WO2014012014A1 - Methods and products related to protozoan disease - Google Patents

Methods and products related to protozoan disease Download PDF

Info

Publication number
WO2014012014A1
WO2014012014A1 PCT/US2013/050310 US2013050310W WO2014012014A1 WO 2014012014 A1 WO2014012014 A1 WO 2014012014A1 US 2013050310 W US2013050310 W US 2013050310W WO 2014012014 A1 WO2014012014 A1 WO 2014012014A1
Authority
WO
WIPO (PCT)
Prior art keywords
protozoan
substituted
tyrosyl
trna synthetase
unsubstituted
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/050310
Other languages
French (fr)
Inventor
Gregory P. FOURNIER
Eric ALM
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Massachusetts Institute of Technology
Original Assignee
Massachusetts Institute of Technology
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Massachusetts Institute of Technology filed Critical Massachusetts Institute of Technology
Priority to US14/414,557 priority Critical patent/US20150166562A1/en
Publication of WO2014012014A1 publication Critical patent/WO2014012014A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D493/00Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system
    • C07D493/02Heterocyclic compounds containing oxygen atoms as the only ring hetero atoms in the condensed system in which the condensed system contains two hetero rings
    • C07D493/08Bridged systems
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/435Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
    • A61K31/44Non condensed pyridines; Hydrogenated derivatives thereof
    • A61K31/445Non condensed piperidines, e.g. piperocaine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • A61P33/04Amoebicides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • A61P33/06Antimalarials
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D211/00Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings
    • C07D211/92Heterocyclic compounds containing hydrogenated pyridine rings, not condensed with other rings with a hetero atom directly attached to the ring nitrogen atom
    • C07D211/94Oxygen atom, e.g. piperidine N-oxide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D309/00Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings
    • C07D309/02Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having no double bonds between ring members or between ring members and non-ring members
    • C07D309/08Heterocyclic compounds containing six-membered rings having one oxygen atom as the only ring hetero atom, not condensed with other rings having no double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D309/10Oxygen atoms
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • Infectious diseases caused by protozoa are among the leading causes of death throughout the world. Alone, the protozoa from genus Plasmodium -cause of malaria- is considered endemic in more than 100 countries and is the leading cause of death for children. Control efforts generally involve a combination of prevention and treatment methods. To some success, these measures have become standardized as the global effort to defeat malaria has become an international priority. However, effective treatments for malaria, and a variety of other protozoan diseases remain a challenge in the face of emerging drug resistance with a growing incidence within developing nations.
  • the invention is a method for treating protozoan diseases by administering to a subject having a protozoan disease an inhibitor of protozoan tyrosyl- tRNA synthetase in an effective amount to treat the protozoan disease, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase does not inhibit mammalian tyrosyl- tRNA synthetase.
  • the inhibitor of protozoan tyrosyl-tRNA synthetase specifically binds to an adenylate binding pocket of protozoan tyrosyl-tRNA synthetase.
  • the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, K84, C85 and F127 of SEQ ID NO. 1.
  • the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, and F127 of SEQ ID NO. 1.
  • the inhibitor of protozoan tyrosyl-tRNA synthetase is also an inhibitor of bacterial tyrosyl-tRNA synthetase.
  • the inhibitor of protozoan tyrosyl-tRNA synthetase is not an inhibitor of bacterial tyrosyl-tRNA synthetase.
  • the protozoan diseases treated include but are not limited to selection from groups including malaria, toxoplasma, leishmaniasis, giardiasis, trypanosomiasis (Sleeping sickness, Chagas disease), amoebic dysentery, and trichomoniasis.
  • an inhibitor of protozoan tyrosyl-tRNA synthetase includes but is not limited to the compound of Formula (I)
  • each instance of R 1; R 2 , R 3 , and R 4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl.
  • the inhibitors of protozoan tyrosyl- tRNA synthetase include but are not limited to the following: SB 219383, SB 239629, SB 243545, or SB 284485.
  • compositions comprising: an inhibitor of protozoan tyrosyl-tRNA synthetase, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase does not inhibit mammalian or bacterial tyrosyl-tRNA synthetase.
  • Yet another aspect of this invention involves a method of selecting or designing a compound that interacts with a protozoan tyrosyl-tRNA synthetase and modulates protozoan tyrosyl-tRNA synthetase activity, the method comprising the step of assessing the stereochemical complementarity between the compound and a topographic region of protozoan tyrosyl-tRNA synthetase, wherein the topographic region of the protozoan tyrosyl-tRNA synthetase is characterized by at least a portion of the amino acids positioned at an adenylate binding pocket of the protozoan tyrosyl-tRNA synthetase.
  • the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, K84, C85 and F127 of SEQ ID NO. 1.
  • the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, and F127 of SEQ ID NO. 1.
  • compositions comprising an inhibitor of protozoan tyrosyl-tRNA synthetase and an anti-protozoan agent.
  • the inhibitor of protozoan tyrosyl-tRNA synthetase synthetase is a compound of Formula (I):
  • each instance of R 1; R 2 , R 3 , and R4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl.
  • the composition comprises an inhibitor of protozoan tyrosyl-tRNA synthetase and an anti-protozoan agent
  • the inhibitor of protozoan tyrosyl-tRNA synthetase includes but is not limited to SB 219383, SB 239629, SB 243545, and SB 284485.
  • the compound is the formula (I) or (II):
  • R 1 ; R 2 , R 3 , and R 4 is independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl; wherein each instance of R 5 , R 6 , R 7j Rg and R9 is, independently, hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted substituted alkynyl;
  • Formula (II) is not a compound wherein Ri is a butyl ester or OH, and R 2 , R 3 , R4, R5, and R 7 are all OH, R9 are all H and one OH, and R 6 and Rg are both H.
  • Figure 1 shows multiple sequence alignments (SEQ ID NOs. 6-13) of the region of TyrRS corresponding to the unique components of the adenylate binding pocket in protozoa, with 5 unique sites labeled with a box.
  • FIG. 2 shows a chemical structure of SB243545 with important protozoan sites identified.
  • offspring generations horizontal gene transfer is an exchange of genetic material with a different population or species that occurs independently of reproduction, and is subsequently inherited by offspring generations.
  • the invention involves, in some aspects, methods for treating protozoan disease.
  • the therapeutic methods of the invention are accomplished using an inhibitor of protozoan tyrosyl-tRNA synthetase.
  • Tyrosyl-tRNA synthetase is an enzyme that is found in all cells. It plays an important role in the synthesis of proteins.
  • amino acids are joined and specifically ordered to create proteins. Specifically the amino acid tyrosine is added at the proper place in a protein's chain of amino acids as a function of the tyrosyl-tRNA synthetase activity.
  • an "inhibitor of protozoan tyrosyl-tRNA synthetase” as used herein refers to any compound that reduces to any extent, partially or fully or completely inhibits the activity of protozoan tyrosyl-tRNA synthetase.
  • the level of activity of protozoan tyrosyl-tRNA synthetase may be assessed using known in vitro or in vivo assays.
  • the level of protozoan tyrosyl-tRNA synthetase activity may be reduced by 10%, 20%, 30%, 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater. In some embodiments the level of protozoan tyrosyl-tRNA synthetase activity may be reduced by 100%.
  • Compounds useful as inhibitors of the invention may specifically inhibit protozoan tyrosyl-tRNA synthetase.
  • a compound that specifically inhibits protozoan tyrosyl-tRNA synthetase is a compound that reduces to any degree or inhibits protozoan tyrosyl-tRNA synthetase, but that does not therapeutically impact or inhibit human or animal or mammalian tyrosyl-tRNA synthetase.
  • the phrase "therapeutically impact or inhibit human or animal or mammalian tyrosyl-tRNA synthetase" refers to a level of tyrosyl-tRNA synthetase activity.
  • a compound is said to not therapeutically impact human or animal tyrosyl-tRNA synthetase in an in vitro assay of human or animal tyrosyl-tRNA synthetase activity.
  • the compound may inhibit activity of the human or animal tyrosyl-tRNA synthetase by less than 50%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1%, or 0.5%.
  • a compound that specifically inhibits protozoan tyrosyl-tRNA synthetase it is desirable for a compound that specifically inhibits protozoan tyrosyl-tRNA synthetase to be a compound that reduces to any degree or inhibits protozoan and bacterial tyrosyl-tRNA synthetase. In other embodiments it is desirable for a compound that specifically inhibits protozoan tyrosyl-tRNA synthetase to be a compound that reduces to any degree or inhibits protozoan tyrosyl-tRNA synthetase, but that does not therapeutically impact bacterial tyrosyl-tRNA synthetase.
  • the phrase "therapeutically impact bacterial tyrosyl-tRNA synthetase" refers to a level of bacterial tyrosyl-tRNA synthetase activity.
  • a compound is said to not therapeutically impact bacterial tyrosyl-tRNA synthetase in an in vitro assay of bacterial tyrosyl-tRNA synthetase activity.
  • the compound may inhibit activity of the bacterial tyrosyl-tRNA synthetase by less than 50%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1%, or 0.5%.
  • the inhibitor of protozoan tyrosyl-tRNA synthetase may specifically interact with or near an adenylate binding pocket of protozoan tyrosyl-tRNA synthetase.
  • the adenylate binding pocket of protozoan tyrosyl-tRNA synthetase is known in the art.
  • the protozoan and animal tyrosyl-tRNA synthetases have important amino acid distinctions, particularly within this adenylate binding pocket, that create the opportunity for the development of drugs that bind to and disrupt activity of the protozoan tyrosyl-tRNA synthetase without significantly affecting the animal tyrosyl- tRNA synthetase.
  • An exemplary amino acid sequence of a protozoan tyrosyl-tRNA synthetase is provided herein to highlight the adenylate binding pocket and the important amino acid distinctions.
  • the invention is not limited to the exemplified amino acid sequence. Alternative sequences for this and other protozoan tyrosyl-tRNA synthetases are encompassed within the invention.
  • the exemplary amino acid sequence of Plasmodium vivax is:
  • Inhibitors which specifically recognize one or more or all of these amino acids in a Plasmodium and/or bacterial tyrosyl-tRNA synthetase may be useful in the methods of the invention.
  • the inhibitor of protozoan tyrosyl-tRNA synthetase in some aspects is a structural analog of tyrosyl-adenylate, the natural bound substrate of tyrosyl-tRNA synthetase protein (TyrRS).
  • Structural analogs of tyrosyl-adenylate include, for example, naturally occurring tyrosyl-adenylate analog SB-219383, and synthesized derivatives SB-239629, SB-243545, and SB-284485.
  • Other structural analogs include those described in publications such as Qiu et al., Protein Science, 2001, v. 10, p. 2008, Brown et al Bioorganic & Medicinal Chemistry Letters, 2001, v. 11, p. 711, and Jarvest et al Bioorganic & Medicinal Chemistry Letters, 2001, v. 11, p. 715.
  • Novel compounds for the inhibition of protozoan disease causing organisms are also provided. These compounds may be prepared by modifying known analogs such as SB-219383, SB-239629, SB-243545, and SB-284485 to provide improved selective and specific binding and inhibition of protozoan TyrRS. For instance the modifications may be such that they provide altered and preferably improved interactions at unique sites of protein interaction within and near the adenylate binding pocket, as defined in the Plasmodium vivax TyrS protein sequence, at sites F70, Q80, K84, C85, F127, as well as at adjacent structural sites.
  • the inhibitor of protozoan tyrosyl-tRNA synthetase is the compound of formula (I) or (II) or salts thereof.
  • R 1 ; R 2 , R 3 , and R 4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or
  • R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl;
  • R5 is, independently, hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl;
  • the compound of Formula (I) is not a compound wherein R is a butyl ester or OH and R 2 , R 3 , and R ⁇ are all OH,
  • the compound of Formula (II) is not a compound wherein Ri is a butyl ester or OH, and R 2 , R 3 , R4, R5, and R 7 are all OH, R9 are all H and one OH, and R 6
  • the inhibitor of protozoan tyrosyl-tRNA synthetase is selected from the following compounds or salts thereof:
  • the invention also embraces analogs of the specific inhibitors described specifically or through incorporation by reference herein. Analogs are chemically modified versions of these inhibitors.
  • the inhibitor analogs have one or more activities of the specific inhibitors (as described herein), e.g. anti-protozoan activity. The one or more activities are preferably present in the inhibitor analogs in significant amounts, e.g., at greater than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the activity of the specific inhibitors.
  • the one or more activities are preferably present in the inhibitor analogs at greater than 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, or more, of the activity of the specific inhibitors described herein.
  • the inhibitor analogs may not have all of the activities of the specific inhibitors. However, non-active inhibitor analogs, having none of the anti- protozoan activities of specific inhibitors in significant amounts, are not useful in the methods of the invention.
  • useful inhibitors of protozoan tyrosyl-tRNA synthetase include any one or more inhibitors of protozoan tyrosyl-tRNA synthetase including but not limited to SB-219383, SB-239629, SB-243545, and SB-284485 and/or stereoisomeric forms, or pharmaceutically acceptable acid or base addition salt forms thereof or analogs thereof, in therapeutically effective amounts.
  • the following publications describe compounds that are useful as inhibitors of protozoan tyrosyl-tRNA synthetase: Qiu et al., Protein Science, 2001, v. 10, p. 2008, Brown et al Bioorganic & Medicinal Chemistry Letters, 2001, v. 11, p. 711, and Jarvest et al Bioorganic &
  • the disclosures of these publications are incorporated by reference herein in their entirety for the disclosure of inhibitors of tyrosyl-tRNA synthetase that are useful in the methods of the invention.
  • the invention embraces analogs of the specific inhibitors that, while identical in their chemical inhibition and binding of protozoan TyrRS, produce the additional activities of increased cell uptake/persistence, so as to effectively increase their binding and inhibition. For example, some modification of the compound may decrease the charge, allowing for passage through the cell membrane.
  • the compounds are, thus, effective without increase binding affinity or specificity to the target.
  • inhibitor compounds and preparations described herein can be administered as a single dose or in several doses administered over a period of time (e.g. chronic administration at regular intervals of time) as described herein.
