kg) was administered daily from 2-4 days post injury to label the injury-activated proliferative cells.
[00391] Example 25
[00392] The time course of glial cell response and the detrimental changes induced by brain stab injury
[00393] The benefits of NeuroDl -converted neurons at the injury site were examined. After brain injury, neuroinhibitory proteoglycans typically increase whereas axon fibers and blood vessels usually decrease in the injury areas. A number of biomarkers were assayed after brain injury and followed their time course of changes from 2 days to one month after injury. It was found that 2 days after stab injury, the immunostaining signal of GFAP (reactive astrocytes), NG2 (NG2 cells), and Ibal (microglia) all increased significantly. Interestingly, the GFAP and Ibal signal remained very high in 30 days after injury, whereas the NG2 signal decreased significantly after two weeks of injury. Figure 12A shows representative images of immunostaining showing changes of GFAP (astrocyte), NG2 (NG2 cell), and Ibal (microglia) signal before (DO) and up to one month after brain stab injury. Scale bar, 20 μιη. n = 3-4 animals for each quantification. A substantial increase of cell death (TUNEL), chondroitin sulfate proteoglycan (CSPG), and astrocytic gap junctions (Cx43) was also observed after stab injury. Figure 12B shows representative images of TUNEL staining which showed significant cell death at day 2 and day 30 after stab injury, which was accompanied by increase in chondroitin sulfate proteoglycan (CSPG) and astrocytic gap junctions (labeled by Cx43). Scale bar, 20 μιη. n = 3-4 animals for each quantification.
[00394] TUNEL, CSPG, and Cx43 signals decreased at 2 weeks after injury, but increased again at 30 days after injury. Furthermore, the astrocytic glutamate transporter (Gltl), axon fibers (SMI312), and oligodendrocyte myelin proteins (MBP) all decreased after injury. Figure 12C shows representative images indicating a significant decrease of astrocytic glutamate transporter Gltl and axon fibers (labeled by SMI312) as well as myelin protein (MBP) after brain stab injury. Scale bar, 20 μιη. n = 3-4 animals for each quantification. Figure 12D shows bar graphs showing the quantified data of the immunostaining signal before and after brain injury (D0-D30, except MBP). n = 3-4 animals for each quantification.
[00395] Example 26 [00396] More beneficial effects after conversion of reactive astrocytes and NG2 cells into functional neurons by expression of exogenous NeuroDl in the injury sites
[00397] Additional beneficial effects including decreased gap junctions, decreased cell death, and increased VEGF in regions containing NeuroDl -converted neurons. Figure 13A includes images of GFP fluorescence, top left or NeuroDl -GFP fluorescence, bottom left, Cx43 immunostaining, middle panels and the overlap of GFP or NeuroDl-GFP fluorescence and Cx43 immunostaining, right panels, top and bottom respectively, scale bar, 20 μιη. Figure 13A further includes a graph showing that astrocytic gap junctions (Cx43) decreased in regions infected with a retrovirus construct encoding NeuroDl compared to the control areas infected with a retrovirus construct encoding GFP only (n = 7). Figure 13B includes images of GFP fluorescence, top left or NeuroDl-GFP fluorescence, bottom left, TUNEL staining, middle panels and the overlap of GFP or NeuroDl-GFP and TUNEL staining, right panels, top and bottom respectively, scale bar, 20 μιη. Figure 13B further includes a graph showing that TUNEL staining showed reduced cell death in the regions containing NeuroDl -converted neurons (n = 5). Figure 13C includes images of GFP fluorescence, top left or NeuroDl-GFP fluorescence, bottom left, VEGF immunostaining, middle panels and the overlap of GFP or NeuroDl-GFP and VEGF immunostaining, right panels, top and bottom respectively, scale bar, 10 μιη. Figure 13C further includes a graph showing that angiogenesis marker VEGF was significantly increased in the regions containing NeuroDl -converted neurons (n = 6). Figure 13D shows representative images illustrating that in regions containing NeuroDl -converted neurons, astrocytes were closely contacting blood vessels (n = 6), scale bar, 40 μιη. Figure 13E shows representative images illustrating that in regions containing NeuroDl -converted neurons, SMI312-labeled axon fibers were co-localizing with myelin protein MBP (n = 4), scale bar, 20 μιη. In Figure 13E SMI312 immunostaining is shown in the left panel, MBP immunostaining in the middle left panel and the overlap of SMI312 immunostaining and MBP immunostaining is shown in the panel on the right.
[00398] Example 27
[00399] Gap junction coupling between newly converted neurons and surrounding astrocytes.
[00400] Gap junction-mediated trans-cellular signaling may mediate beneficial effects of conversion of astrocytes to neurons by expression of exogenous NeuroDl. Astrocytes are coupled with gap junctions and brain injury increases astrocytic gap junctions, see Figure 12B. The studies described herein showed that during the early stage of astrocyte-neuron conversion, gap junctions might remain between astrocytes and new NeuroDl -converted neurons, see Figure 2G. Further results showed that injecting dye (sulforhodamine B) into 1-day old NeuroDl- converted neurons resulted in the spreading of the dye into neighboring astrocytes (Figure 14A). The dye coupling was blocked by gap junction inhibitor carbenoxolone (CBX), see Figure 14A. Interestingly, injecting dye into 3-day old NeuroDl -converted neurons did not have dye coupling anymore, suggesting that gap junctions only remained for a short period after the conversion, see Figure 14A. To investigate whether such neuron- astrocyte gap junction had any functional significance, we used LPS (100 μΜ) to induce cell death in our cell cultures. Compared to the GFP control retrovirus, infection with a retrovirus encoding NeuroDl significantly decreased the number of cell deaths, and such beneficial effect was blocked by gap junction inhibitor. Thus, converting reactive glial cells into functional neurons by expression of exogenous NeuroDl significantly improves injured areas by increasing axon fibers and blood vessels while decreasing cell death. Figure 14A shows representative images showing that dialysis of sulforhodamine B into 1 day old NeuroDl -converted neuron labeled surrounding astrocytes as outlined by dashed line and that such dye coupling was not seen in 3-day old converted neurons or after blocking gap junctions with carbenoxolone (CBX, 100 μΜ). Scale bar, 20 μιη. n = 3 cultures. Figure 14B shows representative images showing that NeuroDl -induced conversion of astrocytes into neurons significantly reduced cell death (labeled by TUNEL staining). Blocking gap junction with CBX increased cell death. Scale bar, 20 μιη. n = 4 cultures. TUNEL cell number was counted per 60x image (area = 0.044 mm2). Figure 14C is a graph showing quantitation of these results.
[00401] Example 28
[00402] NeuroDl can convert reactive astrocytes and NG2 cells into NeuroDl-converted neurons in aging animals
[00403] Injection of a retrovirus encoding NeuroDl into very old brain, 14 month old WT or AD brain, was found to convert reactive glial cells into neurons. Figure 15A shows representative images indicating that cells infected with a retrovirus encoding NeuroDl and GFP (14 DPI) were positive for NeuN in 7-month old WT mice (n = 4), scale bar, 40 μιη. In Figure 15A, NeuroDl-GFP fluorescence is shown in the left panel, NeuN immunostaining is shown in the middle panel and the overlap of NeuroDl -GFP fluorescence and NeuN immunostaining in the same field is shown in the right panel. [00404] Figure 15B shows representative images indicating that NeuroDl -converted neurons (16 DPI) showed robust dendrites in 14 month old animals (n = 3), scale bar, 40 μιη. In Figure 15B, NeuroDl -GFP fluorescence is shown in the left panel and the overlap of NeuroDl -GFP fluorescence and DAPI fluorescence in the same field is shown in the right panel. Figure 15C shows representative images indicating that even in 14 month old 5xFAD mice, there were many NeuroDl -converted neurons (14 DPI) in the vicinity of Αβ deposits (n = 6), scale bar, 40 μιη. This result suggests that NeuroDl conversion method may be used in aging brains to restore lost neuronal functions. In Figure 15C, NeuroDl-GFP fluorescence is shown in the left panel, Αβ42 immunostaining is shown in the middle panel and the overlap of NeuroDl -GFP fluorescence and Αβ42 immunostaining in the same field is shown in the right panel.
[00405] Example 29
[00406] No intermediate neuroprogenitor stage during human astrocyte-neuron conversion
[00407] Figure 16 shows representative images indicating that cells infected with a retrovirus encoding NeuroDl (arrowheads) did not show any increase in the expression of neural stem cell marker Musashi over 1, 3 and 5 days post infection (DPI). Scale bar, 40 μιη. n = 3 cultures. In Figure 16, NeuroDl-GFP fluorescence is shown in the left panel, Musashi immunostaining is shown in the middle panel and the overlap of NeuroDl-GFP fluorescence and Musashi immunostaining in the same field is shown in the right panel, along with DAPI fluorescence.
[00408] Example 30
[00409] Properties of human astrocyte-converted neurons after NeuroDl infection
[00410] Figure 17A and Figure 17B are representative images showing glutamate immunostaining in mouse cultured neurons (7 DIV) and NeuroDl -converted neurons generated by infection of human astrocytes with a retrovirus encoding NeuroDl (21 DPI, 98.4 + 0.9% positive for glutamate), respectively, scale bars, 40 μιη. for Figure 17A, 20 μιη for Figure 17B. n = 3 cultures.
[00411] Figure 17C and Figure 17D are representative images showing GAB A immunostaining in mouse cultured neurons (7 DIV) and NeuroDl -converted neurons generated by infection of human astrocytes with a retrovirus encoding NeuroDl (21 DPI, 1.4 + 0.1% positive for GABA), respectively, scale bars, 40 μιη. n = 3 cultures. [00412] Figure 17E and Figure 17F are representative images showing Tbrl immunostaining in mouse cultured neurons (7 DIV) and NeuroDl -converted neurons generated by infection of human astrocytes with a retrovirus encoding NeuroDl (21 DPI), respectively, scale bars, 40 μιη.
[00413] Example 31
[00414] Human astrocytes can be converted into neurons whereas human microglia cannot.
[00415] Figure 18A shows representative images indicating that the majority of cells in human astrocyte cultures were immunopositive for astrocyte marker SIOO (94.3 + 0.7 %), n = 3-5 cultures, scale bar, 40 μιη. Figure 18B shows representative images indicating that NeuroDl- GFP infected human astrocytes became immunopositive for NeuN (21 DPI), n = 3-5 cultures, scale bar, 40 μιη. The NeuroDl expression was confirmed by NeuroDl immunostaining. Figure 18C shows representative images indicating that NeuroDl -converted neurons generated by infection of human astrocytes with a retrovirus encoding NeuroDl were positive for Proxl (8 DPI), n = 3-5 cultures, scale bar, 40 μιη. Figure 18D shows representative images indicating that the majority of cells in human microglia cultures were positive for Ibal (97.1 + 1.1%), n = 3-5 cultures, scale bar, 40 μιη. Figure 18E and Figure 18F are representative images showing that human microglia could not be converted into neurons by NeuroDl (20 DPI), n = 3-5 cultures, scale bar, 40 μιη. Figure 18G is a graph showing quantitation of cultured human astrocytes immunopositive for SIOO (94.3 + 0.7 %), Ibal and NG2. Figure 18H is a graph showing quantitation of cultured human microglia immunopositive for GFAP, Ibal (97.1 + 1.1%) and NG2.
[00416] Example 32
[00417] NG2 promoter-driven NeuroDl expression in vivo and in vitro:
[00418] A retrovirus encoding NeuroDl and GFP under the control of human NG2 promoter, hNG2:: NeuroDl -IRES -GFP, was generated and used to infect cells in adult mouse cortex. After injecting hNG2:: NeuroDl -IRES -GFP retrovirus into adult mouse cortex, NeuroDl -infected NG2 cells, identified by GFP fluorescence, were immunopositive for NeuN, indicating that NG2 cells were indeed converted into neurons in vivo; 7 DPI. Figure 19A shows representative images obtained after injecting hNG2:: NeuroDl -IRES -GFP retrovirus into one month old mouse cortex. GFP fluorescence is shown in the left panel, NeuN immunofluorescence is shown in the middle panel, identifying NeuN-positive neurons in vivo, arrows, 7 DPI. n = 4 animals. The overlap of GFP fluorescence and NeuN immunofluorescence is shown in the same field in the right panel. Scale bar: 40 μιη.
[00419] Cultured NG2 cells were infected with hNG2: :NeuroDl-IRES-GFP and many NeuN- positive neurons with clear neuronal morphology in NeuroDl -infected NG2 cultures were found; 7 DPI. Thus, NG2 cells can be converted into neurons by NeuroDl. Figure 19B shows representative images obtained after infecting cultured NG2 cells with hNG2::NeuroDl-IRES- GFP retrovirus. GFP fluorescence is shown in the left panel, NeuN immunofluorescence is shown in the middle panel, identifying NeuN-positive neurons in vivo, arrows, 7 DPI. The overlap of GFP fluorescence and NeuN immunofluorescence, along with DAPI staining, is shown in the same field in the right panel. Scale bar: 40 μιη.
[00420] Example 33 - Animal model of focal ischemic stroke I
[00421] In this example, a mouse model for endothelin-1 induced focal ischemic stroke is used to determine the effects of expression of exogenous NeuroDl in glial cells in the stroke injured brain.
[00422] Animals: 3-5 month old C57BL/6 male mice (20-30 gram) are housed in standard cage of animal facility of Penn State University on a 12:12 light/dark cycle. Mice are maintained on a restricted feeding schedule (3g/day) to prevent satiation and motivate reaching performance. One group of mice receives intracortical infusions of endothelin-1 (ET-1); one group of mice receives intracortical infusions of 0.9% sterile saline; one group of mice receives sham procedures.
[00423] Surgery procedure: Mice are anesthetized by using 0.25% Avertin (dissolved in sterile saline, 20ml/kg, i.p.). Tail/foot pinch and corneal response is tested to verify full anesthetization. Temperature is maintained at 37°C through a thermal pad during surgery. The scalp is shaved and cleaned with iodine, then injected with bupivacaine (1 ml/20 g, s.c). Each mouse is then placed in a stereotaxic apparatus; a midline incision is made along the length of shaved area. A small burr hole is drilled through the skull over the center of the forelimb region of the sensorimotor cortex at coordinates of 2.25mm lateral to midline and +0.6mm anterior to Bregma. The dura mater is punctured and a 1ml syringe with a 26 gauge needle is lowered into the cortex to a depth of 700 μιη. 4 μΐ of ET-1 (320 pmol, 0.2 μg/μl in sterile saline) is injected into the cortex for 10 min, and the syringe is left in place for 5 min post-injection to prevent backflow before slowly removed. The burr hole is then filled with gelfoam and covered with UV curing dental cement, and the wound is sutured and covered in antibiotic ointment. After surgery the animal is placed on the thermal pad till fully awaken before returning to its home cage. Of the two sham groups, one group receives all surgical procedures up to the skull opening and the other receives a skull opening and infusion of vehicle (0.9% sterile saline) into the forelimb area of the sensorimotor cortex. Mice are checked in the following days (4- 5 days) after surgery to ensure the normal recovery of mice.
[00424] A behavioral test, the bilateral tactile stimulation test, can be used to assess the induced stroke. For this test, each mouse is placed into a shallow transparent plastic container (8.5cm tall, 18cm in diameter) with an open top and allowed to habituate for lmin. The mouse is picked up and lightly restrained by the scruff while a 1.27 cm long piece of 3mm wide tape is placed onto the ventral side of each paw. The mouse is then placed back into the container and allowed to remove each piece of tape using its teeth. The latency to contact and remove each piece of tape is recorded for five trials, allowing 30 s of rest between each trial.
[00425] NeuroDl retrovirus including SEQ ID NO: 2 or SEQ ID NO: 4 is generated as described in Example 3 and injected into the cortex of mice as described in Example 7. After about two weeks following the injection of NeuroDl, the brains will be examined to confirm an increase in neurons in the vicinity of the NeuroDl retrovirus injection. The bilateral tactile stimulation test can be used to assess improvement of stroke-related behavioral effects.
[00426] Example 34 - Animal model of focal ischemic stroke II