  • Methods and compositions of the invention include stereoisomeric forms and pharmaceutically acceptable acid or base addition salt forms of the inhibitors of protozoan tyrosyl-tRNA synthetase.
  • inhibitors of protozoan tyrosyl-tRNA synthetase include, for instance, inhibitory nucleic acids.
  • a protozoan tyrosyl-tRNA synthetase inhibitory nucleic acid causes specific gene knockdown, while avoiding off-target effects, such as knockdown of the human tyrosyl- tRNA synthetase.
  • RNAi RNA interference
  • miRNA microRNA pathway
  • shRNA short hairpin RNA
  • dsRNA double- stranded RNA
  • miRNAs small interfering nucleic acid-based molecules known in the art.
  • vector-based RNAi modalities are used to reduce expression of a gene (e.g., a protozoan tyrosyl- tRNA synthetase) in a cell.
  • a gene e.g., a protozoan tyrosyl- tRNA synthetase
  • therapeutic compositions of the invention comprise an isolated plasmid vector (e.g., any isolated plasmid vector known in the art or disclosed herein) that expresses a small interfering nucleic acid such as an shRNA.
  • the isolated plasmid may comprise a protozoan-specific promoter operably linked to a gene encoding the small interfering nucleic acid.
  • the isolated plasmid vector is packaged in a virus capable of infecting the individual.
  • viruses include adenovirus, retrovirus, lentivirus, adeno-associated virus, and others that are known in the art and disclosed herein.
  • RNAi-based modalities could be employed to inhibit expression of a gene in a cell, such as siRNA-based oligonucleotides and/or altered siRNA-based oligonucleotides.
  • Altered siRNA based oligonucleotides are those modified to alter potency, target affinity, safety profile and/or stability, for example, to render them resistant or partially resistant to intracellular degradation. Modifications, such as phosphorothioates, for example, can be made to oligonucleotides to increase resistance to nuclease degradation, binding affinity and/or uptake.
  • hydrophobization and bioconjugation enhances siRNA delivery and targeting (De Paula et al., RNA.
  • siRNAs with ribo-difluorotoluyl nucleotides maintain gene silencing activity (Xia et al., ASC Chem. Biol. 1(3): 176-83, (2006)).
  • siRNAs with amide-linked oligoribonucleosides have been generated that are more resistant to SI nuclease degradation than unmodified siRNAs (Iwase R et al. 2006 Nucleic Acids Symp Ser 50: 175-176).
  • phosphodiester linkage confers improved serum stability without loss of efficacy (Choung et al., Biochem. Biophys. Res. Commun. 342(3):919-26, 2006).
  • Other molecules that can be used to inhibit expression of a gene include sense and antisense nucleic acids (single or double stranded), ribozymes, peptides, DNAzymes, peptide nucleic acids (PNAs), triple helix forming
  • Antisense and ribozyme suppression strategies have led to the reversal of a tumor phenotype by reducing expression of a gene product or by cleaving a mutant transcript at the site of the mutation (Carter and Lemoine Br. J. Cancer. 67(5):869-76, 1993; Lange et al., Leukemia. 6(11): 1786-94, 1993; Valera et al., J. Biol. Chem. 269(46):28543-6, 1994; Dosaka-Akita et al., Am. J. Clin. Pathol.
  • Ribozymes have also been proposed as a means of both inhibiting gene expression of a mutant gene and of correcting the mutant by targeted trans-splicing (Sullenger and Cech Nature 371(6498):619-22, 1994; Jones et al., Nat. Med. 2(6):643-8, 1996). Ribozyme activity may be augmented by the use of, for example, non-specific nucleic acid binding proteins or facilitator oligonucleotides (Herschlag et al., Embo J. 13(12):2913-24, 1994;
  • Multitarget ribozymes (connected or shotgun) have been suggested as a means of improving efficiency of ribozymes for gene suppression (Ohkawa et al., Nucleic Acids Symp Ser. (29): 121-2, 1993).
  • Triple helix approaches have also been investigated for sequence- specific gene suppression. Triple helix forming oligonucleotides have been found in some cases to bind in a sequence- specific manner (Postel et al., Proc. Natl. Acad. Sci. U.S.A.
  • the diverse array of suppression strategies that can be employed includes the use of DNA and/or RNA aptamers that can be selected to target a protein of interest (e.g, a protozoan tyrosyl-tRNA synthetase).
  • the invention provides methods for the treatment of protozoan disease.
  • Protozoan disease refers to a condition resulting from infection by a host with a protozoan.
  • a host refers to a subject.
  • a subject is a human or non-human animal such as non-human primates, dogs, cats, sheep, goats, cows, pigs, horses and rodents.
  • the invention encompasses the use of the inhibitors described herein alone or in combination with other therapeutics for the treatment of a subject having or at risk of having a protozoan infection.
  • the subject that has had contact with a protozoan and the protozoan has invaded the body of the subject.
  • invade refers to contact by the protozoan with an external surface of the subject, e.g., skin or mucosal membranes and/or refers to the penetration of the external surface of the subject by the protozoan, indirect protozoan penetration of the external surface of the subject by an infected insect, or ingestion of the protozoan via contaminated food or water.
  • a subject at risk of having a protozoan infection is one that has been exposed to or may become exposed to a protozoan or a geographical area in which a protozoan infection has been reported. Further risks include close contact with a human or non-human primate or their tissues infected with the protozoan.
  • Such persons include laboratory or quarantine facility workers who handle non-human primates that have been associated with the disease.
  • hospital staff and family members who care for patients with the disease are at risk if they do not use proper barrier nursing techniques.
  • the methods of the invention are useful for treating a subject in need thereof.
  • a subject in need thereof is a subject having or at risk of having a protozoan infection.
  • treatment or “to treat” refer to both therapeutic and prophylactic treatments. If the subject in need of treatment is experiencing a condition (i.e., has or is having a particular condition), then “treating the condition” refers to ameliorating, reducing or eliminating one or more symptoms arising from the condition.
  • treating the subject refers to reducing the risk of the subject having the condition or, in other words, decreasing the likelihood that the subject will develop an infectious disease to the virus, as well as to a treatment after the subject has been infected in order to fight the infectious disease, e.g., reduce or eliminate it altogether or prevent it from becoming worse.
  • the inhibitors described herein are isolated molecules.
  • An isolated molecule is a molecule that is substantially pure and is free of other substances with which it is ordinarily found in nature or in vivo systems to an extent practical and appropriate for its intended use.
  • the molecular species are sufficiently pure and are sufficiently free from other biological constituents of host cells so as to be useful in, for example, producing pharmaceutical preparations or sequencing if the molecular species is a nucleic acid, peptide, or polysaccharide.
  • an isolated molecular species of the invention may be admixed with a pharmaceutically- acceptable carrier in a pharmaceutical preparation or be mixed with some of the components with which it is associated in nature, the molecular species may comprise only a small percentage by weight of the preparation.
  • the molecular species is nonetheless substantially pure in that it has been substantially separated from the substances with which it may be associated in living systems.
  • Protozoan are typically microscopic, one-celled organisms that are heterotrophic (using organic carbon as a source of energy). They belong to any of the major lineages of protists and, are eukaryotes. As such they possess a "true,” or membrane-bound, nucleus. Many protozoan are symbionts of other organisms. They are able to multiply in humans, which contributes to their survival and also permits serious infections to develop from just a single organism.
  • Some medically important protozoans include Archaezoa (Giardia lamblia, Trichomonas vaginalis), Amoebozoa (Entamoeba histolytica), Apicomplexa (Babesia microti, Cryptosporidium, Cyclospora, Plasmodium, Toxoplasma Gondii), Euglenozoa (Trypanosoma cruzi, T.b. gambiense,T.b.
  • protozoan species include Leishmania aethiopica, Leishmania amazonensis, Leishmania arabica, Leishmania archibaldi, Leishmania aristedesi, Leishmania (Viannia) braziliensis, Leishmania chagasi (syn. Leishmania infantum), Leishmania (Viannia) colombiensis, Leishmania deanei, Leishmania donovani,
  • Leishmania enriettii Leishmania equatorensis, Leishmania forattinil, Leishmania garnhami, Leishmania gerbili, Leishmania (Viannia) guyanensis, Leishmania herreri, Leishmania hertigi, Leishmania infantum, Leishmania killicki, Leishmania (Viannia) lainsoni, Leishmania major, Leishmania mexicana, Leishmania (Viannia) naiffi,
  • Leishmania (Viannia) panamensis, Leishmania (Viannia) peruviana, Leishmania
  • T. congolense which causes nagana in cattle, horses, and camels
  • T. evansi which causes one form of the disease surra in certain animals (human infection reported in 2005 in India)
  • Trypanosoma lewisi Trypanosoma melophagium
  • Trypanosoma percae Trypanosoma rangeli
  • T. rotatorium in amphibian
  • T. simiae which causes nagana in animals, T. suis, T. theileri, T. triglae in marine teleosts, T.
  • vivax which causes the disease nagana, Trichomonas vaginalis, Entamoeba histolytica, Giardia lamblia, Eimeria acervulina, Eimeria tenella, Eimeria maxima, and Sarcocystis species, particularly the species that infect humans, opposums, and horses.
  • the protozoan disease does not include disease associated with fungal or yeast infections or Candida or worms.
  • Protozoan infections are widely known mainly around tropical or subtropical regions, and can be exemplified by malaria, leishmaniasis, African trypanosomiasis (African sleeping sickness), American trypanosomiasis (Chaga's disease), lymphatic filariasis, and babesiosis. These infections can be classified into those infecting only humans, and zoonosis also infecting domestic livestock or small animals, both leading to significant economic and social loss , as well as providing reservoirs for human disease, or as essential non-human vectors in a parasitic life cycle infecting humans at another stage.
  • the methods of the invention include methods of treating humans as well as non-human animals.
  • Leishmaniasis is a life-threatening disease that is a major health problem worldwide. An estimated 10-15 million people are infected, and 400,000 new cases occur each year. Currently no vaccine is available against Leishmania and the generic, antimony-based drug treatments are plagued with low efficacy, high toxicity and widespread resistance. Trypanosoma cause life-threatening diseases in humans, including African sleeping sickness and Chagas disease, as well as a number of important diseases in domestic animals. Leishmania and Trypanosoma are closely-related genera, representing the major pathogens in the kinetoplastid group of protozoa. The intestinal parasite Entamoeba histolytica causes amoebic dysentery and extraintestinal abscesses of organs such as the liver and lung.
  • E. histolytica infection The most commonly used drug for treating E. histolytica infection is metronidazole.
  • Toxoplasma gondii and several protozoans of veterinary importance such as Sarcocystis; Theileria; Babesia; and Eimeria (causing coccidiosis in fowl and domestic animals) are also the cause of relevant protozoan diseases.
  • Toxoplasma gondii is the causative agent in toxoplasmosis. In contrast to the mild clinical symptoms of infection seen in a healthy individual with an intact immune system, subjects with weakened, or otherwise compromised, immune systems can have serious clinical effects from toxoplasma infection. Toxoplasma gondii is also pathogenic to animals, particularly sheep, in which it causes abortion, stillbirth, and fetal
  • Toxoplasma gondii causes encephalitis, a dangerous life- threatening disease in both man and domestic animals. Toxoplasma gondii infections via cat vectors, present an important risk for pregnant women.
  • Plasmodium falciparum causes a severe form of human malaria and is responsible for nearly all malaria- specific mortality. Resistance of Plasmodium to antimalarial drugs is an increasingly serious problem in fighting the disease. Ticks transmit babesiosis, and although this is primarily a disease of animals, humans are also infected with this parasite. There are over 100 species of Babesia, with Babesia microti and Babesia divergens the two most likely to cause human infection. Babesia microti is the organism responsible for a growing number of cases of infection especially in the northeast United States. Babesiosis is not only transmitted via tick bites, it can also be transmitted via blood transfusions, with documented cases of infection via this method.
  • Eimeria There are numerous species of Eimeria, and an oral/fecal route of transmission results in intestinal infection in cows, sheep, goats, pigs, ducks, chickens, turkeys, and rabbits, with the domestic chicken host to at least seven different species of Eimeria. Due to its widespread nature and its effects on the host animal, which may result in sub- optimal weight gain and reduced economic value, Eimeria is an economically important disease in the modern poultry production. A subject may or may not exhibit symptoms of infection such as fever, swollen lymph glands, muscle aches, and pains. Methods to diagnose symptomatic and asymptomatic protozoan infection are known to those of ordinary skill in the art.
  • Diagnostic methods include, for instance, but are not limited to, blood tests for antibodies to the protozoan parasite and other assays such as lymph assays for protozoan parasites.
  • Scans by computerized tomography (CT scan) or magnetic resonance imaging (MRI scan) may also be used in the diagnosis of some types of protozoan infection, for example brain scans for Toxoplasma infection.
  • the inhibitors of the invention may be specially formulated for veterinary delivery.
  • the inhibitors of the invention may be incorporated into animal feed or combined with other medications being delivered to an animal in order to treat the infection.
  • animal specific, i.e. cat-specific, antibiotics may be used on a cat in order to prevent a pregnant women who may be exposed to the cat from being exposed to an infection.
  • the therapeutic compounds described herein can be administered in combination with other therapeutic agents and such administration may be simultaneous or sequential.
  • the other therapeutic agents When the other therapeutic agents are administered simultaneously they can be administered in the same or separate formulations, but are administered at the same time.
  • the administration of the other therapeutic agent, including anti-protozoan agents can also be temporally separated, meaning that the therapeutic agents are administered at a different time, either before or after, the administration of the therapeutics described herein.
  • the separation in time between the administration of these compounds may be a matter of minutes or it may be longer.
  • the invention also involves administering another anti- protozoan agents to a subject.
  • anti-protozoan agents include Antiamoebic and antigiardiasis medicines: Diloxanide, Metronidazole;
  • Antileishmaniasis medicines Amphotericin B, Meglumine antimoniate, Pentamidine, Pentostam; Antimalarial medicines: Amodiaquine, Artemether, Artemether +
  • African trypanosomiasis (Eflornithine, Melarsoprol, Pentamidine, Suramin sodium), American trypanosomiasis: (Benznidazole, Nifurtimox).