[00427] In this example, a mouse model for photothrombosis-induced focal ischemic stroke is used to determine the effects of expression of exogenous NeuroDl in glial cells in the stroke injured brain.
[00428] Animals: 3-5 month old C57BL/6 male mice (20-30 gram) are housed in standard cage of animal facility of Penn State University on a 12:12 light/dark cycle. Mice are maintained on a restricted feeding schedule (3g/day) to prevent satiation and motivate reaching performance. Surgery procedure: Mice are anesthetized by using 0.25% Avertin (dissolved in sterile saline, 20ml/kg body weight, i.p.). Tail/foot pinch and corneal response is tested to verify full anesthetization. Temperature is maintained at 37°C through a thermal pad during surgery. The skin above the skull is incised, and a fiber-optic bundle mounted on a cold light source (diameter 5 1.5 mm, wavelength 560 nm, aperture B2, 1750K, KL 1500 LCD) is placed over the right hemisphere with a focus at 2.25mm lateral to midline and +0.6mm anterior to Bregma. The photosensitive dye rose Bengal (dissolved in artificial cerebral spinal fluid) is injected into the lateral tail vein (30mg/kg body weight). Focal illumination of the skull starts immediately after the injection, which lasts for 20 min. After the induction of thrombosis, the incision is sutured and the animal is placed on the thermal pad till fully awaken before returning to its home cage. The placement of the light beam, the light intensity, and the light aperture are the same for all animals. Of the sham group, mice receive all surgical procedures except for light irradiation. Mice are checked in the following days (4- 5 days) after surgery to ensure the normal recovery of mice.
[00429] A behavioral test, the bilateral tactile stimulation test, can be used to assess the induced stroke. For this test, each mouse is placed into a shallow transparent plastic container (8.5cm tall, 18cm in diameter) with an open top and allowed to habituate for lmin. The mouse is picked up and lightly restrained by the scruff while a 1.27 cm long piece of 3mm wide tape is placed onto the ventral side of each paw. The mouse is then placed back into the container and allowed to remove each piece of tape using its teeth. The latency to contact and remove each piece of tape is recorded for five trials, allowing 30 s of rest between each trial.
[00430] NeuroDl retrovirus including SEQ ID NO: 2 or SEQ ID NO: 4 is generated as described in Example 3 and injected into the cortex of mice as described in Example 7. After about two weeks following the injection of NeuroDl, the brains will be examined to confirm an increase in neurons in the vicinity of the NeuroDl retrovirus injection. The bilateral tactile stimulation test can be used to assess improvement of stroke-related behavioral effects.
[00431] Example 35 - Animal model of spinal cord injury
[00432] In this example, a mouse model for spinal cord injury is used to determine the effects of expression of exogenous NeuroDl in glial cells in the injured spinal cord.
[00433] Animals to be used in this example are female C57B/6 mice (22-29 g) Prior to surgery a heating pad is pre-heated to maintain a temperature range of 36.6-37.1°C throughout the whole surgery process. Mice are anesthetized by injecting 15ml/kg 0.25% Avertin into the peritoneum. After mouse is immobilized shave the skin of back. Cover eyes with ointment.
Place the mouse on the heating pad with back up, disinfecting the back twice with 70% alcohol. Before proceeding the mouse is checked to insure that there is no reflex to a toe pinch. Then, a 1.3 cm dorsal median incision is to be made over the thoracic vertebral column incision on the back. The caudal part of the nuchal ligament and the underlying trapezius muscle from its origin of the spinal processes is cut to expose the spinous processes of T8-T10. A fine pair of rongeurs is used to make a laminectomy of vertebra T9-T10, being careful not to damage the dura. Once the spinal cord is exposed, either of two methods will be used for injury: 1) using a pair of forceps, the spinal process of T9 is held and lifted to open the intervertebral space. A pair of modified forceps is used to laterally compress the spinal cord to the thickness of 0.3 mm and is held with the forceps for 15 sec or 2) a pair of forceps is used to hold and slightly lift the spinal process of T9 to open the intervertebral space. The cord is transected with a microscalpel (5 mm blade depth, 15°; Roboz Surgical Instruments) in one movement from the right to the left. The cut is redone a second time from the left to the right taking great care to slide with the tip of the scalpel over the osseous surface of the spinal canal to ensure complete transection. A sham injury control group will receive identical treatment, including exposure, laminectomy and placement of the forceps around the spinal cord, but no crush or transaction injury would be inflicted. The breath and heartbeat of each animal is monitored throughout the whole surgery procedure. Then, the autochtone muscles and the trapezius muscles of both sides are repositioned and gently opposed muscles by closed three single sutures using 10-0 Ethilon (7718G, Ethicon). The skin is closed with the same suture.
[00434] Post-surgery care: each mouse is kept on a heating pad until it wakes up after which it is transferred to its cage with bedding, enough water and soft food.
[00435] Immediately following the surgery and for an additional day, 1ml Ringer's solution for hydration and buprenorphine (0.01 mg/kg) will be subcutaneously injected twice daily for 3 days to alleviate pain. Each mouse is checked every day post-surgery and the bladder manually evacuated twice daily until the mouse can spontaneously micturate. Each mouse will be intraperitoneally injected with 0.01ml antibiotics Baytril to prevent bladder infection.
[00436] NeuroDl retrovirus including SEQ ID NO: 2 or SEQ ID NO: 4 is generated as described in Example 3 and will be injected into the spinal cord of mice at the site of the spinal cord injury. After about two weeks following the injection of NeuroDl, the spinal cords will be examined to confirm an increase in neurons in the vicinity of the NeuroDl retrovirus injection.
[00437] Example 36 - Effect of expression of exogenous Dlx2 converted human astrocytes into GABAergic and glutamatergic neurons in cell culture
[00438] Expression of exogenous Dlx2 in cultured human astrocytes changed astrocytes into GAD-positive GABAergic neurons, which showed repetitive action potentials and GABAergic events. Occasionally, some glutamatergic events were also detected, suggesting that Dlx2 can convert human astrocytes into both GABAergic and glutamatergic neurons.
[00439] Example 37 - Converting reactive astrocytes into neurons in non-human primates [00440] Conversion of reactive astrocytes into neurons will be performed using non-human primates, such as marmoset or macaque monkeys, to introduce human NeuroDl into reactive astrocytes after stroke (similar to that described in Example 33 and 34) or spinal cord injury (similar to that described in Example 35) to convert them into functional neurons. NeuroDl can be introduced into animals through retrovirus or adeno-associated virus that contain astroglial specific promoter GFAP to allow expression of NeuroDl only in astrocytes. Nanoparticles that can bind with plasmids or viral particles can also be used to introduce NeuroDl into glial cells for neuronal conversion.
[00441] Sequences
[00442] SEQ ID NO:l - Human NeuroDl nucleic acid sequence encoding human NeuroDl protein - 1071 nucleotides, including stop codon
ATGACCAAATCGTACAGCGAGAGTGGGCTGATGGGCGAGCCTCAGCCCCAAGGTCCTCCAAGCT GGACAGACGAGTGTCTCAGTTCTCAGGACGAGGAGCACGAGGCAGACAAGAAGGAGGACGACCT CGAAGCCATGAACGCAGAGGAGGACTCACTGAGGAACGGGGGAGAGGAGGAGGACGAAGATGAG GACCTGGAAGAGGAGGAAGAAGAGGAAGAGGAGGATGACGATCAAAAGCCCAAGAGACGCGGCC CCAAAAAGAAGAAGATGACTAAGGCTCGCCTGGAGCGTTTTAAATTGAGACGCATGAAGGCTAA CGCCCGGGAGCGGAACCGCATGCACGGACTGAACGCGGCGCTAGACAACCTGCGCAAGGTGGTG CCTTGCTATTCTAAGACGCAGAAGCTGTCCAAAATCGAGACTCTGCGCTTGGCCAAGAACTACA TCTGGGCTCTGTCGGAGATCCTGCGCTCAGGCAAAAGCCCAGACCTGGTCTCCTTCGTTCAGAC GCTTTGCAAGGGCTTATCCCAACCCACCACCAACCTGGTTGCGGGCTGCCTGCAACTCAATCCT CGGACTTTTCTGCCTGAGCAGAACCAGGACATGCCCCCCCACCTGCCGACGGCCAGCGCTTCCT TCCCTGTACACCCCTACTCCTACCAGTCGCCTGGGCTGCCCAGTCCGCCTTACGGTACCATGGA CAGCTCCCATGTCTTCCACGTTAAGCCTCCGCCGCACGCCTACAGCGCAGCGCTGGAGCCCTTC TTTGAAAGCCCTCTGACTGATTGCACCAGCCCTTCCTTTGATGGACCCCTCAGCCCGCCGCTCA GCATCAATGGCAACTTCTCTTTCAAACACGAACCGTCCGCCGAGTTTGAGAAAAATTATGCCTT TACCATGCACTATCCTGCAGCGACACTGGCAGGGGCCCAAAGCCACGGATCAATCTTCTCAGGC ACCGCTGCCCCTCGCTGCGAGATCCCCATAGACAATATTATGTCCTTCGATAGCCATTCACATC ATGAGCGAGTCATGAGTGCCCAGCTCAATGCCATATTTCATGATTAG
[00443] SEQ ID NO:2 - Human NeuroDl amino acid sequence - 356 amino acids - encoded by SEQ ID NO: 1
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDE DLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKW PCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNP RTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPF FESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSG TAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
[00444] SEQ ID NO: 3 - Mouse NeuroDl nucleic acid sequence encoding mouse NeuroDl protein - 1074 nucleotides, including stop codon
ATGACCAAATCATACAGCGAGAGCGGGCTGATGGGCGAGCCTCAGCCCCAAGGTCCCCCAAGCT GGACAGATGAGTGTCTCAGTTCTCAGGACGAGGAACACGAGGCAGACAAGAAAGAGGACGAGCT TGAAGCCATGAATGCAGAGGAGGACTCTCTGAGAAACGGGGGAGAGGAGGAGGAGGAAGATGAG GATCTAGAGGAAGAGGAGGAAGAAGAAGAGGAGGAGGAGGATCAAAAGCCCAAGAGACGGGGTC CCAAAAAGAAAAAGATGACCAAGGCGCGCCTAGAACGTTTTAAATTAAGGCGCATGAAGGCCAA CGCCCGCGAGCGGAACCGCATGCACGGGCTGAACGCGGCGCTGGACAACCTGCGCAAGGTGGTA CCTTGCTACTCCAAGACCCAGAAACTGTCTAAAATAGAGACACTGCGCTTGGCCAAGAACTACA TCTGGGCTCTGTCAGAGATCCTGCGCTCAGGCAAAAGCCCTGATCTGGTCTCCTTCGTACAGAC GCTCTGCAAAGGTTTGTCCCAGCCCACTACCAATTTGGTCGCCGGCTGCCTGCAGCTCAACCCT CGGACTTTCTTGCCTGAGCAGAACCCGGACATGCCCCCGCATCTGCCAACCGCCAGCGCTTCCT TCCCGGTGCATCCCTACTCCTACCAGTCCCCTGGACTGCCCAGCCCGCCCTACGGCACCATGGA CAGCTCCCACGTCTTCCACGTCAAGCCGCCGCCACACGCCTACAGCGCAGCTCTGGAGCCCTTC TTTGAAAGCCCCCTAACTGACTGCACCAGCCCTTCCTTTGACGGACCCCTCAGCCCGCCGCTCA GCATCAATGGCAACTTCTCTTTCAAACACGAACCATCCGCCGAGTTTGAAAAAAATTATGCCTT TACCATGCACTACCCTGCAGCGACGCTGGCAGGGCCCCAAAGCCACGGATCAATCTTCTCTTCC GGTGCCGCTGCCCCTCGCTGCGAGATCCCCATAGACAACATTATGTCTTTCGATAGCCATTCGC ATCATGAGCGAGTCATGAGTGCCCAGCTTAATGCCATCTTTCACGATTAG
[00445] SEQ ID NO:4 - Mouse NeuroDl amino acid sequence - 357 amino acids - encoded by SEQ ID NO: 3
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDELEAMNAEEDSLRNGGEEEEEDE DLEEEEEEEEEEEDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKW PCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNP RTFLPEQNPDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPF FESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGPQSHGSIFSS GAAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
[00446] Mouse LCN2 promoter - SEQ ID NO : 5
GCAGTGTGGAGACACACCCACTTTCCCCAAGGGCTCCTGCTCCCCCAAGTGATCCCCTTATCCT CCGTGCTAAGATGACACCGAGGTTGCAGTCCTTACCTTTGAAAGCAGCCACAAGGGCGTGGGGG TGCACACCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCAGATTTCTGAGTTCGAGACCAGC CTGGTCTACAAAGTGAATTCCAGGACAGCCAGGGCTATACAGAGAAACCCTGTCTTGAAAAAAA AAGAGAAAGAAAAAAGAAAAAAAAAAATGAAAGCAGCCACATCTAAGGACTACGTGGCACAGGA GAGGGTGAGTCCCTGAGAGTTCAGCTGCTGCCCTGTCTGTTCCTGTAAATGGCAGTGGGGTCAT GGGAAAGTGAAGGGGCTCAAGGTATTGGACACTTCCAGGATAATCTTTTGGACGCCTCACCCTG TGCCAGGACCAAGGCTGAGCTTGGCAGGCTCAGAACAGGGTGTCCTGTTCTTCCCTGTCTAAAA CATTCACTCTCAGCTTGCTCACCCTTCCCCAGACAAGGAAGCTGCACAGGGTCTGGTGTTCAGA TGGCTTTGGCTTACAGCAGGTGTGGGTGTGGGGTAGGAGGCAGGGGGTAGGGGTGGGGGAAGCC TGTACTATACTCACTATCCTGTTTCTGACCCTCTAGGACTCCTACAGGGTTATGGGAGTGGACA GGCAGTCCAGATCTGAGCTGCTGACCCACAAGCAGTGCCCTGTGCCTGCCAGAATCCAAAGCCC TGGGAATGTCCCTCTGGTCCCCCTCTGTCCCCTGCAGCCCTTCCTGTTGCTCAACCTTGCACAG TTCCGACCTGGGGGAGAGAGGGACAGAAATCTTGCCAAGTATTTCAACAGAATGTACTGGCAAT TACTTCATGGCTTCCTGGACTTGGTAAAGGATGGACTACCCCGCCCAACAGGGGGGCTGGCAGC CAGGTAGGCCCATAAAAAGCCCGCTGGGGAGTCCTCCTCACTCTCTGCTCTTCCTCCTCCAGCA CAC AT C AGAC C TAG T AGC T GT G GAAAC C A
[00447] Human GFAP promoter - SEQ ID NO: 6
GTCTGCAAGCAGACCTGGCAGCATTGGGCTGGCCGCCCCCCAGGGCCTCCTCTTCATGCCCAGT GAATGACTCACCTTGGCACAGACACAATGTTCGGGGTGGGCACAGTGCCTGCTTCCCGCCGCAC CCCAGCCCCCCTCAAATGCCTTCCGAGAAGCCCATTGAGTAGGGGGCTTGCATTGCACCCCAGC CTGACAGCCTGGCATCTTGGGATAAAAGCAGCACAGCCCCCTAGGGGCTGCCCTTGCTGTGTGG CGCCACCGGCGGTGGAGAACAAGGCTCTATTCAGCCTGTGCCCAGGAAAGGGGATCAGGGGATG CCCAGGCATGGACAGTGGGTGGCAGGGGGGGAGAGGAGGGCTGTCTGCTTCCCAGAAGTCCAAG GACACAAATGGGTGAGGGGACTGGGCAGGGTTCTGACCCTGTGGGACCAGAGTGGAGGGCGTAG ATGGACCTGAAGTCTCCAGGGACAACAGGGCCCAGGTCTCAGGCTCCTAGTTGGGCCCAGTGGC TCCAGCGTTTCCAAACCCATCCATCCCCAGAGGTTCTTCCCATCTCTCCAGGCTGATGTGTGGG AACTCGAGGAAATAAATCTCCAGTGGGAGACGGAGGGGTGGCCAGGGAAACGGGGCGCTGCAGG AATAAAGACGAGCCAGCACAGCCAGCTCATGCGTAACGGCTTTGTGGAGCTGTCAAGGCCTGGT CTCTGGGAGAGAGGCACAGGGAGGCCAGACAAGGAAGGGGTGACCTGGAGGGACAGATCCAGGG GCTAAAGTCCTGATAAGGCAAGAGAGTGCCGGCCCCCTCTTGCCCTATCAGGACCTCCACTGCC ACATAGAGGCCATGATTGACCCTTAGACAAAGGGCTGGTGTCCAATCCCAGCCCCCAGCCCCAG AACTCCAGGGAATGAATGGGCAGAGAGCAGGAATGTGGGACATCTGTGTTCAAGGGAAGGACTC CAGGAGTCTGCTGGGAATGAGGCCTAGTAGGAAATGAGGTGGCCCTTGAGGGTACAGAACAGGT TCATTCTTCGCCAAATTCCCAGCACCTTGCAGGCACTTACAGCTGAGTGAGATAATGCCTGGGT TATGAAATCAAAAAGTTGGAAAGCAGGTCAGAGGTCATCTGGTACAGCCCTTCCTTCCCTTTTT TTTTTTTTTTTTTTGTGAGACAAGGTCTCTCTCTGTTGCCCAGGCTGGAGTGGCGCAAACACAG CTCACTGCAGCCTCAACCTACTGGGCTCAAGCAATCCTCCAGCCTCAGCCTCCCAAAGTGCTGG GATTACAAGCATGAGCCACCCCACTCAGCCCTTTCCTTCCTTTTTAATTGATGCATAATAATTG TAAGTATTCATCATGGTCCAACCAACCCTTTCTTGACCCACCTTCCTAGAGAGAGGGTCCTCTT GATTCAGCGGTCAGGGCCCCAGACCCATGGTCTGGCTCCAGGTACCACCTGCCTCATGCAGGAG TTGGCGTGCCCAGGAAGCTCTGCCTCTGGGCACAGTGACCTCAGTGGGGTGAGGGGAGCTCTCC CCATAGCTGGGCTGCGGCCCAACCCCACCCCCTCAGGCTATGCCAGGGGGTGTTGCCAGGGGCA CCCGGGCATCGCCAGTCTAGCCCACTCCTTCATAAAGCCCTCGCATCCCAGGAGCGAGCAGAGC CAGAGCAT
[00448] Mouse AldhlLl promoter - SEQ ID NO:7
AACTGAGAGTGGAGGGGCACAGAAGAGCCCAAGAGGCTCCTTAGGTTGTGTGGAGGGTACAATA TGTTTGGGCTGAGCAACCCAGAGCCAGACTTTGTCTGGCTGGTAAGAGACAGAGGTGCCTGCTA TCACAATCCAAGGGTCTGCTTGAGGCAGAGCCAGTGCAAAGGATGTGGTTAGAGCCAGCCTGGT GTACTGAAGAGGGGCGAAGAGCTTGAGTAAGGAGTCTCAGCGGTGGTTTGAGAGGCAGGGTGGT TAATGGAGTAGCTGCAGGGGAGAATCCTTGGGAGGGAGCCTGCAGGACAGAGCTTTGGTCAGGA AGTGATGGGCATGTCACTGGACCCTGTATTGTCTCTGACTTTTCTCAAGTAGGACAATGACTCT GCCCAGGGAGGGGGTCTGTGACAAGGTGGAAGGGCCAGAGGAGAACTTCTGAGAAGAAAACCAG AGGCCGTGAAGAGGTGGGAAGGGCATGGGATTCAGAACCTCAGGCCCACCAGGACACAACCCCA GGTCCACAGCAGATGGGTGACCTTGCATGTCTCAGTCACCAGCATTGTGCTCCTTGCTTATCAC GCTTGGGTGAAGGAAATGACCCAAATAGCATAAAGCCTGAAGGCCGGGACTAGGCCAGCTAGGG CTTGCCCTTCCCTTCCCAGCTGCACTTTCCATAGGTCCCACCTTCAGCAGATTAGACCCGCCTC CTGCTTCCTGCCTCCTTGCCTCCTCACTCATGGGTCTATGCCCACCTCCAGTCTCGGGACTGAG GCTCACTGAAGTCCCATCGAGGTCTGGTCTGGTGAATCAGCGGCTGGCTCTGGGCCCTGGGCGA CCAGTTAGGTTCCGGGCATGCTAGGCAATGAACTCTACCCGGAATTGGGGGTGCGGGGAGGCGG GGAGGTCTCCAACCCAGCCTTTTGAGGACGTGCCTGTCGCTGCACGGTGCTTTTTATAGACGAT GGTGGCCCATTTTGCAGAAGGGAAAGCCGGAGCCCTCTGGGGAGCAAGGTCCCCGCAAATGGAC GGATGACCTGAGCTTGGTTCTGCCAGTCCACTTCCCAAATCCCTCACCCCATTCTAGGGACTAG GGAAAGATCTCCTGATTGGTCATATCTGGGGGCCTGGCCGGAGGGCCTCCTATGATTGGAGAGA TCTAGGCTGGGCGGGCCCTAGAGCCCGCCTCTTCTCTGCCTGGAGGAGGAGCACTGACCCTAAC CCTCTCTGCACAAGACCCGAGCTTGTGCGCCCTTCTGGGAGCTTGCTGCCCCTGTGCTGACTGC TGACAGCTGACTGACGCTCGCAGCTAGCAGGTACTTCTGGGTTGCTAGCCCAGAGCCCTGGGCC GGTGACCCTGTTTTCCCTACTTCCCGTCTTTGACCTTGGGTAAGTTTCTTTTTCTTTTGTTTTT GAGAGAGGCACCCAGATCCTCTCCACTACAGGCAGCCGCTGAACCTTGGATCCTCAGCTCCTGC CCTGGGAACTACAGTTCCTGCCCTTTTTTTCCCACCTTGAGGGAGGTTTTCCCTGAGTAGCTTC GACTATCCTGGAACAAGCTTTGTAGACCAGCCTGGGTCTCCGGAGAGTTGGGATTAAAGGCGTG CACCACCACC
[00449] Human NG2 promoter - SEQ ID NO: 8
CTCTGGTTTCAAGACCAATACTCATAACCCCCACATGGACCAGGCACCATCACACCTGAGCACT GCACTTAGGGTCAAAGACCTGGCCCCACATCTCAGCAGCTATGTAGACTAGCTCCAGTCCCTTA ATCTCTCTCAGCCTCAGTTTCTTCATCTGCAAAACAGGTCTCAGTTTCGTTGCAAAGTATGAAG TGCTGGGCTGTTACTGGTCAAAGGGAAGAGCTGGGAAGAGGGTGCAAGGTGGGGTTGGGCTGGA GATGGGCTGGAGCAGATAGATGGAGGGACCTGAATGGAGGAAGTAAACCAAGGCCCGGTAACAT TGGGACTGGACAGAGAACACGCAGATCCTCTAGGCACCGGAAGCTAAGTAACATTGCCCTTTCT CCTCCTGTTTGGGACTAGGCTGATGTTGCTGCCTGGAAGGGAGCCAGCAGAAGGGCCCCAGCCT GAAGCTGTTAGGTAGAAGCCAAATCCAGGGCCAGATTTCCAGGAGGCAGCCTCGGGAAGTTGAA ACACCCGGATTCAGGGGTCAGGAGGCCTGGGCTTCTGGCACCAAACGGCCAGGGACCTACTTTC CACCTGGAGTCTTGTAAGAGCCACTTTCAGCTTGAGCTGCACTTTCGTCCTCCATGAAATGGGG GAGGGGATGCTCCTCACCCACCTTGCAAGGTTATTTTGAGGCAAATGTCATGGCGGGACTGAGA ATTCTTCTGCCCTGCGAGGAAATCCAGACATCTCTCCCTTACAGACAGGGAGACTGAGGTGAGG CCCTTCCAGGCAGAGAAGGTCACTGTTGCAGCCATGGGCAGTGCCCCACAGGACCTCGGGTGGT GCCTCTGGAGTCTGGAGAAGTTCCTAGGGGACCTCCGAGGCAAAGCAGCCCAAAAGCCGCCTGT GAGGGTGGCTGGTGTCTGTCCTTCCTCCTAAGGCTGGAGTGTGCCTGTGGAGGGGTCTCCTGAA CTCCCGCAAAGGCAGAAAGGAGGGAAGTAGGGGCTGGGACAGTTCATGCCTCCTCCCTGAGGGG GTCTCCCGGGCTCGGCTCTTGGGGCCAGAGTTCAGGGTGTCTGGGCCTCTCTATGACTTTGTTC TAAGTCTTTAGGGTGGGGCTGGGGTCTGGCCCAGCTGCAAGGGCCCCCTCACCCCTGCCCCAGA GAGGAACAGCCCCGCACGGGCCCTTTAAGAAGGTTGAGGGTGGGGGCAGGTGGGGGAGTCCAAG CCTGAAACCCGAGCGGGCGCGCGGGTCTGCGCCTGCCCCGCCCCCGGAGTTAAGTGCGCGGACA CCCGGAGCCGGCCCGCGCCCAGGAGCAGAGCCGCGCTCGCTCCACTCAGCTCCCAGCTCCCAGG ACTCCGCTGGCTCCTCGCAAGTCCTGCCGCCCAGCCCGCCGGG