  • the dosages of known therapies may be reduced in some instances, to avoid side effects.
  • the active agents of the invention are administered to the subject in an effective amount for treating the subject.
  • An "effective amount”, for instance, is an amount necessary or sufficient to realize a desired biologic effect.
  • an effective amount is that amount sufficient to prevent or inhibit protozoan growth or proliferation or alternatively an amount sufficient to induce apoptosis of a protozoan.
  • the effective amount of a compound of the invention in the treatment of a subject may vary depending upon the specific compound used, the mode of delivery of the compound, and whether it is used alone or in combination.
  • the effective amount for any particular application can also vary depending on such factors as the type and/or degree of infection in a subject, the particular compound being administered for treatment, the size of the subject, or the severity of the disorder.
  • One of ordinary skill in the art can empirically determine the effective amount of a particular molecule of the invention without necessitating undue experimentation.
  • an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity in and of itself and yet is entirely effective to treat the particular subject.
  • Toxicity and efficacy of the protocols of the present invention can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio
  • Prophylactic and/or therapeutic agents that exhibit large therapeutic indices are preferred. While prophylactic and/or therapeutic agents that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such agents to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
  • the data obtained from the cell culture assays, animal studies and human studies can be used in formulating a range of dosage of the prophylactic and/or therapeutic agents for use in humans.
  • the dosage of such agents lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the agent used in the method of the invention the
  • therapeutically effective dose can be estimated initially from cell culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound that achieves a half- maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.
  • treat, treated, or treating when used with respect to a disorder refers to a prophylactic treatment which increases the resistance of a subject to development of the disease or, in other words, decreases the likelihood that the subject will develop the disease as well as a treatment after the subject has developed the disease in order to fight the disease, prevent the disease from becoming worse, or slow the progression of the disease compared to in the absence of the therapy.
  • a sub-therapeutic dosage of either or both of the molecules may be used.
  • a "sub-therapeutic dose” as used herein refers to a dosage which is less than that dosage which would produce a therapeutic result in the subject if administered in the absence of the other agent.
  • compositions of the present invention comprise an effective amount of one or more agents, dissolved or dispersed in a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate.
  • animal e.g. , human
  • preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards.
  • the compounds are generally suitable for administration to humans. This term requires that a compound or
  • composition be nontoxic and sufficiently pure so that no further manipulation of the compound or composition is needed prior to administration to humans.
  • pharmaceutically acceptable carrier includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g. , antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and
  • the compounds may be sterile or non-sterile.
  • the agent may comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it need to be sterile for such routes of administration as injection.
  • the present invention can be administered intravenously, intradermally, intraarterially, intralesionally, intratumorally, intracranially, intraarticularly, intraprostaticaly, intrapleurally, intratracheally, intranasally,
  • intraperitoneal injection is contemplated.
  • the composition may comprise various antioxidants to retard oxidation of one or more components.
  • the prevention of the action of microorganisms can be brought about by preservatives such as various antibacterial and antifungal agents, including but not limited to parabens (e.g. , methylparabens, propylparabens), chlorobutanol, phenol, sorbic acid, thimerosal or combinations thereof.
  • parabens e.g. , methylparabens, propylparabens
  • chlorobutanol phenol
  • sorbic acid thimerosal or combinations thereof.
  • the agent may be formulated into a composition in a free base, neutral or salt form.
  • Pharmaceutically acceptable salts include the acid addition salts, e.g. , those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups also can be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine.
  • a carrier can be a solvent or dispersion medium comprising but not limited to, water, ethanol, polyol (e.g. , glycerol, propylene glycol, liquid polyethylene glycol, etc.), lipids (e.g. , triglycerides, vegetable oils, liposomes) and combinations thereof.
  • the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin; by the maintenance of the required particle size by dispersion in carriers such as, for example liquid polyol or lipids; by the use of surfactants such as, for example hydroxypropylcellulose; or combinations thereof such methods.
  • isotonic agents such as, for example, sugars, sodium chloride or combinations thereof.
  • the compounds of the invention may be administered directly to a tissue.
  • Direct tissue administration may be achieved by direct injection.
  • the compounds may be administered once, or alternatively they may be administered in a plurality of administrations. If administered multiple times, the compounds may be administered via different routes. For example, the first (or the first few) administrations may be made directly into the affected tissue while later administrations may be systemic.
  • a pharmaceutical composition comprises the compound of the invention and a pharmaceutically-acceptable carrier.
  • Pharmaceutically-acceptable carriers for nucleic acids, small molecules, peptides, monoclonal antibodies, and antibody fragments are well-known to those of ordinary skill in the art.
  • a pharmaceutically-acceptable carrier means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients.
  • Pharmaceutically acceptable carriers include diluents, fillers, salts, buffers, stabilizers, solubilizers and other materials which are well-known in the art. Exemplary pharmaceutically acceptable carriers for peptides in particular are described in U.S. Patent No. 5,211,657. Such preparations may routinely contain salt, buffering agents, preservatives, compatible carriers, and optionally other therapeutic agents. When used in medicine, the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically-acceptable salts thereof and are not excluded from the scope of the invention.
  • Such pharmacologically and pharmaceutically-acceptable salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulfuric, nitric, phosphoric, maleic, acetic, salicylic, citric, formic, malonic, succinic, and the like.
  • pharmaceutically- acceptable salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts.
  • the compounds of the invention may be formulated into preparations in solid, semi-solid, liquid or gaseous forms such as tablets, capsules, powders, granules, ointments, solutions, depositories, inhalants and injections, and usual ways for oral, parenteral or surgical administration.
  • the invention also embraces pharmaceutical compositions which are formulated for local administration, such as by implants.
  • Compositions suitable for oral administration may be presented as discrete units, such as capsules, tablets, lozenges, each containing a predetermined amount of the active agent.
  • Other compositions include suspensions in aqueous liquids or non-aqueous liquids, such as a syrup, an elixir or an emulsion.
  • the compounds can be formulated readily by combining the active compounds with pharmaceutically acceptable carriers well known in the art.
  • Such carriers enable the compounds of the invention to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated.
  • Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
  • Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or
  • polyvinylpyrrolidone PVP
  • disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.
  • Dragee cores are provided with suitable coatings.
  • suitable coatings For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
  • Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
  • compositions which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
  • the push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
  • stabilizers may be added.
  • Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.
  • compositions may take the form of tablets or lozenges formulated in conventional manner.
  • the compounds for use according to the present invention may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g. , dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • a suitable propellant e.g. , dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • a suitable propellant e.g. , dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
  • a suitable propellant e.g. , dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethan
  • the compounds when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g. , by bolus injection or continuous infusion.
  • Formulations for injection may be presented in unit dosage form, e.g. , in ampoules or in multi-dose containers, with an added preservative.
  • the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions.
  • non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
  • Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like. Lower doses will result from other forms of administration, such as intravenous administration. In the event that a response in a subject is insufficient at the initial doses applied, higher doses (or effectively higher doses by a different, more localized delivery route) may be employed to the extent that patient tolerance permits. Multiple doses per day are contemplated to achieve appropriate systemic levels of compounds.
  • Both non-biodegradable and biodegradable polymeric matrices can be used to deliver the agents of the invention to the subject.
  • Biodegradable matrices are preferred.
  • Such polymers may be natural or synthetic polymers. Synthetic polymers are preferred.
  • the polymer is selected based on the period of time over which release is desired, generally in the order of a few hours to a year or longer. Typically, release over a period ranging from between a few hours and three to twelve months is most desirable.
  • the polymer optionally is in the form of a hydrogel that can absorb up to about 90% of its weight in water and further, optionally is cross-linked with multivalent ions or other polymers.
  • a kit comprises an inhibitor of protozoan tyrosyl-tRNA synthetase and instructions for administering the same.
  • the kit may further comprise devices for administering the inhibitors, and/or other therapeutics or diagnostics related to the therapy.
  • Instructions can define a component of promotion, and typically involve written instructions on or associated with packaging of compositions of the invention. Instructions also can include any oral or electronic instructions provided in any manner.
  • kits may include one or more containers housing the components of the invention and instructions for use.
  • kits may include one or more agents described herein, along with instructions describing the intended therapeutic application and the proper administration of these agents.
  • agents in a kit may be in a pharmaceutical formulation and dosage suitable for a particular application and for a method of administration of the agents.
  • the kit may be designed to facilitate use of the methods described herein by physicians and can take many forms.
  • Each of the compositions of the kit may be provided in liquid form (e.g., in solution), or in solid form, (e.g., a dry powder).
  • some of the compositions may be constitutable or otherwise processable (e.g., to an active form), for example, by the addition of a suitable solvent or other species (for example, water or a cell culture medium), which may or may not be provided with the kit.
  • a suitable solvent or other species for example, water or a cell culture medium
  • Instructions also can include any oral or electronic instructions provided in any manner such that a user will clearly recognize that the instructions are to be associated with the kit, for example, audiovisual (e.g., videotape, DVD, etc.), Internet, and/or web-based communications, etc.
  • the written instructions may be in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which instructions can also reflects approval by the agency of manufacture, use or sale for human administration.
  • the kit may contain any one or more of the components described herein in one or more containers.
  • the kit may include instructions for mixing one or more components of the kit and/or isolating and mixing a sample and applying to a subject.
  • the kit may include a container housing agents described herein.
  • the agents may be prepared sterilely, packaged in syringe and shipped refrigerated. Alternatively it may be housed in a vial or other container for storage. A second container may have other agents prepared sterilely.
  • the kit may include the active agents premixed and shipped in a syringe, vial, tube, or other container.
  • Computational techniques can be used to screen, identify, select, and design compounds capable of binding to the protozoan tyrosyl-tRNA synthetase or optionally the adenylate binding pocket thereof and functioning inhibitors.
  • computational techniques can be used to identify or design ligands, such as agonists and/or antagonists, that associate with the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. Once identified and screened for biological activity, these agonists, antagonists, and combinations thereof, may be used therapeutically, for example, to inhibit protozoan tyrosyl-tRNA synthetase activity.
  • Data stored in a machine-readable storage medium that is capable of displaying a graphical three- dimensional representation of the structure of the potential therapeutic compound or a structurally homologous molecule or molecular complex, as identified herein, or portions thereof may thus be advantageously used for drug discovery.
  • the structure coordinates of the potential therapeutic compounds are used to generate a three-dimensional image that can be computationally fit to the three-dimensional image of the protozoan tyrosyl- tRNA synthetase or the adenylate binding pocket thereof.
  • the three-dimensional molecular structure encoded by the data in the data storage medium can then be computationally evaluated for its ability to associate with the potential therapeutic compound.
  • the protein structure can also be visually inspected for potential association with the potential therapeutic compound.
  • programs are available for the "threading" of protozoan TyrRS sequences to existing known TyrRS structures for use in fitting, if the specific crystal structures of the individual protozoan TyrRS proteins are not in existence.
  • One embodiment of the method of drug design involves evaluating the potential association of a candidate therapeutic compound with the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof.
  • the method of drug design thus includes computationally evaluating the potential of a selected ligand to associate with any of the molecules or molecular complexes set forth above.
  • This method includes the steps of: (a) employing computational means, for example, such as a programmable computer including the appropriate software known in the art or as disclosed herein, to perform a fitting operation between the potential therapeutic compound and the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof and (b) analyzing the results of the fitting operation to quantify the association between the potential therapeutic compound and the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof.
  • computational means for example, such as a programmable computer including the appropriate software known in the art or as disclosed herein
  • Selected potential therapeutic compounds may be positioned in a variety of orientations associating with the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. This may be accomplished using software such as QUANTA (Molecular Simulations, Inc., San Diego, CA, USA.) and SYBYL (TRIPOS, St. Louis, MO, USA), followed by energy minimization and molecular dynamics with standard molecular mechanics force fields, such as CHARMM (Molecular Simulations, Inc., San Diego, CA, USA) and AMBER (P. A. Kollman, University of California at San Francisco, San Francisco, CA, USA).
  • any of the biological or biochemical functions mediated by the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof can be used as an endpoint assay to identify an agent that modulates protozoan tyrosyl-tRNA synthetase activity (a putative therapeutic compound).
  • the assays may include all of the
  • Compounds can be identified through cellular assays.
  • Cellular assays may involve, for instance, expressing the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof in cells and testing a variety of compounds for their ability to bind to the expressed peptide.
  • the assay may be performed with labeled compounds, facilitating identification of the compound that binds.
  • a biological readout can be used to identify a putative therapeutic compound.
  • Biological assays will allow for the identification of both agonists and antagonists or inhibitors.
  • Competition binding assays may also be used to discover compounds that interact with the protozoan tyrosyl- tRNA synthetase or the adenylate binding pocket thereof (e.g. binding partners and/or ligands).
  • a compound is exposed to the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof under conditions that allow the compound to bind or to otherwise interact with the polypeptide.
  • a peptide or antibody or fragment thereof against the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof may be added to the mixture.
  • test compound interacts with the protozoan tyrosyl- tRNA synthetase or the adenylate binding pocket thereof, it decreases the amount of peptide or antibody that can bind to the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof.
  • Agents that modulate the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof can be identified using one or more of the above assays, alone or in combination. It is generally preferable to use a cell-based or cell free system first and then confirm activity in an animal or other model system. Such model systems are well known in the art and can readily be employed in this context.