[00450] CAG: :NeuroDl-IRES-GFP - SEQ ID NO:9
GATCCGGCCATTAGCCATATTATTCATTGGTTATATAGCATAAATCAATATTGGCTATTGGCCA TTGCATACGTTGTATCCATATCATAATATGTACATTTATATTGGCTCATGTCCAACATTACCGC CATGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAG CCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAAC GACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCC ATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCA TATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAG TACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCA TGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCC AAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCA AAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCATGTACGGTGGGAGGTCT ATATAAGCAGAGCTCAATAAAAGAGCCCACAACCCCTCACTCGGGGCGCCAGTCCTCCGATTGA CTGAGTCGCCCGGGTACCCGTATTCCCAATAAAGCCTCTTGCTGTTTGCATCCGAATCGTGGTC TCGCTGTTCCTTGGGAGGGTCTCCTCTGAGTGATTGACTACCCACGACGGGGGTCTTTCATTTG GGGGCTCGTCCGGGATTTGGAGACCCCTGCCCAGGGACCACCGACCCACCACCGGGAGGTAAGC TGGCCAGCAACTTATCTGTGTCTGTCCGATTGTCTAGTGTCTATGTTTGATGTTATGCGCCTGC GTCTGTACTAGTTAGCTAACTAGCTCTGTATCTGGCGGACCCGTGGTGGAACTGACGAGTTCTG AACACCCGGCCGCAACCCTGGGAGACGTCCCAGGGACTTTGGGGGCCGTTTTTGTGGCCCGACC TGAGGAAGGGAGTCGATGTGGAATCCGACCCCGTCAGGATATGTGGTTCTGGTAGGAGACGAGA ACCTAAAACAGTTCCCGCCTCCGTCTGAATTTTTGCTTTCGGTTTGGAACCGAAGCCGCGCGTC TTGTCTGCTGCAGCGCTGCAGCATCGTTCTGTGTTGTCTCTGTCTGACTGTGTTTCTGTATTTG TCTGAAAATTAGGGCCAGACTGTTACCACTCCCTTAAGTTTGACCTTAGGTCACTGGAAAGATG TCGAGCGGATCGCTCACAACCAGTCGGTAGATGTCAAGAAGAGACGTTGGGTTACCTTCTGCTC TGCAGAATGGCCAACCTTTAACGTCGGATGGCCGCGAGACGGCACCTTTAACCGAGACCTCATC ACCCAGGTTAAGATCAAGGTCTTTTCACCTGGCCCGCATGGACACCCAGACCAGGTCCCCTACA TCGTGACCTGGGAAGCCTTGGCTTTTGACCCCCCTCCCTGGGTCAAGCCCTTTGTACACCCTAA GCCTCCGCCTCCTCTTCCTCCATCCGCCCCGTCTCTCCCCCTTGAACCTCCTCGTTCGACCCCG CCTCGATCCTCCCTTTATCCAGCCCTCACTCCTTCTCTAGGCGCCGGAATTCGATGTCGACATT GATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGA GTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCA TTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAAT GGGTGGACTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTAC GCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTA TGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGGTCGAGGTG AGCCCCACGTTCTGCTTCACTCTCCCCATCTCCCCCCCCTCCCCACCCCCAATTTTGTATTTAT TTATTTTTTAATTATTTTGTGCAGCGATGGGGGCGGGGGGGGGGGGGGCGCGCGCCAGGCGGGG CGGGGCGGGGCGAGGGGCGGGGCGGGGCGAGGCGGAGAGGTGCGGCGGCAGCCAATCAGAGCGG CGCGCTCCGAAAGTTTCCTTTTATGGCGAGGCGGCGGCGGCGGCGGCCCTATAAAAAGCGAAGC GCGCGGCGGGCGGGAGTCGCTGCGTTGCCTTCGCCCCGTGCCCCGCTCCGCGCCGCCTCGCGCC GCCCGCCCCGGCTCTGACTGACCGCGTTACTCCCACAGGTGAGCGGGCGGGACGGCCCTTCTCC TCCGGGCTGTAATTAGCGCTTGGTTTAATGACGGCTCGTTTCTTTTCTGTGGCTGCGTGAAAGC CTTAAAGGGCTCCGGGAGGGCCCTTTGTGCGGGGGGGAGCGGCTCGGGGGGTGCGTGCGTGTGT GTGTGCGTGGGGAGCGCCGCGTGCGGCCCGCGCTGCCCGGCGGCTGTGAGCGCTGCGGGCGCGG CGCGGGGCTTTGTGCGCTCCGCGTGTGCGCGAGGGGAGCGCGGCCGGGGGCGGTGCCCCGCGGT GCGGGGGGGCTGCGAGGGGAACAAAGGCTGCGTGCGGGGTGTGTGCGTGGGGGGGTGAGCAGGG GGTGTGGGCGCGGCGGTCGGGCTGTAACCCCCCCCTGCACCCCCCTCCCCGAGTTGCTGAGCAC GGCCCGGCTTCGGGTGCGGGGCTCCGTGCGGGGCGTGGCGCGGGGCTCGCCGTGCCGGGCGGGG GGTGGCGGCAGGTGGGGGTGCCGGGCGGGGCGGGGCCGCCTCGGGCCGGGGAGGGCTCGGGGGA GGGGCGCGGCGGCCCCGGAGCGCCGGCGGCTGTCGAGGCGCGGCGAGCCGCAGCCATTGCCTTT TATGGTAATCGTGCGAGAGGGCGCAGGGACTTCCTTTGTCCCAAATCTGGCGGAGCCGAAATCT GGGAGGCGCCGCCGCACCCCCTCTAGCGGGCGCGGGCGAAGCGGTGCGGCGCCGGCAGGAAGGA AATGGGCGGGGAGGGCCTTCGTGCGTCGCCGCGCCGCCGTCCCCTTCTCCATCTCCAGCCTCGG GGCTGCCGCAGGGGGACGGCTGCCTTCGGGGGGGACGGGGCAGGGCGGGGTTCGGCTTCTGGCG TGTGACCGGCGGCTCTAGAGCCTCTGCTAACCATGTTCATGCCTTCTTCTTTTTCCTACAGCTC CTGGGCAACGTGCTGGTTGTTGTGCTGTCTCATCATTTTGGCAAAGAATTCGCTAGCGGATCCG GCCGCCTCGGCCACCGGTCGCCACCATCGCCACCATGACCAAATCATACAGCGAGAGCGGGCTG ATGGGCGAGCCTCAGCCCCAAGGTCCCCCAAGCTGGACAGATGAGTGTCTCAGTTCTCAGGACG AGGAACACGAGGCAGACAAGAAAGAGGACGAGCTTGAAGCCATGAATGCAGAGGAGGACTCTCT GAGAAACGGGGGAGAGGAGGAGGAGGAAGATGAGGATCTAGAGGAAGAGGAGGAAGAAGAAGAG GAGGAGGAGGATCAAAAGCCCAAGAGACGGGGTCCCAAAAAGAAAAAGATGACCAAGGCGCGCC TAGAACGTTTTAAATTAAGGCGCATGAAGGCCAACGCCCGCGAGCGGAACCGCATGCACGGGCT GAACGCGGCGCTGGACAACCTGCGCAAGGTGGTACCTTGCTACTCCAAGACCCAGAAACTGTCT AAAATAGAGACACTGCGCTTGGCCAAGAACTACATCTGGGCTCTGTCAGAGATCCTGCGCTCAG GCAAAAGCCCTGATCTGGTCTCCTTCGTACAGACGCTCTGCAAAGGTTTGTCCCAGCCCACTAC CAATTTGGTCGCCGGCTGCCTGCAGCTCAACCCTCGGACTTTCTTGCCTGAGCAGAACCCGGAC ATGCCCCCGCATCTGCCAACCGCCAGCGCTTCCTTCCCGGTGCATCCCTACTCCTACCAGTCCC CTGGACTGCCCAGCCCGCCCTACGGCACCATGGACAGCTCCCACGTCTTCCACGTCAAGCCGCC GCCACACGCCTACAGCGCAGCTCTGGAGCCCTTCTTTGAAAGCCCCCTAACTGACTGCACCAGC CCTTCCTTTGACGGACCCCTCAGCCCGCCGCTCAGCATCAATGGCAACTTCTCTTTCAAACACG AACCATCCGCCGAGTTTGAAAAAAATTATGCCTTTACCATGCACTACCCTGCAGCGACGCTGGC AGGGCCCCAAAGCCACGGATCAATCTTCTCTTCCGGTGCCGCTGCCCCTCGCTGCGAGATCCCC ATAGACAACATTATGTCTTTCGATAGCCATTCGCATCATGAGCGAGTCATGAGTGCCCAGCTTA ATGCCATCTTTCACGATTAGGTTTAAACGCGGCCGCGCCCCTCTCCCTCCCCCCCCCCTAACGT TACTGGCCGAAGCCGCTTGGAATAAGGCCGGTGTGCGTTTGTCTATATGTTATTTTCCACCATA TTGCCGTCTTTTGGCAATGTGAGGGCCCGGAAACCTGGCCCTGTCTTCTTGACGAGCATTCCTA GGGGTCTTTCCCCTCTCGCCAAAGGAATGCAAGGTCTGTTGAATGTCGTGAAGGAAGCAGTTCC TCTGGAAGCTTCTTGAAGACAAACAACGTCTGTAGCGACCCTTTGCAGGCAGCGGAACCCCCCA CCTGGCGACAGGTGCCTCTGCGGCCAAAAGCCACGTGTATAAGATACACCTGCAAAGGCGGCAC AACCCCAGTGCCACGTTGTGAGTTGGATAGTTGTGGAAAGAGTCAAATGGCTCTCCTCAAGCGT ATTCAACAAGGGGCTGAAGGATGCCCAGAAGGTACCCCATTGTATGGGATCTGATCTGGGGCCT CGGTGCACATGCTTTACATGTGTTTAGTCGAGGTTAAAAAAACGTCTAGGCCCCCCGAACCACG GGGACGTGGTTTTCCTTTGAAAAACACGATGATAATATGGCCACAACCATGGTGAGCAAGGGCG AGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAA GTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATC TGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGC AGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGA AGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAG GTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGG ACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGC CGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGC GTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCG ACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACAT GGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTAA GTCGACAATCAACCTCTGGATTACAAAATTTGTGAAAGATTGACTGGTATTCTTAACTATGTTG CTCCTTTTACGCTATGTGGATACGCTGCTTTAATGCCTTTGTATCATGCTATTGCTTCCCGTAT GGCTTTCATTTTCTCCTCCTTGTATAAATCCTGGTTGCTGTCTCTTTATGAGGAGTTGTGGCCC GTTGTCAGGCAACGTGGCGTGGTGTGCACTGTGTTTGCTGACGCAACCCCCACTGGTTGGGGCA TTGCCACCACCTGTCAGCTCCTTTCCGGGACTTTCGCTTTCCCCCTCCCTATTGCCACGGCGGA ACTCATCGCCGCCTGCCTTGCCCGCTGCTGGACAGGGGCTCGGCTGTTGGGCACTGACAATTCC GTGGTGTTGTCGGGGAAGCTGACGTCCTTTCCATGGCTGCTCGCCTGTGTTGCCACCTGGATTC TGCGCGGGACGTCCTTCTGCTACGTCCCTTCGGCCCTCAATCCAGCGGACCTTCCTTCCCGCGG CCTGCTGCCGGCTCTGCGGCCTCTTCCGCGTCTTCGCCTTCGCCCTCAGACGAGTCGGATCTCC CTTTGGGCCGCCTCCCCGCCTGGAATTCGAGCTCGAGCTTGTTAACATCGATAAAATAAAAGAT TTTATTTAGTCTCCAGAAAAAGGGGGGAATGAAAGACCCCACCTGTAGGTTTGGCAAGCTAGCT TAAGT AAC GC C AT T T T GC AAGG C AT G GAAAAAT AC AT AAC T G AGAAT AGAGAAG T T C AGAT C AA GGTCAGGAACAGATGGAACAGCTGAATATGGGCCAAACAGGATATCTGTGGTAAGCAGTTCCTG CCCCGGCTCAGGGCCAAGAACAGATGGAACAGCTGAATATGGGCCAAACAGGATATCTGTGGTA AGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGTCCCCAGATGCGGTCCAGCCCTCAGC AGTTTCTAGAGAAC CATC AGAT GTTTCCAGGGTGCCCCAAGGACCTGAAATGACCCTGTGCCTT ATTTGAACTAACCAATCAGTTCGCTTCTCGCTTCTGTTCGCGCGCTTCTGCTCCCCGAGCTCAA TAAAAGAGCCCACAACCCCTCACTCGGGGCGCCAGTCCTCCGATTGACTGAGTCGCCCGGGTAC CCGTGTATCCAATAAACCCTCTTGCAGTTGCATCCGACTTGTGGTCTCGCTGTTCCTTGGGAGG GTCTCCTCTGAGTGATTGACTACCCGTCAGCGGGGGTCTTTCATTTCCGACTTGTGGTCTCGCT GCCTTGGGAGGGTCTCCTCTGAGTGATTGACTACCCGTCAGCGGGGGTCTTCACATGCAGCATG TATCAAAATTAATTTGGTTTTTTTTCTTAAGTATTTACATTAAATGGCCATAGTTGCATTAATG AATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGCGCTCTTCCGCTTCCTCGCTCACTG ACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACG GTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCC AGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATC ACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTT TCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCC GCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGG TGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGC CTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCA GCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGT GGCCTAACTACGGCTACACTAGAAGGACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTAC CTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTT TTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTT CTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATC AAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTGCGGCCGGCCGCAAATCAA TCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTAT CTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACG ATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGG CTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAAC TTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTT AATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTA TGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAA AAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCA CTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTG TGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTG CCCGGCGTCAACACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGA AAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAAC CCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAA AACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATA CTCTTCCTTTTTCAAT
Items
[00451] Item 1. A method of producing a neuronal phenotype in a glial cell, comprising: expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell.
[00452] Item 2. The method of item 1, wherein the glial cell is in vitro.
[00453] Item 3. The method of item 1, wherein the glial cell is in vivo.
[00454] Item 4. The method of any of items 1-3, wherein the glial cell is a human glial cell.
[00455] Item 5. The method of any of items 1-4, wherein the glial cell is a non- human mammalian glial cell.
[00456] Item 6. The method of any of items 1-5, wherein expressing exogenous
NeuroDl comprises delivering an expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[00457] Item 7. The method of any of items 1-6, wherein expressing exogenous NeuroDl comprises delivering a viral expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[00458] Item 8. The method of any of items 1-7, wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
[00459] Item 9. The method of any of items 1-8, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter. [00460] Item 10. The method of any of items 1-9, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell.
[00461] Item 11. An in vitro glial cell comprising exogenous NeuroDl.
[00462] Item 12. An in vitro glial cell comprising an expression vector encoding
NeuroDl.
[00463] Item 13. The in vitro glial cell of item 11 or 12, having a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
[00464] Item 14. The in vitro glial cell of any of items 11-13, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell.
[00465] Item 15. An in vitro glial cell substantially as described herein.
[00466] Item 16. A method of producing a neuronal phenotype in a glial cell substantially as described herein.
[00467] Item 17. A method of treating a neurological condition in a subject in need thereof, comprising: administering a therapeutically effective dose of NeuroDl to a glial cell of the subject; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
[00468] Item 18. The method of treating a neurological condition in a subject in need thereof, according to item 17, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein.
[00469] Item 19. The method of treating a neurological condition in a subject in need thereof, according to item 18, wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO:l or a functional fragment thereof; SEQ ID NO: 3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof. [00470] Item 20. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-19, wherein the neurological condition is characterized by presence of reactive astrocytes.
[00471] Item 21. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-20, wherein the neurological condition is an injury to the central or peripheral nervous system.
[00472] Item 22. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-21, wherein the neurological condition is selected from the group consisting of: Alzheimer disease, Parkinson disease, amyotrophic lateral sclerosis (ALS), epilepsy and stroke.
[00473] Item 23. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-22, wherein administering a therapeutically effective dose of NeuroDl comprises local administration.
[00474] Item 24. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-23, wherein administering a therapeutically effective dose of NeuroDl comprises systemic administration.
[00475] Item 25. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-24, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a ubiquitous promoter.
[00476] Item 26. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-25, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a cell type-specific promoter selected from the group consisting of: an astrocyte-specific promoter and an NG2 cell- specific promoter.
[00477] Item 27. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-26, wherein the expression vector is a viral expression vector.
[00478] Item 28. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-27, wherein the expression vector is a retrovirus. [00479] Item 29. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-28, wherein the expression vector is an adenovirus.
[00480] Item 30. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-28, wherein the expression vector is an adeno- associated virus.
[00481] Item 31. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-28, wherein the expression vector is a lentivirus.
[00482] Item 32. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-24, wherein administering the therapeutically effective dose of NeuroDl comprises administering NeuroDl protein.
[00483] Item 33. The method of treating a neurological condition in a subject in need thereof, according to any of items 17-24, wherein administering the therapeutically effective dose of NeuroDl comprises administering mRNA encoding NeuroDl protein.
[00484] Item 34. A method of treating a neurological condition in a subject in need thereof, comprising: providing a viral expression vector comprising a nucleic acid encoding NeuroDl; and delivering the viral expression vector to the central nervous system or peripheral nervous system of the subject, whereby the viral vector infects dividing cells of the central nervous system or peripheral nervous system, respectively, producing infected cells and whereby exogenous NeuroDl is expressed in the infected cells at a therapeutically effective level, wherein the expression of NeuroDl in the infected cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated.
[00485] Item 35. The method of any of items 17-34, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell.
[00486] Item 36. A method of treating a neurological condition in a subject in need thereof substantially as described herein.
[00487] Item 37. An expression vector, comprising a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl.
[00488] Item 38. The expression vector of item37 wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter.
[00489] Item 39. The expression vector of item37 or 38 wherein the expression vector is a viral vector. [00490] Item 40. The expression vector of any of items 37-39 wherein the expression vector is a retroviral expression vector.
[00491] Item 41. The expression vector of any of items 37-40 wherein the expression vector is an adenovirus, adeno-associated virus or lentivirus.
[00492] Item 42. The expression vector of any of items 37-41 wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter.
[00493] Item 43. The expression vector of any of items 37-41 wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO: l or a functional fragment thereof; SEQ ID NO: 3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
[00494] Item 44. An expression vector, comprising a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl substantially as described herein.
[00495] Any patents or publications mentioned in this specification are incorporated herein by reference to the same extent as if each individual publication is specifically and individually indicated to be incorporated by reference.
[00496] The compositions and methods described herein are presently representative of preferred embodiments, exemplary, and not intended as limitations on the scope of the invention. Changes therein and other uses will occur to those skilled in the art. Such changes and other uses can be made without departing from the scope of the invention as set forth in the claims.