  • Escherichia coli str. K-12 (GI: 16129595): MASSNLIKQL QERGLVAQVT DEEALAERLA QGPIALYCGF DPTADSLHLG HLVPLLCLKR FQQAGHKPVA LVGGATGLIG DPSFKAAERK LNTEETVQEW VDKIRKQVAP FLDFDCGENS AIAANNYDWF GNMNVLTFLR DIGKHFSVNQ MINKEAVKQR LNREDQGISF TEFSYNLLQG YDFACLNKQY GVVLQIGGSD QWGNITSGID LTRRLHQNQV FGLTVPLITK ADGTKFGKTE GGAVWLDPKK TSPYKFYQFW INTADADVYR FLKFFTFMSI EEINALEEED KNSGKAPRAQ YVLAEQVTRL VHGEEGLQAA KRITECLFSG SLSALSEADF EQLAQDGVPM VEMEKGADLM QALVD
  • Staphylococcus aureus (GI: 16975033): MTNVLIEDLK WRGLIYQQTD EQGIEDLLNK EQVTLYCGAD PTADSLHIGH LLPFLTLRRF QEHGHRPIVL IGGGTGMIGD PSGKSEERVL QTEEQVDKNI EGISKQMHNI FEFGTDHGAV LVNNRDWLGQ ISLISFLRDY GKHVGVNYML GKDSIQSRLE HGISYTEFTY TILQAIDFGH LNRELNCKIQ VGGSDQWGNI TSGIELMRRM YGQTDAYGLT IPLVTKSDGK KFGKSESGAV WLDAEKTSPY EFYQFWINQS DEDVIKFLKY FTFLGKEEID RLEQSKNEAP HLREAQKTLA EEVTKFIHGE DALNDAIRIS QALFSGDLKS LSAKELKDGF KDVPQVTLSN DTTNIVEVLI ETGISPSKRQ AREDV
  • Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers.
  • the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer.
  • Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses.
  • HPLC high pressure liquid chromatography
  • alkyl refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms (“C ⁇ o alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms (“C ⁇ alkyl”). In some embodiments, an alkyl group has 1 to 8 carbon atoms ("C ⁇ alkyl”). In some embodiments, an alkyl group has 1 to 7 carbon atoms ("C ⁇ alkyl”). In some embodiments, an alkyl group has 1 to 6 carbon atoms (“C ⁇ alkyl”). In some embodiments, an alkyl group has 1 to 5 carbon atoms (“Q-s alkyl”). In some embodiments, an alkyl group has 1 to 4 carbon atoms ("C ⁇ alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms (“C ⁇ o alkyl”). In some embodiments, an alkyl group has 1 to 9 carbon atoms (“C ⁇ alkyl”). In some embodiment
  • an alkyl group has 1 to 3 carbon atoms (“Ci_ 3 alkyl").
  • an alkyl group has 1 to 2 carbon atoms (“Ci_ 2 alkyl").
  • an alkyl group has 1 carbon atom ("Ci alkyl”). In some embodiments, an alkyl group has 2 to 6 carbon atoms ("C 2 -6 alkyl”).
  • Ci_ 6 alkyl groups include methyl (CO, ethyl (C 2 ), n-propyl (C 3 ), isopropyl (C 3 ), n-butyl (C 4 ), tert-butyl (C 4 ), sec-butyl (C 4 ), iso-butyl (C 4 ), n-pentyl (C 5 ), 3-pentanyl (C 5 ), amyl (C 5 ), neopentyl (C 5 ), 3-methyl-2-butanyl (C 5 ), tertiary amyl (C 5 ), and n-hexyl (C 6 ).
  • alkyl groups include n-heptyl (C 7 ), n-octyl (Cg) and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an "unsubstituted alkyl") or substituted (a "substituted alkyl”) with one or more
  • the alkyl group is an unsubstituted Ci-w alkyl (e.g., -CH ). In certain embodiments, the alkyl group is a substituted Cno alkyl.
  • Perhaloalkyl is a substituted alkyl group as defined herein wherein all of the hydrogen atoms are independently replaced by a halogen, e.g., fluoro, bromo, chloro, or iodo.
  • the alkyl moiety has 1 to 8 carbon atoms ("Ci_8
  • the alkyl moiety has 1 to 6 carbon atoms ("Ci_6 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 4 carbon atoms ("Ci ⁇ perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 3 carbon atoms (“Ci_ 3 perhaloalkyl”). In some embodiments, the alkyl moiety has 1 to 2 carbon atoms ("Ci_ 2 perhaloalkyl"). In some embodiments, all of the hydrogen atoms are replaced with fluoro. In some embodiments, all of the hydrogen atoms are replaced with chloro.
  • perhaloalkyl groups examples include -CF 3 ,
  • alkenyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms (“C 2 -io alkenyl”). In some embodiments, an alkenyl group has 2 to 9 carbon atoms ("C 2 -9 alkenyl”). In some embodiments, an alkenyl group has 2 to 8 carbon atoms ("C 2 -8 alkenyl”). In some embodiments, an alkenyl group has 2 to 7 carbon atoms (“C 2 _ 7 alkenyl”). In some embodiments, an alkenyl group has 2 to 6 carbon atoms (“C 2 -6 alkenyl”).
  • an alkenyl group has 2 to 5 carbon atoms ("C 2 -5 alkenyl”). In some embodiments, an alkenyl group has 2 to 4 carbon atoms ("C 2 _4 alkenyl”). In some embodiments, an alkenyl group has 2 to 3 carbon atoms (“C 2 _ 3 alkenyl”). In some embodiments, an alkenyl group has 2 carbon atoms ("C 2 alkenyl”).
  • the one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl).
  • Examples of C 2 - alkenyl groups include ethenyl (C 2 ), 1-propenyl (C 3 ), 2-propenyl (C 3 ), 1-butenyl (C 4 ), 2-butenyl (C 4 ), butadienyl (C 4 ), and the like.
  • Examples of C 2 _6 alkenyl groups include the aforementioned C 2 _ alkenyl groups as well as pentenyl (C 5 ), pentadienyl (C 5 ), hexenyl (C 6 ), and the like. Additional examples of alkenyl include heptenyl (C 7 ), octenyl (Cg), octatrienyl (Cg), and the like.
  • each instance of an alkenyl group is independently unsubstituted (an "unsubstituted alkenyl") or substituted (a "substituted alkenyl") with one or more substituents.
  • the alkenyl group is an unsubstituted C 2 _ 10 alkenyl.
  • the alkenyl group is a substituted C 2 _io alkenyl.
  • alkynyl refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms (“C ⁇ o alkynyl”). In some embodiments, an alkynyl group has 2 to 9 carbon atoms (“C 2 _9 alkynyl”). In some embodiments, an alkynyl group has 2 to 8 carbon atoms ("C 2 _g alkynyl”). In some embodiments, an alkynyl group has 2 to 7 carbon atoms (“C 2 _ 7 alkynyl”). In some embodiments, an alkynyl group has 2 to 6 carbon atoms (“C 2 _6 alkynyl”).
  • an alkynyl group has 2 to 5 carbon atoms ("C 2 _5 alkynyl”). In some embodiments, an alkynyl group has 2 to 4 carbon atoms ("C 2 ⁇ alkynyl”). In some embodiments, an alkynyl group has 2 to 3 carbon atoms (“C 2 _ 3 alkynyl”). In some embodiments, an alkynyl group has 2 carbon atoms ("C 2 alkynyl”).
  • the one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl).
  • C 2 _ alkynyl groups include, without limitation, ethynyl (C 2 ), 1-propynyl (C 3 ), 2-propynyl (C 3 ), 1-butynyl (C 4 ), 2-butynyl (C 4 ), and the like.
  • C 2 _6 alkenyl groups include the aforementioned C 2 ⁇ alkynyl groups as well as pentynyl (C 5 ), hexynyl (C 6 ), and the like. Additional examples of alkynyl include heptynyl (C 7 ), octynyl (Cg), and the like. Unless otherwise specified, each instance of an alkynyl group is independently unsubstituted (an "unsubstituted alkynyl") or substituted (a "substituted alkynyl") with one or more substituents. In certain embodiments, the alkynyl group is an unsubstituted C 2 _ 10 alkynyl. In certain embodiments, the alkynyl group is a substituted C 2 _ 10 alkynyl.
  • heteroalkyl, heteroalkenyl, and heteroalkynyl refers to an alkyl, alkenyl, and alkynyl moiety, as defined herein, wherein 1, 2, 3, or 4 carbons of the parent chain are replaced with oxygen, nitrogen, or sulfur atoms.
  • carbocyclyl refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms ("C ⁇ o carbocyclyl”) and zero heteroatoms in the non-aromatic ring system.
  • a carbocyclyl group has 3 to 8 ring carbon atoms ("C 3 _g carbocyclyl”).
  • a carbocyclyl group has 3 to 6 ring carbon atoms (“C 3 _ 6 carbocyclyl”).
  • a carbocyclyl group has 3 to 6 ring carbon atoms ("C 3 _6 carbocyclyl”). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms ("Cs-io carbocyclyl").
  • Exemplary C 3 _ 6 carbocyclyl groups include, without limitation, cyclopropyl (C 3 ), cyclopropenyl (C 3 ), cyclobutyl (C 4 ), cyclobutenyl (C 4 ), cyclopentyl (C 5 ), cyclopentenyl (C 5 ), cyclohexyl (C 6 ), cyclohexenyl (C 6 ), cyclohexadienyl (C 6 ), and the like.
  • Exemplary C 3 _g carbocyclyl groups include, without limitation, the
  • C 3 _ 6 carbocyclyl groups as well as cycloheptyl (C 7 ), cycloheptenyl (C 7 ), cycloheptadienyl (C 7 ), cycloheptatrienyl (C 7 ), cyclooctyl (Cg), cyclooctenyl (Cg), bicyclo[2.2.1]heptanyl (C 7 ), bicyclo[2.2.2]octanyl (Cg), and the like.
  • Exemplary C 3 _ 10 carbocyclyl groups include, without limitation, the aforementioned C 3 _g carbocyclyl groups as well as cyclononyl (Cg), cyclononenyl (Cg), cyclodecyl (C 10 ), cyclodecenyl (Cio), octahydro-lH-indenyl (Cg), decahydronaphthalenyl (C 10 ), spiro[4.5]decanyl (C 10 ), and the like.
  • the carbocyclyl group is either monocyclic (“monocyclic carbocyclyl”) or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic carbocyclyl”) or tricyclic system (“tricyclic carbocyclyl”)) and can be saturated or can contain one or more carbon-carbon double or triple bonds.
  • Carbocyclyl also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system.
  • each instance of a carbocyclyl group is independently unsubstituted (an "unsubstituted carbocyclyl") or substituted (a "substituted carbocyclyl”) with one or more substituents.
  • the carbocyclyl group is an unsubstituted C 3 _ 10 carbocyclyl.
  • the carbocyclyl group is a substituted C 3 _ 10 carbocyclyl.
  • Carbocyclyl is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms ("Cs-io cycloalkyl").
  • a cycloalkyl group has 3 to 8 ring carbon atoms ("C 3 _ 8 cycloalkyl”). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C3_6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms ("C 5 _6 cycloalkyl”). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms ("Cs-io cycloalkyl”). Examples of C 5 _6 cycloalkyl groups include cyclopentyl (C 5 ) and cyclohexyl (C 5 ).
  • C 3 _ 6 cycloalkyl groups include the aforementioned C 5 _6 cycloalkyl groups as well as cyclopropyl (C 3 ) and cyclobutyl (C 4 ).
  • C 3 _ 8 cycloalkyl groups include the aforementioned C 3 _6 cycloalkyl groups as well as cycloheptyl (C 7 ) and cyclooctyl (C 8 ).
  • each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents.
  • the cycloalkyl group is an unsubstituted C 3 _io cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C 3 _ 10 cycloalkyl.
  • heterocyclyl refers to a radical of a 3- to 14-membered non- aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("3-14 membered heterocyclyl").
  • the point of attachment can be a carbon or nitrogen atom, as valency permits.
  • a heterocyclyl group can either be monocyclic (“monocyclic heterocyclyl”) or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system (“bicyclic heterocyclyl”) or tricyclic system (“tricyclic heterocyclyl”)), and can be saturated or can contain one or more carbon-carbon double or triple bonds.
  • Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings.
  • Heterocyclyl also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system.
  • each instance of heterocyclyl is independently unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyl") with one or more substituents.
  • the heterocyclyl group is an unsubstituted 3- 14 membered heterocyclyl.
  • the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
  • a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heterocyclyl").
  • a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring
  • a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heterocyclyl").
  • the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
  • the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur.
  • heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
  • Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, thiorenyl.
  • Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl.
  • Exemplary 5-membered heterocyclyl groups containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
  • Exemplary 5- membered heterocyclyl groups containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl.
  • Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl.
  • Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl.
  • Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl.
  • Exemplary bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl,
  • octahydroisochromenyl decahydronaphthyridinyl, decahydro-1 ,8-naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, lH-benzo[e] [l,4]diazepinyl, l,4,5,7-tetrahydropyrano[3,4-b]pyrrolyl, 5,6- dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7-dihydro- 4H-thieno[2,3-c]pyranyl, 2,3-dihydro-lH-pyrrolo[2,3-b]pyridinyl, 2,3- dihydrofuro[2,3-b]pyr
  • aryl refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 ⁇ electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system ("C 6 -i 4 aryl”).
  • an aryl group has 6 ring carbon atoms ("C 6 aryl”; e.g., phenyl).
  • an aryl group has 10 ring carbon atoms ("Cio aryl”; e.g., naphthyl such as 1-naphthyl and 2-naphthyl).
  • an aryl group has 14 ring carbon atoms ("C 14 aryl”; e.g., anthracyl).
  • Aryl also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system.
  • each instance of an aryl group is independently unsubstituted (an "unsubstituted aryl") or substituted (a "substituted aryl") with one or more substituents.
  • the aryl group is an unsubstituted C 6 -i 4 aryl.
  • the aryl group is a substituted C6-i 4 aryl.
  • Alkyl is a subset of “alkyl” and refers to an alkyl group, as defined herein, substituted by an aryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
  • heteroaryl refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 ⁇ electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur ("5-14 membered heteroaryl").
  • the point of attachment can be a carbon or nitrogen atom, as valency permits.
  • Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings.
  • Heteroaryl includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system.
  • Heteroaryl also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system.
  • Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom e.g., indolyl, quinolinyl, carbazolyl, and the like
  • the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
  • a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl").
  • a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl").
  • a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered
  • heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an "unsubstituted heteroaryl") or substituted (a "substituted heteroaryl”) with one or more substituents. In certain embodiments, the heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.
  • Exemplary 5-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyrrolyl, furanyl and thiophenyl.
  • Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl.
  • Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
  • Exemplary 5-membered heteroaryl groups containing 4 heteroatoms include, without limitation, tetrazolyl.
  • Exemplary 6-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyridinyl.
  • Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl.
  • Exemplary 6-membered heteroaryl groups containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively.
  • Exemplary 7-membered heteroaryl groups containing 1 heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl.
  • Exemplary 5,6-bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl.
  • Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl.
  • Exemplary tricyclic heteroaryl groups include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.
  • Heteroaralkyl is a subset of “alkyl” and refers to an alkyl group, as defined herein, substituted by a heteroaryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
  • partially unsaturated refers to a ring moiety that includes at least one double or triple bond.
  • partially unsaturated is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl moieties) as herein defined.
  • saturated refers to a ring moiety that does not contain a double or triple bond, i.e. , the ring contains all single bonds.
  • alkylene is the divalent moiety of alkyl
  • alkenylene is the divalent moiety of alkenyl
  • alkynylene is the divalent moiety of alkynyl, each as defined herein.
  • Alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups, as defined herein, are optionally substituted (e.g., "substituted” or “unsubstituted” alkyl, "substituted” or “unsubstituted” alkenyl, "substituted” or “unsubstituted” alkynyl, "substituted” or “unsubstituted” heteroalkyl, "substituted” or “unsubstituted” heteroalkenyl, "substituted” or “unsubstituted” heteroalkynyl, "substituted” or “unsubstituted” carbocyclyl, "substituted” or
  • unsubstituted heterocyclyl substituted or unsubstituted aryl or “substituted” or “unsubstituted” heteroaryl group).
  • substituted whether preceded by the term “optionally” or not, means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction.
  • a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position.
  • substituted is contemplated to include substitution with all permissible substituents of organic compounds, any of the substituents described herein that results in the formation of a stable compound.
  • the present invention contemplates any and all such combinations in order to arrive at a stable compound.
  • heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety.
  • each instance of R ⁇ is, independently, selected from C ⁇ o alkyl, C ⁇ o perhaloalkyl, C 2 _io alkenyl, C 2 _io alkynyl, C ⁇ o heteroalkyl, C 2 _io heteroalkenyl, C 2 ioheteroalkynyl, C 3 _ 10 carbocyclyl, 3-14 membered heterocyclyl, C 6 -i 4 aryl, and 5-14 membered heteroaryl, or two groups are joined to form a 3-14 membered
  • heterocyclyl or 5-14 membered heteroaryl ring wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R dd groups;
  • each instance of R cc is, independently, selected from hydrogen, Ci-io alkyl, Ci-io perhaloalkyl, C 2 _ 10 alkenyl, C 2 _ 10 alkynyl, C ⁇ o heteroalkyl, C 2 _ 10 heteroalkenyl, C 2 10 heteroalkynyl, C 3 _io carbocyclyl, 3-14 membered heterocyclyl, C 6 -i4 aryl, and 5-14 membered heteroaryl, or two R cc groups are joined to form a 3-14 membered
  • heterocyclyl or 5-14 membered heteroaryl ring wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R dd groups;
  • each instance of R ee is, independently, selected from d_ 6 alkyl, d_ 6 perhaloalkyl, C 2 - 6 alkenyl, C 2 - 6 alkynyl, d_ 6 heteroalkyl, C 2 - 6 heteroalkenyl, C 2 - 6 heteroalkynyl, -io carbocyclyl, C 6 -io aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R gg groups;
  • each instance of R is, independently, selected from hydrogen, d_ 6 alkyl, d_ 6 perhaloalkyl, C 2 - 6 alkenyl, C 2 - 6 alkynyl, d_ 6 heteroalkyl, C 2 - 6 heteroalkenyl, C 2
  • heterocyclyl or 5-14 membered heteroaryl ring wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R gg groups; and
  • halo refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
  • a "counterion” is a negatively charged group associated with a positively charged quarternary amine in order to maintain electronic neutrality.
  • Exemplary counterions include halide ions (e.g., F , CT, Br , ⁇ ), NO 3 , C10 4 , OH ⁇ , H 2 P0 4 , HS0 4 , sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p- toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-l-sulfonic acid-5-sulfonate, ethan-l-sulfonic acid-2-sulfonate, and the like), and carboxylate ions (e.g., acetate, ethanoate, propanoate, benzoate, glycerate, lactate, tartrate, glycolate, and the like).
  • carboxylate ions e.g., acetate, ethanoate
  • Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quarternary nitrogen atoms.
  • the substituent present on the nitrogen atom is an nitrogen protecting group (also referred to herein as an "amino protecting group").
  • Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
  • Nitrogen protecting groups such as sulfonamide groups include, but are not limited to, p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,- trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5, 6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts) , 2,6-dimethoxy-4-methylbenzenesulf onamide (iMds), 2,2,5,7, 8-pentamethylchroman-6-sulfonamide (Pmc), methanesulf
  • Ts p-toluenesulfonamide
  • nitrogen protecting groups include, but are not limited to, phenothiazinyl- (lO)-acyl derivative, N'-p-toluenesulfonylaminoacyl derivative, N'- phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-l, 1,4,4- tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl- 1 ,3,5-triazacyclohexan-2-one, 5-substituted 1 ,3-dibenzyl-l ,3,5-triazacyclohexan-2- one, 1-
  • benzenesulfenamide o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide,
  • triphenylmethylsulfenamide triphenylmethylsulfenamide
  • 3-nitropyridinesulfenamide Npys
  • the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an "hydroxyl protecting group").
  • oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), i-butylthiomethyl,
  • GUM guaiacolmethyl
  • POM pentenyloxymethyl
  • MEM 2- methoxyethoxymethyl
  • SEMOR 2-trimethylsilylethoxymethyl
  • THP tetrahydropyranyl
  • MTHP 4-methoxytetrahydrothiopyranyl
  • S,S-dioxide l-[(2-chloro-4-methyl)phenyl]-4- methoxypiperidin-4-yl (CTMP), l,4-dioxan-2-yl, tetrahydrofuranyl,
  • methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
  • the substituent present on an sulfur atom is a sulfur protecting group (also referred to as a "thiol protecting group").
  • salt refers to any and all salts.
  • pharmaceutically acceptable salt refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
  • Pharmaceutically acceptable salts are well known in the art. For example, Berge et al. , describes pharmaceutically acceptable salts in detail in /. Pharmaceutical Sciences (1977) 66: 1- 19.
  • Pharmaceutically acceptable salts of the compounds of this invention include those derived from suitable inorganic and organic acids and bases. Examples of
  • nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid
  • organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2- hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate
  • Pharmaceutically acceptable salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N + (Ci_ 4 alkyl) 4 salts.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.
  • prodrug means a compound that can react under biological conditions (e.g., in vitro or in vivo enzymatic conditions) to provide a pharmacologically active compound.
  • a prodrug has improved physical and/or delivery properties over the parent compound.
  • Prodrugs are typically designed to enhance pharmacologically, pharmaceutically and/or pharmacokinetically based properties associated with the parent compound.
  • the advantage of a prodrug can lie in its physical properties, such as enhanced water solubility compared to the parent compound, enhanced transport across a cell membrane, and/or enhanced drug stability for long-term storage.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Epidemiology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Description

METHODS AND PRODUCTS RELATED TO PROTOZOAN DISEASE
RELATED APPLICATIONS
This application claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Application Serial No. 61/671,596, entitled "METHODS AND PRODUCTS RELATED TO PROTOZOAN DISEASE " filed on July 13, 2012, which is herein incorporated by reference in its entirety.
FEDERALLY SPONSORED RESEARCH
This invention was made with government support under Grant No.
NNH06CC03B awarded by NASA. The government has certain rights in this invention.
BACKGROUND OF INVENTION
Infectious diseases caused by protozoa are among the leading causes of death throughout the world. Alone, the protozoa from genus Plasmodium -cause of malaria- is considered endemic in more than 100 countries and is the leading cause of death for children. Control efforts generally involve a combination of prevention and treatment methods. To some success, these measures have become standardized as the global effort to defeat malaria has become an international priority. However, effective treatments for malaria, and a variety of other protozoan diseases remain a challenge in the face of emerging drug resistance with a growing incidence within developing nations.
SUMMARY OF INVENTION
In some aspects the invention is a method for treating protozoan diseases by administering to a subject having a protozoan disease an inhibitor of protozoan tyrosyl- tRNA synthetase in an effective amount to treat the protozoan disease, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase does not inhibit mammalian tyrosyl- tRNA synthetase. In some embodiments the inhibitor of protozoan tyrosyl-tRNA synthetase specifically binds to an adenylate binding pocket of protozoan tyrosyl-tRNA synthetase. In other embodiments the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, K84, C85 and F127 of SEQ ID NO. 1. In another embodiment, the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, and F127 of SEQ ID NO. 1.
In some embodiments of this invention, the inhibitor of protozoan tyrosyl-tRNA synthetase is also an inhibitor of bacterial tyrosyl-tRNA synthetase. In other
embodiments, the inhibitor of protozoan tyrosyl-tRNA synthetase is not an inhibitor of bacterial tyrosyl-tRNA synthetase.
In some embodiments of the invention, the protozoan diseases treated include but are not limited to selection from groups including malaria, toxoplasma, leishmaniasis, giardiasis, trypanosomiasis (Sleeping sickness, Chagas disease), amoebic dysentery, and trichomoniasis.
In an embodiment of the invention, an inhibitor of protozoan tyrosyl-tRNA synthetase includes but is not limited to the compound of Formula (I)
Figure imgf000003_0001
Formula (I) or a salt thereof;
wherein:
each instance of R1; R2, R3, and R4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl. In a further embodiment of the invention, the inhibitors of protozoan tyrosyl- tRNA synthetase include but are not limited to the following: SB 219383, SB 239629, SB 243545, or SB 284485.
Another aspect of the invention involves a composition, comprising: an inhibitor of protozoan tyrosyl-tRNA synthetase, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase does not inhibit mammalian or bacterial tyrosyl-tRNA synthetase.
Yet another aspect of this invention involves a method of selecting or designing a compound that interacts with a protozoan tyrosyl-tRNA synthetase and modulates protozoan tyrosyl-tRNA synthetase activity, the method comprising the step of assessing the stereochemical complementarity between the compound and a topographic region of protozoan tyrosyl-tRNA synthetase, wherein the topographic region of the protozoan tyrosyl-tRNA synthetase is characterized by at least a portion of the amino acids positioned at an adenylate binding pocket of the protozoan tyrosyl-tRNA synthetase. In an embodiment of this invention, the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, K84, C85 and F127 of SEQ ID NO. 1. In a further embodiment of the invention, the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, and F127 of SEQ ID NO. 1.
Another aspect of the invention involves a composition comprising an inhibitor of protozoan tyrosyl-tRNA synthetase and an anti-protozoan agent. In an embodiment of this invention, the inhibitor of protozoan tyrosyl-tRNA synthetase synthetase is a compound of Formula (I):
Figure imgf000005_0001
Formula (I) wherein the inhibitor of protozoan tyrosyl-tRNA or a salt thereof; wherein: each instance of R1; R2, R3, and R4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl. In another embodiment of the invention, where the composition comprises an inhibitor of protozoan tyrosyl-tRNA synthetase and an anti-protozoan agent, the inhibitor of protozoan tyrosyl-tRNA synthetase includes but is not limited to SB 219383, SB 239629, SB 243545, and SB 284485.
In another aspect of the invention, the compound is the formula (I) or (II):
Figure imgf000006_0001
Figure imgf000006_0002
Formula (II) or a salt thereof; wherein: each instance of R1 ; R2, R3, and R4 is independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl; R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl; wherein each instance of R5, R6, R7j Rg and R9 is, independently, hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl; and provided that the compound of Formula (I) is not a compound wherein Ri is a butyl ester or OH and R2, R3, and R4 are all OH, provided that the compound of
Formula (II) is not a compound wherein Ri is a butyl ester or OH, and R2, R3, R4, R5, and R7 are all OH, R9 are all H and one OH, and R6 and Rg are both H.
This invention is not limited in its application to the details of construction and the arrangement of components set forth in the following description or illustrated in the drawings. The invention is capable of other embodiments and of being practiced or of being carried out in various ways. Also, the phraseology and terminology used herein is for the purpose of description and should not be regarded as limiting. The use of "including," "comprising," or "having," "containing," "involving," and variations thereof herein, is meant to encompass the items listed thereafter and equivalents thereof as well as additional items.
BRIEF DESCRIPTION OF DRAWINGS
The accompanying drawings are not intended to be drawn to scale. In the drawings, each identical or nearly identical component that is illustrated in various figures is represented by a like numeral. For purposes of clarity, not every component may be labeled in every drawing. In the drawings:
Figure 1 shows multiple sequence alignments (SEQ ID NOs. 6-13) of the region of TyrRS corresponding to the unique components of the adenylate binding pocket in protozoa, with 5 unique sites labeled with a box.
Figure 2 shows a chemical structure of SB243545 with important protozoan sites identified. DETAILED DESCRIPTION
A major challenge in the treatment of protozoan diseases is that most effective protein targets are highly conserved, and thus too similar across eukaryotes. As a result many potentially effective compounds would target both parasite and host. The discovery, according to the invention, of a horizontal gene transfer from a more distantly related organism, circumvents current limitations by providing a target, thus greatly increasing the potential selectivity of compounds targeted to protozoa. Horizontal gene transfer refers to the transfer of genetic material between organisms. As opposed to the vertical transfer of genetic information which occurs between parent and
offspring generations, horizontal gene transfer is an exchange of genetic material with a different population or species that occurs independently of reproduction, and is subsequently inherited by offspring generations.