Claims

1. A method of producing a neuronal phenotype in a glial cell, comprising:
expressing exogenous NeuroDl in the glial cell, wherein the glial cell is selected from the group consisting of: an astrocyte, a reactive astrocyte, an NG2 cell and a reactive NG2 cell.
2. The method of claim 1 , wherein the glial cell is in vitro.
3. The method of claim 1, wherein the glial cell is in vivo.
4. The method of any of claims 1-3, wherein the glial cell is a human glial cell.
5. The method of any of claims 1-4, wherein the glial cell is a non-human mammalian glial cell.
6. The method of any of claims 1-5, wherein expressing exogenous NeuroDl comprises delivering an expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
7. The method of any of claims 1-6, wherein expressing exogenous NeuroDl comprises delivering a viral expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
8. The method of any of claims 1-7, wherein expressing exogenous NeuroDl comprises delivering a retrovirus expression vector comprising a nucleic acid encoding NeuroDl to the glial cell.
9. The method of any of claims 1-8, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
10. The method of any of claims 1-9, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell.
11. An in vitro glial cell comprising exogenous NeuroD 1.
12. An in vitro glial cell comprising an expression vector encoding NeuroDl.
13. The in vitro glial cell of claim 11 or 12, having a neuronal phenotype, wherein the neuronal phenotype comprises one or more of: neuronal morphology, expression of one or more neuronal markers, electrophysiologic characteristics of neurons, synapse formation and release of neurotransmitter.
14. The in vitro glial cell of any of claims 11-13, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell.
15. An in vitro glial cell substantially as described herein.
16. A method of producing a neuronal phenotype in a glial cell substantially as described herein.
17. A method of treating a neurological condition in a subject in need thereof, comprising:
administering a therapeutically effective dose of NeuroDl to a glial cell of the subject; whereby exogenous NeuroDl is expressed in the glial cell, producing a neuronal phenotype in the glial cell to ameliorate the neurological condition of the subject.
18. The method of treating a neurological condition in a subject in need thereof, according to claim 17, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein.
19. The method of treating a neurological condition in a subject in need thereof, according to claim 18, wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO:l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
20. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-19, wherein the neurological condition is characterized by presence of reactive astrocytes.
21. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-20, wherein the neurological condition is an injury to the central or peripheral nervous system.
22. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-21, wherein the neurological condition is selected from the group consisting of: Alzheimer disease, Parkinson disease, amyotrophic lateral sclerosis (ALS), epilepsy and stroke.
23. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-22, wherein administering a therapeutically effective dose of
NeuroDl comprises local administration.
24. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-23, wherein administering a therapeutically effective dose of NeuroDl comprises systemic administration.
25. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-24, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a ubiquitous promoter.
26. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-25, wherein administering the therapeutically effective dose of NeuroDl comprises administering an expression vector comprising a nucleic acid sequence encoding NeuroDl protein, the nucleic acid sequence operably linked to a cell type-specific promoter selected from the group consisting of: an astrocyte-specific promoter and an NG2 cell- specific promoter.
27. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-26, wherein the expression vector is a viral expression vector.
28. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-27, wherein the expression vector is a retrovirus.
29. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-28, wherein the expression vector is an adenovirus.
30. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-28, wherein the expression vector is an adeno-associated virus.
31. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-28, wherein the expression vector is a lentivirus.
32. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-24, wherein administering the therapeutically effective dose of NeuroDl comprises administering NeuroDl protein.
33. The method of treating a neurological condition in a subject in need thereof, according to any of claims 17-24, wherein administering the therapeutically effective dose of NeuroDl comprises administering mRNA encoding NeuroDl protein.
34. A method of treating a neurological condition in a subject in need thereof, comprising:
providing a viral expression vector comprising a nucleic acid encoding NeuroDl; and delivering the viral expression vector to the central nervous system or peripheral nervous system of the subject, whereby the viral vector infects dividing cells of the central nervous system or peripheral nervous system, respectively, producing infected cells and whereby exogenous NeuroDl is expressed in the infected cells at a therapeutically effective level, wherein the expression of NeuroDl in the infected cells results in a greater number of neurons in the subject compared to an untreated subject having the same neurological condition, whereby the neurological condition is treated.
35. The method of any of claims 17-34, wherein NeuroDl is the only exogenously expressed transcription factor in the glial cell.
36. A method of treating a neurological condition in a subject in need thereof substantially as described herein.
37. An expression vector, comprising a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl.
38. The expression vector of claim 37 wherein the glial cell specific promoter is an astrocyte specific promoter or an NG2 cell specific promoter.
39. The expression vector of claim 37 or 38 wherein the expression vector is a viral vector.
40. The expression vector of any of claims 37-39 wherein the expression vector is a retroviral expression vector.
41. The expression vector of any of claims 37-40 wherein the expression vector is an adenovirus, adeno-associated virus or lentivirus.
42. The expression vector of any of claims 37-41 wherein the promoter is a GFAP promoter, NG2 promoter, AldhlLl promoter or LCN2 promoter.
43. The expression vector of any of claims 37-41 wherein the nucleic acid sequence encoding NeuroDl protein comprises a nucleic acid sequence selected from the group consisting of: a nucleic acid sequence encoding SEQ ID NO:2 or a functional fragment thereof; a nucleic acid sequence encoding SEQ ID NO:4 or a functional fragment thereof; SEQ ID NO:l or a functional fragment thereof; SEQ ID NO:3 or a functional fragment thereof; and a nucleic acid sequence encoding a protein which has 70%, 71 , 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 81%, 82%, 83%, 84%, 85%, 86%,87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater, identity to SEQ ID NO: 2 or SEQ ID NO: 4, or a functional fragment thereof.
44. An expression vector, comprising a glial cell specific promoter operably linked to a nucleic acid encoding NeuroDl substantially as described herein.
PCT/US2013/051277 2012-07-19 2013-07-19 Regenerating functional neurons for treatment of disease and injury in the nervous system Ceased WO2014015261A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
US14/438,765 US9717804B2 (en) 2012-07-19 2013-07-19 Regenerating functional neurons for treatment of disease and injury in the nervous system
CN202210111624.5A CN114601937A (en) 2012-07-19 2013-07-19 Regenerating functional neurons for treatment of disease and injury in the nervous system
HK16101711.8A HK1213939A1 (en) 2012-07-19 2013-07-19 Regenerating functional neurons for treatment of disease and injury in the nervous system
CN201380048924.2A CN104870634A (en) 2012-07-19 2013-07-19 Regenerating functional neurons for treatment of disease and injury in the nervous system
US15/643,186 US10201619B2 (en) 2012-07-19 2017-07-06 Regenerating functional neurons for treatment of disease and injury in the nervous system
US16/230,364 US11167044B2 (en) 2012-07-19 2018-12-21 Regenerating functional neurons for treatment of disease in the nervous system
US17/502,944 US20220072153A1 (en) 2012-07-19 2021-10-15 Regenerating functional neurons for treatment of disease and injury in the nervous system

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261673471P 2012-07-19 2012-07-19
US61/673,471 2012-07-19
US201361762506P 2013-02-08 2013-02-08
US61/762,506 2013-02-08

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/438,765 A-371-Of-International US9717804B2 (en) 2012-07-19 2013-07-19 Regenerating functional neurons for treatment of disease and injury in the nervous system
US15/643,186 Continuation US10201619B2 (en) 2012-07-19 2017-07-06 Regenerating functional neurons for treatment of disease and injury in the nervous system

Publications (1)

Publication Number Publication Date
WO2014015261A1 true WO2014015261A1 (en) 2014-01-23

Family

ID=49947049

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/051277 Ceased WO2014015261A1 (en) 2012-07-19 2013-07-19 Regenerating functional neurons for treatment of disease and injury in the nervous system

Country Status (4)

Country Link
US (5) US10561742B2 (en)
CN (7) CN113512565A (en)
HK (1) HK1213939A1 (en)
WO (1) WO2014015261A1 (en)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018160712A1 (en) * 2017-02-28 2018-09-07 The Penn State Research Foundation Regenerating functional neurons for treatment of neural injury caused by disruption of blood flow
US10973930B2 (en) 2016-02-18 2021-04-13 The Penn State Research Foundation Generating GABAergic neurons in brains
EP4242141A1 (en) 2022-03-10 2023-09-13 HOLDING FINANCIERE CIUCH En abrégé "H.F.C." Transfer device with overlapping transverse conveyors
WO2024005124A1 (en) 2022-06-30 2024-01-04 アステラス製薬株式会社 Method for producing non-human primate model of cerebral infarction and pharmaceutical composition for treating cerebral infarction
WO2024143444A1 (en) 2022-12-28 2024-07-04 アステラス製薬株式会社 4-aminopiperidine compound, lipid nanoparticles thereof, and pharmaceutical composition containing same
WO2024162304A1 (en) 2023-01-31 2024-08-08 アステラス製薬株式会社 Carbamoyl lipid or urea lipid each having cyclic amine, lipid nanoparticles containing same, and pharmaceutical composition