Many effective protein targets in protozoans are highly conserved, and thus are too similar to proteins in other non-protozoan eukaryotes, including humans and animals. Therefore, many effective protein targets in protozoans are highly conserved, and are too similar across eukaryotes. The discovery that protozoan tyrosyl-tRNA synthetase, a critical protein to protozoan survival, has distinct amino acids in important binding regions has vast implications for the development of protozoan therapeutics. The tyrosyl-tRNA synthetase target is particularly valuable as it is highly expressed, universally essential, and of a class often effectively targeted by antibiotics within bacteria.
Thus, the invention involves, in some aspects, methods for treating protozoan disease. The therapeutic methods of the invention are accomplished using an inhibitor of protozoan tyrosyl-tRNA synthetase. Tyrosyl-tRNA synthetase is an enzyme that is found in all cells. It plays an important role in the synthesis of proteins. During protein synthesis, amino acids are joined and specifically ordered to create proteins. Specifically the amino acid tyrosine is added at the proper place in a protein's chain of amino acids as a function of the tyrosyl-tRNA synthetase activity. The crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase is disclosed in Qiu et al., Protein Science, 2001, v. 10, p. 2008. Based on this crystal structure combined with the knowledge of the critical amino acid differences in the protozoan tyrosyl-tRNA synthetases based on the teachings of the instant disclosure it is now possible to design therapeutic compounds that specifically inhibit protozoan tyrosyl-tRNA synthetase.
An "inhibitor of protozoan tyrosyl-tRNA synthetase" as used herein refers to any compound that reduces to any extent, partially or fully or completely inhibits the activity of protozoan tyrosyl-tRNA synthetase. The level of activity of protozoan tyrosyl-tRNA synthetase may be assessed using known in vitro or in vivo assays. In some
embodiments the level of protozoan tyrosyl-tRNA synthetase activity may be reduced by 10%, 20%, 30%, 40%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater. In some embodiments the level of protozoan tyrosyl-tRNA synthetase activity may be reduced by 100%. Compounds useful as inhibitors of the invention may specifically inhibit protozoan tyrosyl-tRNA synthetase. A compound that specifically inhibits protozoan tyrosyl-tRNA synthetase is a compound that reduces to any degree or inhibits protozoan tyrosyl-tRNA synthetase, but that does not therapeutically impact or inhibit human or animal or mammalian tyrosyl-tRNA synthetase. The phrase "therapeutically impact or inhibit human or animal or mammalian tyrosyl-tRNA synthetase" refers to a level of tyrosyl-tRNA synthetase activity.
In some embodiments a compound is said to not therapeutically impact human or animal tyrosyl-tRNA synthetase in an in vitro assay of human or animal tyrosyl-tRNA synthetase activity. In that assay the compound may inhibit activity of the human or animal tyrosyl-tRNA synthetase by less than 50%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1%, or 0.5%.
In some embodiments it is desirable for a compound that specifically inhibits protozoan tyrosyl-tRNA synthetase to be a compound that reduces to any degree or inhibits protozoan and bacterial tyrosyl-tRNA synthetase. In other embodiments it is desirable for a compound that specifically inhibits protozoan tyrosyl-tRNA synthetase to be a compound that reduces to any degree or inhibits protozoan tyrosyl-tRNA synthetase, but that does not therapeutically impact bacterial tyrosyl-tRNA synthetase. The phrase "therapeutically impact bacterial tyrosyl-tRNA synthetase" refers to a level of bacterial tyrosyl-tRNA synthetase activity.
In some embodiments a compound is said to not therapeutically impact bacterial tyrosyl-tRNA synthetase in an in vitro assay of bacterial tyrosyl-tRNA synthetase activity. In that assay the compound may inhibit activity of the bacterial tyrosyl-tRNA synthetase by less than 50%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5%, 4%, 3%, 2%, 1%, or 0.5%.
The inhibitor of protozoan tyrosyl-tRNA synthetase may specifically interact with or near an adenylate binding pocket of protozoan tyrosyl-tRNA synthetase. The adenylate binding pocket of protozoan tyrosyl-tRNA synthetase is known in the art. It has been discovered herein that the protozoan and animal tyrosyl-tRNA synthetases have important amino acid distinctions, particularly within this adenylate binding pocket, that create the opportunity for the development of drugs that bind to and disrupt activity of the protozoan tyrosyl-tRNA synthetase without significantly affecting the animal tyrosyl- tRNA synthetase. An exemplary amino acid sequence of a protozoan tyrosyl-tRNA synthetase is provided herein to highlight the adenylate binding pocket and the important amino acid distinctions. However, the invention is not limited to the exemplified amino acid sequence. Alternative sequences for this and other protozoan tyrosyl-tRNA synthetases are encompassed within the invention. The exemplary amino acid sequence of Plasmodium vivax is:
MEGEGVKREELEGATGEAAPQEAASQEATPQEDVSAKLADILSVASECIQPEEL
KARLLLKRRLVCYDGFEPSGRMHIAQGLLKCQIVNKLTSNGCRFIFWIADWFAQ
LNNKMSGDLKKIKKVGMYFIEVWKSCGMNMQNVEFLWASEEINKKPNEYWSL
VIDISKSFNINRIKRCLKIMGRSEGEENYCSQILYPCMQCADIFFLNVDICQLGIDQ
RKVNMLAREYCEIKKMKKKPIILSHQMLPGLLEGQEKMSKSDENSAIFMDDSEA
DVNRKIKKGYCPPGVIESNPIFAYARSIVFPHYNEFALQRKEKNGGNKTYATIAE LEADYLSGALHPLDLKDNVAIYLNKMLQPVRDHFQNDAAAKSLLSEIKKYKVT K (SEQ ID NO. 1)
An amino acid Sequence Alignment is depicted in Figure 1. Portions of SEQ ID NO. 1 are shown in Figure 1 in the sixth line down identified as Plasmodium.
Interesting residues of the Plasmodium sequence are compared against corresponding sequences of other protozoan tyrosyl-tRNA synthetases and a human tyrosyl-tRNA synthetase (H. sapiens) and a bacterial tyrosyl-tRNA synthetase (S. aureus). In particular, the amino acid positions corresponding to F70, Q80, K84, C85 and F127 of the Plasmodium vivax tyrosyl-tRNA synthetase in the depicted sequences are included in labeled boxes. These residues are in or near to the adenylate binding pocket.
Inhibitors which specifically recognize one or more or all of these amino acids in a Plasmodium and/or bacterial tyrosyl-tRNA synthetase may be useful in the methods of the invention.
The inhibitor of protozoan tyrosyl-tRNA synthetase in some aspects is a structural analog of tyrosyl-adenylate, the natural bound substrate of tyrosyl-tRNA synthetase protein (TyrRS). Structural analogs of tyrosyl-adenylate include, for example, naturally occurring tyrosyl-adenylate analog SB-219383, and synthesized derivatives SB-239629, SB-243545, and SB-284485. Other structural analogs include those described in publications such as Qiu et al., Protein Science, 2001, v. 10, p. 2008, Brown et al Bioorganic & Medicinal Chemistry Letters, 2001, v. 11, p. 711, and Jarvest et al Bioorganic & Medicinal Chemistry Letters, 2001, v. 11, p. 715.
Novel compounds for the inhibition of protozoan disease causing organisms are also provided. These compounds may be prepared by modifying known analogs such as SB-219383, SB-239629, SB-243545, and SB-284485 to provide improved selective and specific binding and inhibition of protozoan TyrRS. For instance the modifications may be such that they provide altered and preferably improved interactions at unique sites of protein interaction within and near the adenylate binding pocket, as defined in the Plasmodium vivax TyrS protein sequence, at sites F70, Q80, K84, C85, F127, as well as at adjacent structural sites. For example, chemical modifications of the analogous structure region of the butyl-ester group in SB-243545, may be made in order to accommodate the shape of the protozoan- specific binding pocket imposed by F70, Q80, and F127. Other alternative or supplemental chemical modifications of the 2', 3', and 4' hydroxyl groups of the adenylate analog ring in all of the structural variants may be made, in order to specifically interact with the protozoan- specific amino acids at sites Q80, K84, and C85. Compound variants that are highly selective against Plasmodium, made be generated by making chemical modifications to the 3' and 4' hydroxyl groups on the adenylate ring, such that a strong interaction with a unique, reactive Cys residue at position 85 conserved within the Plasmodium genus is produced. In some aspects of the invention the inhibitor of protozoan tyrosyl-tRNA synthetase is the compound of formula (I) or (II) or salts thereof.
Figure imgf000012_0001
Formula (I)
Figure imgf000013_0001
Formula (II) wherein each instance of R1 ; R2, R3, and R4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or
unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl;
wherein each instance of R5, R6, R7> R% and R9 is, independently, hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl; and
provided that the compound of Formula (I) is not a compound wherein R is a butyl ester or OH and R2, R3, and R^ are all OH,
provided that the compound of Formula (II) is not a compound wherein Ri is a butyl ester or OH, and R2, R3, R4, R5, and R7 are all OH, R9 are all H and one OH, and R6
Figure imgf000013_0002
In some embodiments the inhibitor of protozoan tyrosyl-tRNA synthetase is selected from the following compounds or salts thereof:
Figure imgf000014_0001
Figure imgf000015_0001
The invention also embraces analogs of the specific inhibitors described specifically or through incorporation by reference herein. Analogs are chemically modified versions of these inhibitors. In some embodiments, the inhibitor analogs have one or more activities of the specific inhibitors (as described herein), e.g. anti-protozoan activity. The one or more activities are preferably present in the inhibitor analogs in significant amounts, e.g., at greater than 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the activity of the specific inhibitors. More preferably, the one or more activities are preferably present in the inhibitor analogs at greater than 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, or more, of the activity of the specific inhibitors described herein. The inhibitor analogs may not have all of the activities of the specific inhibitors. However, non-active inhibitor analogs, having none of the anti- protozoan activities of specific inhibitors in significant amounts, are not useful in the methods of the invention.
According to the invention, useful inhibitors of protozoan tyrosyl-tRNA synthetase include any one or more inhibitors of protozoan tyrosyl-tRNA synthetase including but not limited to SB-219383, SB-239629, SB-243545, and SB-284485 and/or stereoisomeric forms, or pharmaceutically acceptable acid or base addition salt forms thereof or analogs thereof, in therapeutically effective amounts. The following publications describe compounds that are useful as inhibitors of protozoan tyrosyl-tRNA synthetase: Qiu et al., Protein Science, 2001, v. 10, p. 2008, Brown et al Bioorganic & Medicinal Chemistry Letters, 2001, v. 11, p. 711, and Jarvest et al Bioorganic &
Medicinal Chemistry Letters, 2001, v. 11, p. 715. The disclosures of these publications are incorporated by reference herein in their entirety for the disclosure of inhibitors of tyrosyl-tRNA synthetase that are useful in the methods of the invention. The invention embraces analogs of the specific inhibitors that, while identical in their chemical inhibition and binding of protozoan TyrRS, produce the additional activities of increased cell uptake/persistence, so as to effectively increase their binding and inhibition. For example, some modification of the compound may decrease the charge, allowing for passage through the cell membrane. The compounds are, thus, effective without increase binding affinity or specificity to the target. These different inhibitor compounds and preparations described herein can be administered as a single dose or in several doses administered over a period of time (e.g. chronic administration at regular intervals of time) as described herein. Methods and compositions of the invention include stereoisomeric forms and pharmaceutically acceptable acid or base addition salt forms of the inhibitors of protozoan tyrosyl-tRNA synthetase.
Additionally, inhibitors of protozoan tyrosyl-tRNA synthetase include, for instance, inhibitory nucleic acids.
A protozoan tyrosyl-tRNA synthetase inhibitory nucleic acid causes specific gene knockdown, while avoiding off-target effects, such as knockdown of the human tyrosyl- tRNA synthetase. Various strategies for gene knockdown known in the art can be used to inhibit gene expression. For example, gene knockdown strategies may be used that make use of RNA interference (RNAi) and/or microRNA (miRNA) pathways including small interfering RNA (siRNA), short hairpin RNA (shRNA), double- stranded RNA (dsRNA), miRNAs, and other small interfering nucleic acid-based molecules known in the art. In one embodiment, vector-based RNAi modalities (e.g., shRNA or shRNA-mir expression constructs) are used to reduce expression of a gene (e.g., a protozoan tyrosyl- tRNA synthetase) in a cell. In some embodiments, therapeutic compositions of the invention comprise an isolated plasmid vector (e.g., any isolated plasmid vector known in the art or disclosed herein) that expresses a small interfering nucleic acid such as an shRNA. The isolated plasmid may comprise a protozoan-specific promoter operably linked to a gene encoding the small interfering nucleic acid. In some cases, the isolated plasmid vector is packaged in a virus capable of infecting the individual. Exemplary viruses include adenovirus, retrovirus, lentivirus, adeno-associated virus, and others that are known in the art and disclosed herein.
A broad range of RNAi-based modalities could be employed to inhibit expression of a gene in a cell, such as siRNA-based oligonucleotides and/or altered siRNA-based oligonucleotides. Altered siRNA based oligonucleotides are those modified to alter potency, target affinity, safety profile and/or stability, for example, to render them resistant or partially resistant to intracellular degradation. Modifications, such as phosphorothioates, for example, can be made to oligonucleotides to increase resistance to nuclease degradation, binding affinity and/or uptake. In addition, hydrophobization and bioconjugation enhances siRNA delivery and targeting (De Paula et al., RNA. 13(4):431- 56, 2007) and siRNAs with ribo-difluorotoluyl nucleotides maintain gene silencing activity (Xia et al., ASC Chem. Biol. 1(3): 176-83, (2006)). siRNAs with amide-linked oligoribonucleosides have been generated that are more resistant to SI nuclease degradation than unmodified siRNAs (Iwase R et al. 2006 Nucleic Acids Symp Ser 50: 175-176). In addition, modification of siRNAs at the 2'-sugar position and
phosphodiester linkage confers improved serum stability without loss of efficacy (Choung et al., Biochem. Biophys. Res. Commun. 342(3):919-26, 2006). Other molecules that can be used to inhibit expression of a gene (e.g., a CSC-associated gene) include sense and antisense nucleic acids (single or double stranded), ribozymes, peptides, DNAzymes, peptide nucleic acids (PNAs), triple helix forming
oligonucleotides, antibodies, and aptamers and modified form(s) thereof directed to sequences in gene(s), RNA transcripts, or proteins. Antisense and ribozyme suppression strategies have led to the reversal of a tumor phenotype by reducing expression of a gene product or by cleaving a mutant transcript at the site of the mutation (Carter and Lemoine Br. J. Cancer. 67(5):869-76, 1993; Lange et al., Leukemia. 6(11): 1786-94, 1993; Valera et al., J. Biol. Chem. 269(46):28543-6, 1994; Dosaka-Akita et al., Am. J. Clin. Pathol. 102(5):660-4, 1994; Feng et al., Cancer Res. 55(10):2024-8, 1995; Quattrone et al., Cancer Res. 55(l):90-5, 1995; Lewin et al., Nat Med. 4(8):967-71, 1998). Ribozymes have also been proposed as a means of both inhibiting gene expression of a mutant gene and of correcting the mutant by targeted trans-splicing (Sullenger and Cech Nature 371(6498):619-22, 1994; Jones et al., Nat. Med. 2(6):643-8, 1996). Ribozyme activity may be augmented by the use of, for example, non-specific nucleic acid binding proteins or facilitator oligonucleotides (Herschlag et al., Embo J. 13(12):2913-24, 1994;
Jankowsky and Schwenzer Nucleic Acids Res. 24(3):423-9,1996). Multitarget ribozymes (connected or shotgun) have been suggested as a means of improving efficiency of ribozymes for gene suppression (Ohkawa et al., Nucleic Acids Symp Ser. (29): 121-2, 1993). Triple helix approaches have also been investigated for sequence- specific gene suppression. Triple helix forming oligonucleotides have been found in some cases to bind in a sequence- specific manner (Postel et al., Proc. Natl. Acad. Sci. U.S.A.
88(18):8227-31, 1991; Duval- Valentin et al., Proc. Natl. Acad. Sci. U.S.A. 89(2):504-8, 1992; Hardenbol and Van Dyke Proc. Natl. Acad. Sci. U.S.A. 93(7):2811-6, 1996;
Porumb et al., Cancer Res. 56(3):515-22, 1996). Similarly, peptide nucleic acids have been shown to inhibit gene expression (Hanvey et al., Antisense Res. Dev. 1(4):307-17, 1991; Knudsen and Nielson Nucleic Acids Res. 24(3):494-500, 1996; Taylor et al., Arch. Surg. 132(11): 1177-83, 1997). Minor-groove binding polyamides can bind in a sequence-specific manner to DNA targets and hence may represent useful small molecules for suppression at the DNA level (Trauger et al., Chem. Biol. 3(5):369-77, 1996). In addition, suppression has been obtained by interference at the protein level using dominant negative mutant peptides and antibodies (Herskowitz Nature
329(6136):219-22, 1987; Rimsky et al., Nature 341(6241):453-6, 1989; Wright et al., Proc. Natl. Acad. Sci. U.S.A. 86(9):3199-203, 1989). The diverse array of suppression strategies that can be employed includes the use of DNA and/or RNA aptamers that can be selected to target a protein of interest (e.g, a protozoan tyrosyl-tRNA synthetase).
In one aspect, the invention provides methods for the treatment of protozoan disease. "Protozoan disease", as used herein, refers to a condition resulting from infection by a host with a protozoan. A host, as used herein, refers to a subject. As used herein, a subject is a human or non-human animal such as non-human primates, dogs, cats, sheep, goats, cows, pigs, horses and rodents. Thus the invention encompasses the use of the inhibitors described herein alone or in combination with other therapeutics for the treatment of a subject having or at risk of having a protozoan infection. Typically, the subject that has had contact with a protozoan and the protozoan has invaded the body of the subject. The word "invade" as used herein refers to contact by the protozoan with an external surface of the subject, e.g., skin or mucosal membranes and/or refers to the penetration of the external surface of the subject by the protozoan, indirect protozoan penetration of the external surface of the subject by an infected insect, or ingestion of the protozoan via contaminated food or water. A subject at risk of having a protozoan infection is one that has been exposed to or may become exposed to a protozoan or a geographical area in which a protozoan infection has been reported. Further risks include close contact with a human or non-human primate or their tissues infected with the protozoan. Such persons include laboratory or quarantine facility workers who handle non-human primates that have been associated with the disease. In addition, hospital staff and family members who care for patients with the disease are at risk if they do not use proper barrier nursing techniques.
The methods of the invention are useful for treating a subject in need thereof. A subject in need thereof is a subject having or at risk of having a protozoan infection. In its broadest sense, the terms "treatment" or "to treat" refer to both therapeutic and prophylactic treatments. If the subject in need of treatment is experiencing a condition (i.e., has or is having a particular condition), then "treating the condition" refers to ameliorating, reducing or eliminating one or more symptoms arising from the condition. If the subject in need of treatment is one who is at risk of having a condition, then treating the subject refers to reducing the risk of the subject having the condition or, in other words, decreasing the likelihood that the subject will develop an infectious disease to the virus, as well as to a treatment after the subject has been infected in order to fight the infectious disease, e.g., reduce or eliminate it altogether or prevent it from becoming worse.
The inhibitors described herein are isolated molecules. An isolated molecule is a molecule that is substantially pure and is free of other substances with which it is ordinarily found in nature or in vivo systems to an extent practical and appropriate for its intended use. In particular, the molecular species are sufficiently pure and are sufficiently free from other biological constituents of host cells so as to be useful in, for example, producing pharmaceutical preparations or sequencing if the molecular species is a nucleic acid, peptide, or polysaccharide. Because an isolated molecular species of the invention may be admixed with a pharmaceutically- acceptable carrier in a pharmaceutical preparation or be mixed with some of the components with which it is associated in nature, the molecular species may comprise only a small percentage by weight of the preparation. The molecular species is nonetheless substantially pure in that it has been substantially separated from the substances with which it may be associated in living systems.
Protozoan are typically microscopic, one-celled organisms that are heterotrophic (using organic carbon as a source of energy). They belong to any of the major lineages of protists and, are eukaryotes. As such they possess a "true," or membrane-bound, nucleus. Many protozoan are symbionts of other organisms. They are able to multiply in humans, which contributes to their survival and also permits serious infections to develop from just a single organism. Some medically important protozoans include Archaezoa (Giardia lamblia, Trichomonas vaginalis), Amoebozoa (Entamoeba histolytica), Apicomplexa (Babesia microti, Cryptosporidium, Cyclospora, Plasmodium, Toxoplasma Gondii), Euglenozoa (Trypanosoma cruzi, T.b. gambiense,T.b.
rhodesiense).
Examples of protozoan species include Leishmania aethiopica, Leishmania amazonensis, Leishmania arabica, Leishmania archibaldi, Leishmania aristedesi, Leishmania (Viannia) braziliensis, Leishmania chagasi (syn. Leishmania infantum), Leishmania (Viannia) colombiensis, Leishmania deanei, Leishmania donovani,
Leishmania enriettii, Leishmania equatorensis, Leishmania forattinil, Leishmania garnhami, Leishmania gerbili, Leishmania (Viannia) guyanensis, Leishmania herreri, Leishmania hertigi, Leishmania infantum, Leishmania killicki, Leishmania (Viannia) lainsoni, Leishmania major, Leishmania mexicana, Leishmania (Viannia) naiffi,
Leishmania (Viannia) panamensis, Leishmania (Viannia) peruviana, Leishmania
(Viannia) pifanoi, Leishmania (Viannia) shawi, Leishmania tarentolae, Leishmania tropica, Leishmania turanica, Leishmania venezuelensis, Plasmodium berghei,
Plasmodium brasilianum, Plasmodium chabaudi, Plasmodium cynomolgi, Plasmodium falciparum spp., Plasmodium gallinaceum, Plasmodium knowlesi, Plasmodium lophurae, Plasmodium malariae, Plasmodium ovale, Plasmodium relictum, Plasmodium vivax, Plasmodium yoelii, Trypanosoma avium, which causes trypanosomiasis in birds, T. boissoni, T. brucei, which causes sleeping sickness in humans and nagana in cattle, T. carassii, T. cruzi, which causes Chagas disease in humans, T. congolense, which causes nagana in cattle, horses, and camels, Trypanosoma equinum Voges 1901, T. equiperdum, which causes dourine or Covering sickness in horses and other Equidae, T. evansi, which causes one form of the disease surra in certain animals (human infection reported in 2005 in India), Trypanosoma lewisi, Trypanosoma melophagium, Trypanosoma percae, Trypanosoma rangeli, T. rotatorium in amphibian, T. simiae, which causes nagana in animals, T. suis, T. theileri, T. triglae in marine teleosts, T. vivax, which causes the disease nagana, Trichomonas vaginalis, Entamoeba histolytica, Giardia lamblia, Eimeria acervulina, Eimeria tenella, Eimeria maxima, and Sarcocystis species, particularly the species that infect humans, opposums, and horses.
The protozoan disease does not include disease associated with fungal or yeast infections or Candida or worms.
Protozoan infections are widely known mainly around tropical or subtropical regions, and can be exemplified by malaria, leishmaniasis, African trypanosomiasis (African sleeping sickness), American trypanosomiasis (Chaga's disease), lymphatic filariasis, and babesiosis. These infections can be classified into those infecting only humans, and zoonosis also infecting domestic livestock or small animals, both leading to significant economic and social loss , as well as providing reservoirs for human disease, or as essential non-human vectors in a parasitic life cycle infecting humans at another stage. Thus, the methods of the invention include methods of treating humans as well as non-human animals. Leishmaniasis is a life-threatening disease that is a major health problem worldwide. An estimated 10-15 million people are infected, and 400,000 new cases occur each year. Currently no vaccine is available against Leishmania and the generic, antimony-based drug treatments are plagued with low efficacy, high toxicity and widespread resistance. Trypanosoma cause life-threatening diseases in humans, including African sleeping sickness and Chagas disease, as well as a number of important diseases in domestic animals. Leishmania and Trypanosoma are closely-related genera, representing the major pathogens in the kinetoplastid group of protozoa. The intestinal parasite Entamoeba histolytica causes amoebic dysentery and extraintestinal abscesses of organs such as the liver and lung. The most commonly used drug for treating E. histolytica infection is metronidazole. Other free-living amoeba, which occasionally cause infections in humans, include Acanthamoeba and Naegleria spp.; these infections are typically difficult to treat.
Toxoplasma gondii; and several protozoans of veterinary importance such as Sarcocystis; Theileria; Babesia; and Eimeria (causing coccidiosis in fowl and domestic animals) are also the cause of relevant protozoan diseases.
Toxoplasma gondii is the causative agent in toxoplasmosis. In contrast to the mild clinical symptoms of infection seen in a healthy individual with an intact immune system, subjects with weakened, or otherwise compromised, immune systems can have serious clinical effects from toxoplasma infection. Toxoplasma gondii is also pathogenic to animals, particularly sheep, in which it causes abortion, stillbirth, and fetal
mummification. In addition, Toxoplasma gondii causes encephalitis, a dangerous life- threatening disease in both man and domestic animals. Toxoplasma gondii infections via cat vectors, present an important risk for pregnant women.
Plasmodium falciparum causes a severe form of human malaria and is responsible for nearly all malaria- specific mortality. Resistance of Plasmodium to antimalarial drugs is an increasingly serious problem in fighting the disease. Ticks transmit babesiosis, and although this is primarily a disease of animals, humans are also infected with this parasite. There are over 100 species of Babesia, with Babesia microti and Babesia divergens the two most likely to cause human infection. Babesia microti is the organism responsible for a growing number of cases of infection especially in the northeast United States. Babesiosis is not only transmitted via tick bites, it can also be transmitted via blood transfusions, with documented cases of infection via this method.
There are numerous species of Eimeria, and an oral/fecal route of transmission results in intestinal infection in cows, sheep, goats, pigs, ducks, chickens, turkeys, and rabbits, with the domestic chicken host to at least seven different species of Eimeria. Due to its widespread nature and its effects on the host animal, which may result in sub- optimal weight gain and reduced economic value, Eimeria is an economically important disease in the modern poultry production. A subject may or may not exhibit symptoms of infection such as fever, swollen lymph glands, muscle aches, and pains. Methods to diagnose symptomatic and asymptomatic protozoan infection are known to those of ordinary skill in the art.
Diagnostic methods include, for instance, but are not limited to, blood tests for antibodies to the protozoan parasite and other assays such as lymph assays for protozoan parasites. Scans by computerized tomography (CT scan) or magnetic resonance imaging (MRI scan) may also be used in the diagnosis of some types of protozoan infection, for example brain scans for Toxoplasma infection.
In some instances the inhibitors of the invention may be specially formulated for veterinary delivery. For instance, the inhibitors of the invention may be incorporated into animal feed or combined with other medications being delivered to an animal in order to treat the infection. Additionally, animal specific, i.e. cat-specific, antibiotics may be used on a cat in order to prevent a pregnant women who may be exposed to the cat from being exposed to an infection.
The therapeutic compounds described herein can be administered in combination with other therapeutic agents and such administration may be simultaneous or sequential. When the other therapeutic agents are administered simultaneously they can be administered in the same or separate formulations, but are administered at the same time. The administration of the other therapeutic agent, including anti-protozoan agents can also be temporally separated, meaning that the therapeutic agents are administered at a different time, either before or after, the administration of the therapeutics described herein. The separation in time between the administration of these compounds may be a matter of minutes or it may be longer.
Thus, in some instances, the invention also involves administering another anti- protozoan agents to a subject. Examples of existing or proposed anti-protozoan agents include Antiamoebic and antigiardiasis medicines: Diloxanide, Metronidazole;
Antileishmaniasis medicines: Amphotericin B, Meglumine antimoniate, Pentamidine, Pentostam; Antimalarial medicines: Amodiaquine, Artemether, Artemether +
lumefantrine, Artesunate,Chloroquine, Doxycycline, Mefloquine, Primaquine, Quinine, Sulfadoxine + pyrimethamine, Chloroquine, Doxycycline, Mefloquine, Proguanil, Malarone; Antipneumocytosis and antitoxoplasmosis medicines: Pentamidine,
Pyrimethamine, Sulfamethoxazole + Trimethoprim; Antitrypanosomal medicines:
African trypanosomiasis (Eflornithine, Melarsoprol, Pentamidine, Suramin sodium), American trypanosomiasis: (Benznidazole, Nifurtimox).