Families Citing this family (25)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014015261A1 (en) 2012-07-19 2014-01-23 The Penn State Research Foundation Regenerating functional neurons for treatment of disease and injury in the nervous system
CN103667190A (en) * 2012-09-07 2014-03-26 上海吉凯基因化学技术有限公司 Method for forming nerve cells by induction and composition
US20170260501A1 (en) * 2014-11-25 2017-09-14 International Stem Cell Corporation Derivation of neural crest stem cells and uses thereof
US9840542B2 (en) 2015-09-11 2017-12-12 Nomadogen Biotechnologies Inc. Methods and compositions for the packaging of nucleic acids into microglial exosomes for the targeted expression of polypeptides in neural cells
KR102102837B1 (en) 2015-12-04 2020-04-22 더 펜 스테이트 리서어치 파운데이션 Chemical reprogramming of human glial cells into neurons using small molecule mixtures
US10342221B2 (en) * 2016-08-19 2019-07-09 University Of Southern California Generation of an inducible pericyte-specific CRE mouse model
WO2019152857A1 (en) * 2018-02-02 2019-08-08 Gong Chen Methods and materials for treating brain injuries
CN110133272A (en) * 2018-02-09 2019-08-16 北京大学 Method for the excretion body in astroglia source to be enriched with or detected from biological fluid
GB2571544B (en) 2018-02-28 2022-05-18 Bright Instrument Co Ltd Sectioning macrotome
JP2021520200A (en) * 2018-04-11 2021-08-19 ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニアThe Regents Of The University Of California Methods and compositions for reprogramming non-neuronal neurons into neurons and treating neurodegenerative diseases or disorders
CN114364436A (en) * 2019-10-17 2022-04-15 宾州研究基金会 Regenerating functional neurons for the treatment of spinal cord injury and ALS
CA3157518A1 (en) * 2019-10-17 2021-04-22 Gong Chen Regenerating functional neurons for treatment of neurological disorders
AU2020366448A1 (en) * 2019-10-17 2022-05-12 The Penn State Research Foundation Regenerating functional neurons for treatment of hemorrhagic stroke
AU2020391479A1 (en) * 2019-11-25 2022-06-16 The Penn State Research Foundation Brain repair after traumatic brain injury through NeuroDl-mediated astrocyte-to-neuron conversion
CN111227981B (en) * 2020-01-13 2023-01-17 中国医科大学附属盛京医院 A method for constructing an animal model of neuroblastoma adrenal gland orthotopic transplantation
EP4222270A4 (en) * 2020-09-29 2025-02-26 Neuexcell Therapeutics Inc. NEUROD1 VECTOR
WO2022072325A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Neurod1 combination vector
CA3197316A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Neurod1 and dlx2 vector
WO2022072309A1 (en) * 2020-09-29 2022-04-07 NeuExcell Therapeutics Inc. Ascl1 vector
JP2023543360A (en) * 2020-09-29 2023-10-13 ニューエクセル・セラピューティクス・インコーポレイテッド DLX2 vector
US20220098616A1 (en) * 2020-09-29 2022-03-31 NeuExcell Therapeutics Inc. ISL1 and LHX3 VECTOR
US20220160825A1 (en) * 2020-11-25 2022-05-26 The Penn State Research Foundation Brain repair after traumatic brain injury through neurod1-mediated astrocyte-to-neuron conversion
CN117015389A (en) * 2021-03-31 2023-11-07 暨南大学 A drug and method for forming GABAergic neurons
WO2023168346A2 (en) * 2022-03-04 2023-09-07 The Board Of Regents Of The University Of Texas System Methods for neural regeneration and uses thereof
CN117070477A (en) * 2022-05-10 2023-11-17 纽伦捷生物医药科技(上海)有限公司 Functional fragments, combinations and applications for reprogramming of recombinant oncolytic viruses

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6444463B1 (en) * 1994-05-06 2002-09-03 Fred Hutchinson Cancer Research Center Neurogenic differentiation gene neurod3 and methods for inducing differentiation of cells
US7041507B1 (en) * 1999-01-20 2006-05-09 Cedars-Sinai Medical Center Transdiffentiation of transfected epidermal basal cells into neural progenitor cells, neuronal cells and/or glial cells
WO2011050476A1 (en) * 2009-10-31 2011-05-05 New World Laboratories Inc . Methods for reprogramming cells and uses thereof
WO2011097181A2 (en) * 2010-02-04 2011-08-11 Vivoscript,Inc. Compositions and methods for re-programming cells without genetic modification for treatment of neurological disorders

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5695995A (en) 1994-05-06 1997-12-09 Fred Hutchinson Cancer Research Center Neurogenic differentiation (neurod) genes
US6087168A (en) * 1999-01-20 2000-07-11 Cedars Sinai Medical Center Conversion of non-neuronal cells into neurons: transdifferentiation of epidermal cells
US7785601B2 (en) * 2002-12-31 2010-08-31 Sygnis Bioscience Gmbh & Co. Kg Methods of treating neurological conditions with hematopoietic growth factors
US8137960B2 (en) * 2003-12-04 2012-03-20 The United States Of America As Represented By The Department Of Health And Human Services Bovine adeno-associated viral (BAAV) vector and uses thereof
WO2005113812A2 (en) * 2004-04-23 2005-12-01 Invitrogen Corporation Collections of matched biological reagents and methods for identifying matched reagents
CN102099472A (en) * 2008-05-19 2011-06-15 新加坡科技研究局 Nucleic acid molecule and method of targeting gene expression to gliomas
WO2011091048A1 (en) 2010-01-19 2011-07-28 The Board Of Trustees Of The Leland Stanford Junior University Direct conversion of cells to cells of other lineages
US20130210739A1 (en) * 2010-07-21 2013-08-15 Universite Pierre Et Marie Curie (Paris 6) Bhlh proteins and their use as drugs
WO2014015261A1 (en) 2012-07-19 2014-01-23 The Penn State Research Foundation Regenerating functional neurons for treatment of disease and injury in the nervous system

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6444463B1 (en) * 1994-05-06 2002-09-03 Fred Hutchinson Cancer Research Center Neurogenic differentiation gene neurod3 and methods for inducing differentiation of cells
US7041507B1 (en) * 1999-01-20 2006-05-09 Cedars-Sinai Medical Center Transdiffentiation of transfected epidermal basal cells into neural progenitor cells, neuronal cells and/or glial cells
WO2011050476A1 (en) * 2009-10-31 2011-05-05 New World Laboratories Inc . Methods for reprogramming cells and uses thereof
WO2011097181A2 (en) * 2010-02-04 2011-08-11 Vivoscript,Inc. Compositions and methods for re-programming cells without genetic modification for treatment of neurological disorders

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
ROYBON, LAURENT ET AL.: "Neurogenin2 directs granule neruoblast production an amplication while NeuroDl specifies neruonal fate during hippocampal neurogenesis", PLOS ONE, vol. 4, no. 3, 10 March 2009 (2009-03-10), pages 1 - 19 *

Cited By (15)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10973930B2 (en) 2016-02-18 2021-04-13 The Penn State Research Foundation Generating GABAergic neurons in brains
JP2024001178A (en) * 2017-02-28 2024-01-09 ザ ペン ステイト リサーチ ファウンデーション Regeneration of functional neurons for the treatment of nerve damage caused by disruption of blood flow
WO2018160712A1 (en) * 2017-02-28 2018-09-07 The Penn State Research Foundation Regenerating functional neurons for treatment of neural injury caused by disruption of blood flow
JP2020514328A (en) * 2017-02-28 2020-05-21 ザ ペン ステイト リサーチ ファウンデーション Regeneration of functional neurons for the treatment of nerve damage caused by disruption of blood flow
EP3589307A4 (en) * 2017-02-28 2020-01-22 The Penn State Research Foundation REGENERATION OF FUNCTIONAL NEURONES FOR THE TREATMENT OF NEURONAL DAMAGE CAUSED BY BLOOD FLOW INTERRUPTION
JP7364468B2 (en) 2017-02-28 2023-10-18 ザ ペン ステイト リサーチ ファウンデーション Regeneration of functional neurons for the treatment of nerve damage caused by disruption of blood flow
US20200054711A1 (en) * 2017-02-28 2020-02-20 The Penn State Research Foundation Regenerating functional neurons for treatment of neural injury caused by disruption of blood flow
EP4242141A1 (en) 2022-03-10 2023-09-13 HOLDING FINANCIERE CIUCH En abrégé "H.F.C." Transfer device with overlapping transverse conveyors
FR3133386A1 (en) 2022-03-10 2023-09-15 HOLDING FINANCIERE CIUCH En abrégé "H.F.C." TRANSFER DEVICE WITH INTERLOCKED CROSS CONVEYORS
WO2024005124A1 (en) 2022-06-30 2024-01-04 アステラス製薬株式会社 Method for producing non-human primate model of cerebral infarction and pharmaceutical composition for treating cerebral infarction
KR20250028379A (en) 2022-06-30 2025-02-28 아스텔라스세이야쿠 가부시키가이샤 Method for producing a nonhuman primate animal model of cerebral infarction and pharmaceutical composition for treating cerebral infarction
WO2024143444A1 (en) 2022-12-28 2024-07-04 アステラス製薬株式会社 4-aminopiperidine compound, lipid nanoparticles thereof, and pharmaceutical composition containing same
EP4644371A1 (en) 2022-12-28 2025-11-05 Astellas Pharma Inc. 4-aminopiperidine compound, lipid nanoparticles thereof, and pharmaceutical composition containing same
WO2024162304A1 (en) 2023-01-31 2024-08-08 アステラス製薬株式会社 Carbamoyl lipid or urea lipid each having cyclic amine, lipid nanoparticles containing same, and pharmaceutical composition
EP4660189A1 (en) 2023-01-31 2025-12-10 Astellas Pharma Inc. Carbamoyl lipid or urea lipid each having cyclic amine, lipid nanoparticles containing same, and pharmaceutical composition

Also Published As

Publication number Publication date
CN113413469A (en) 2021-09-21
CN113512565A (en) 2021-10-19
CN113559281A (en) 2021-10-29
US20170304463A1 (en) 2017-10-26
US10201619B2 (en) 2019-02-12
CN104870634A (en) 2015-08-26
CN114601937A (en) 2022-06-10
US20150250900A1 (en) 2015-09-10
US20140024599A1 (en) 2014-01-23
CN113559280A (en) 2021-10-29
US9717804B2 (en) 2017-08-01
US11167044B2 (en) 2021-11-09
US10561742B2 (en) 2020-02-18
CN113559282A (en) 2021-10-29
US20220072153A1 (en) 2022-03-10
US20190117797A1 (en) 2019-04-25
HK1213939A1 (en) 2016-07-15

Similar Documents

Publication Publication Date Title
US11167044B2 (en) Regenerating functional neurons for treatment of disease in the nervous system
Heinrich et al. Directing astroglia from the cerebral cortex into subtype specific functional neurons
US20240082352A1 (en) Regenerating functional neurons for treatment of neural injury caused by disruption of blood flow
US20170252484A1 (en) Schwann cells and method for preparing same
CA3162891A1 (en) Brain repair after traumatic brain injury through neurod1-mediated astrocyte-to-neuron conversion
US20260021160A1 (en) Regenerating functional neurons for treatment of spinal cord injury and als
US20220160825A1 (en) Brain repair after traumatic brain injury through neurod1-mediated astrocyte-to-neuron conversion
US20240325488A1 (en) Regenerating functional neurons for treatment of hemorrhagic stroke
JP2025184865A (en) Regeneration of functional neurons for the treatment of neurological disorders
Taha In vivo reprogramming of astrocytes to neurons in tauopathy mouse model and circuit mapping of reprogrammed neurons
HK40078350A (en) Regenerating functional neurons for treatment of neural injury caused by disruption of blood flow
Guo In Vivo Reprogramming for Brain Repair

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13819650

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14438765

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 13819650

Country of ref document: EP

Kind code of ref document: A1