When used in combination with the therapies of the invention the dosages of known therapies may be reduced in some instances, to avoid side effects.
The active agents of the invention are administered to the subject in an effective amount for treating the subject. An "effective amount", for instance, is an amount necessary or sufficient to realize a desired biologic effect. For instance an effective amount is that amount sufficient to prevent or inhibit protozoan growth or proliferation or alternatively an amount sufficient to induce apoptosis of a protozoan.
The effective amount of a compound of the invention in the treatment of a subject may vary depending upon the specific compound used, the mode of delivery of the compound, and whether it is used alone or in combination. The effective amount for any particular application can also vary depending on such factors as the type and/or degree of infection in a subject, the particular compound being administered for treatment, the size of the subject, or the severity of the disorder. One of ordinary skill in the art can empirically determine the effective amount of a particular molecule of the invention without necessitating undue experimentation. Combined with the teachings provided herein, by choosing among the various active compounds and weighing factors such as potency, relative bioavailability, patient body weight, severity of adverse side-effects and preferred mode of administration, an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity in and of itself and yet is entirely effective to treat the particular subject.
Toxicity and efficacy of the protocols of the present invention can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio
LD50/ED50. Prophylactic and/or therapeutic agents that exhibit large therapeutic indices are preferred. While prophylactic and/or therapeutic agents that exhibit toxic side effects may be used, care should be taken to design a delivery system that targets such agents to the site of affected tissue in order to minimize potential damage to uninfected cells and, thereby, reduce side effects.
The data obtained from the cell culture assays, animal studies and human studies can be used in formulating a range of dosage of the prophylactic and/or therapeutic agents for use in humans. The dosage of such agents lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. For any agent used in the method of the invention, the
therapeutically effective dose can be estimated initially from cell culture assays. A dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of the test compound that achieves a half- maximal inhibition of symptoms) as determined in cell culture. Such information can be used to more accurately determine useful doses in humans. Levels in plasma may be measured, for example, by high performance liquid chromatography.
As used herein, the term treat, treated, or treating when used with respect to a disorder refers to a prophylactic treatment which increases the resistance of a subject to development of the disease or, in other words, decreases the likelihood that the subject will develop the disease as well as a treatment after the subject has developed the disease in order to fight the disease, prevent the disease from becoming worse, or slow the progression of the disease compared to in the absence of the therapy.
Multiple doses of the molecules of the invention are also contemplated. In some instances, when the molecules of the invention are administered with another therapeutic, for instance, a chemotherapeutic agent a sub-therapeutic dosage of either or both of the molecules may be used. A "sub-therapeutic dose" as used herein refers to a dosage which is less than that dosage which would produce a therapeutic result in the subject if administered in the absence of the other agent.
Pharmaceutical compositions of the present invention comprise an effective amount of one or more agents, dissolved or dispersed in a pharmaceutically acceptable carrier. The phrases "pharmaceutical or pharmacologically acceptable" refers to molecular entities and compositions that do not produce an adverse, allergic or other untoward reaction when administered to an animal, such as, for example, a human, as appropriate. Moreover, for animal (e.g. , human) administration, it will be understood that preparations should meet sterility, pyrogenicity, general safety and purity standards as required by FDA Office of Biological Standards. The compounds are generally suitable for administration to humans. This term requires that a compound or
composition be nontoxic and sufficiently pure so that no further manipulation of the compound or composition is needed prior to administration to humans.
As used herein, "pharmaceutically acceptable carrier" includes any and all solvents, dispersion media, coatings, surfactants, antioxidants, preservatives (e.g. , antibacterial agents, antifungal agents), isotonic agents, absorption delaying agents, salts, preservatives, drugs, drug stabilizers, gels, binders, excipients, disintegration agents, lubricants, sweetening agents, flavoring agents, dyes, such like materials and
combinations thereof, as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences (1990), incorporated herein by reference). Except insofar as any conventional carrier is incompatible with the active ingredient, its use in the therapeutic or pharmaceutical compositions is contemplated. The compounds may be sterile or non-sterile.
The agent may comprise different types of carriers depending on whether it is to be administered in solid, liquid or aerosol form, and whether it need to be sterile for such routes of administration as injection. The present invention can be administered intravenously, intradermally, intraarterially, intralesionally, intratumorally, intracranially, intraarticularly, intraprostaticaly, intrapleurally, intratracheally, intranasally,
intravitreally, intravaginally, intrarectally, topically, intratumorally, intramuscularly, intraperitoneally, subcutaneously, subconjunctival, intravesicularlly, mucosally, intrapericardially, intraumbilically, intraocularally, orally, topically, locally, inhalation (e.g., aerosol inhalation), injection, infusion, continuous infusion, localized perfusion bathing target cells directly, via a catheter, via a lavage, in creams, in lipid compositions (e.g. , liposomes), or by other method or any combination of the forgoing as would be known to one of ordinary skill in the art (see, for example, Remington's Pharmaceutical Sciences (1990), incorporated herein by reference). In a particular embodiment, intraperitoneal injection is contemplated.
In any case, the composition may comprise various antioxidants to retard oxidation of one or more components. Additionally, the prevention of the action of microorganisms can be brought about by preservatives such as various antibacterial and antifungal agents, including but not limited to parabens (e.g. , methylparabens, propylparabens), chlorobutanol, phenol, sorbic acid, thimerosal or combinations thereof.
The agent may be formulated into a composition in a free base, neutral or salt form. Pharmaceutically acceptable salts, include the acid addition salts, e.g. , those formed with the free amino groups of a proteinaceous composition, or which are formed with inorganic acids such as for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric or mandelic acid. Salts formed with the free carboxyl groups also can be derived from inorganic bases such as for example, sodium, potassium, ammonium, calcium or ferric hydroxides; or such organic bases as isopropylamine, trimethylamine, histidine or procaine.
In embodiments where the composition is in a liquid form, a carrier can be a solvent or dispersion medium comprising but not limited to, water, ethanol, polyol (e.g. , glycerol, propylene glycol, liquid polyethylene glycol, etc.), lipids (e.g. , triglycerides, vegetable oils, liposomes) and combinations thereof. The proper fluidity can be maintained, for example, by the use of a coating, such as lecithin; by the maintenance of the required particle size by dispersion in carriers such as, for example liquid polyol or lipids; by the use of surfactants such as, for example hydroxypropylcellulose; or combinations thereof such methods. In many cases, it will be preferable to include isotonic agents, such as, for example, sugars, sodium chloride or combinations thereof.
The compounds of the invention may be administered directly to a tissue. Direct tissue administration may be achieved by direct injection. The compounds may be administered once, or alternatively they may be administered in a plurality of administrations. If administered multiple times, the compounds may be administered via different routes. For example, the first (or the first few) administrations may be made directly into the affected tissue while later administrations may be systemic.
The formulations of the invention are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients. In general, a pharmaceutical composition comprises the compound of the invention and a pharmaceutically-acceptable carrier. Pharmaceutically-acceptable carriers for nucleic acids, small molecules, peptides, monoclonal antibodies, and antibody fragments are well-known to those of ordinary skill in the art. As used herein, a pharmaceutically-acceptable carrier means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients.
Pharmaceutically acceptable carriers include diluents, fillers, salts, buffers, stabilizers, solubilizers and other materials which are well-known in the art. Exemplary pharmaceutically acceptable carriers for peptides in particular are described in U.S. Patent No. 5,211,657. Such preparations may routinely contain salt, buffering agents, preservatives, compatible carriers, and optionally other therapeutic agents. When used in medicine, the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically-acceptable salts thereof and are not excluded from the scope of the invention. Such pharmacologically and pharmaceutically-acceptable salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulfuric, nitric, phosphoric, maleic, acetic, salicylic, citric, formic, malonic, succinic, and the like. Also, pharmaceutically- acceptable salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts.
The compounds of the invention may be formulated into preparations in solid, semi-solid, liquid or gaseous forms such as tablets, capsules, powders, granules, ointments, solutions, depositories, inhalants and injections, and usual ways for oral, parenteral or surgical administration. The invention also embraces pharmaceutical compositions which are formulated for local administration, such as by implants. Compositions suitable for oral administration may be presented as discrete units, such as capsules, tablets, lozenges, each containing a predetermined amount of the active agent. Other compositions include suspensions in aqueous liquids or non-aqueous liquids, such as a syrup, an elixir or an emulsion.
For oral administration, the compounds can be formulated readily by combining the active compounds with pharmaceutically acceptable carriers well known in the art. Such carriers enable the compounds of the invention to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated. Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or
polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. Optionally the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.
Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
Pharmaceutical preparations which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added.
Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.
For buccal administration, the compositions may take the form of tablets or lozenges formulated in conventional manner.
For administration by inhalation, the compounds for use according to the present invention may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g. , dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g. gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch. Techniques for preparing aerosol delivery systems are well known to those of skill in the art.
Generally, such systems should utilize components which will not significantly impair the biological properties of the active agent (see, for example, Sciarra and Cutie, "Aerosols," in Remington's Pharmaceutical Sciences, 18th edition, 1990, pp 1694-1712; incorporated by reference). Those of skill in the art can readily determine the various parameters and conditions for producing aerosols without resort to undue
experimentation .
The compounds, when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g. , by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g. , in ampoules or in multi-dose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like. Lower doses will result from other forms of administration, such as intravenous administration. In the event that a response in a subject is insufficient at the initial doses applied, higher doses (or effectively higher doses by a different, more localized delivery route) may be employed to the extent that patient tolerance permits. Multiple doses per day are contemplated to achieve appropriate systemic levels of compounds.
Both non-biodegradable and biodegradable polymeric matrices can be used to deliver the agents of the invention to the subject. Biodegradable matrices are preferred. Such polymers may be natural or synthetic polymers. Synthetic polymers are preferred. The polymer is selected based on the period of time over which release is desired, generally in the order of a few hours to a year or longer. Typically, release over a period ranging from between a few hours and three to twelve months is most desirable. The polymer optionally is in the form of a hydrogel that can absorb up to about 90% of its weight in water and further, optionally is cross-linked with multivalent ions or other polymers.
In one embodiment, a kit comprises an inhibitor of protozoan tyrosyl-tRNA synthetase and instructions for administering the same. The kit may further comprise devices for administering the inhibitors, and/or other therapeutics or diagnostics related to the therapy.
"Instructions" can define a component of promotion, and typically involve written instructions on or associated with packaging of compositions of the invention. Instructions also can include any oral or electronic instructions provided in any manner.
Thus the agents described herein may, in some embodiments, be assembled into pharmaceutical or diagnostic or research kits to facilitate their use in therapeutic, diagnostic or research applications. A kit may include one or more containers housing the components of the invention and instructions for use. Specifically, such kits may include one or more agents described herein, along with instructions describing the intended therapeutic application and the proper administration of these agents. In certain embodiments agents in a kit may be in a pharmaceutical formulation and dosage suitable for a particular application and for a method of administration of the agents.
The kit may be designed to facilitate use of the methods described herein by physicians and can take many forms. Each of the compositions of the kit, where applicable, may be provided in liquid form (e.g., in solution), or in solid form, (e.g., a dry powder). In certain cases, some of the compositions may be constitutable or otherwise processable (e.g., to an active form), for example, by the addition of a suitable solvent or other species (for example, water or a cell culture medium), which may or may not be provided with the kit. As used herein, "instructions" can define a component of instruction and/or promotion, and typically involve written instructions on or associated with packaging of the invention. Instructions also can include any oral or electronic instructions provided in any manner such that a user will clearly recognize that the instructions are to be associated with the kit, for example, audiovisual (e.g., videotape, DVD, etc.), Internet, and/or web-based communications, etc. The written instructions may be in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which instructions can also reflects approval by the agency of manufacture, use or sale for human administration.
The kit may contain any one or more of the components described herein in one or more containers. As an example, in one embodiment, the kit may include instructions for mixing one or more components of the kit and/or isolating and mixing a sample and applying to a subject. The kit may include a container housing agents described herein. The agents may be prepared sterilely, packaged in syringe and shipped refrigerated. Alternatively it may be housed in a vial or other container for storage. A second container may have other agents prepared sterilely. Alternatively the kit may include the active agents premixed and shipped in a syringe, vial, tube, or other container. Computational techniques can be used to screen, identify, select, and design compounds capable of binding to the protozoan tyrosyl-tRNA synthetase or optionally the adenylate binding pocket thereof and functioning inhibitors. In particular, computational techniques can be used to identify or design ligands, such as agonists and/or antagonists, that associate with the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. Once identified and screened for biological activity, these agonists, antagonists, and combinations thereof, may be used therapeutically, for example, to inhibit protozoan tyrosyl-tRNA synthetase activity. Data stored in a machine-readable storage medium that is capable of displaying a graphical three- dimensional representation of the structure of the potential therapeutic compound or a structurally homologous molecule or molecular complex, as identified herein, or portions thereof may thus be advantageously used for drug discovery. The structure coordinates of the potential therapeutic compounds are used to generate a three-dimensional image that can be computationally fit to the three-dimensional image of the protozoan tyrosyl- tRNA synthetase or the adenylate binding pocket thereof. The three-dimensional molecular structure encoded by the data in the data storage medium can then be computationally evaluated for its ability to associate with the potential therapeutic compound. When the molecular structures encoded by the data is displayed in a graphical three-dimensional representation on a computer screen, the protein structure can also be visually inspected for potential association with the potential therapeutic compound. Additionally, programs are available for the "threading" of protozoan TyrRS sequences to existing known TyrRS structures for use in fitting, if the specific crystal structures of the individual protozoan TyrRS proteins are not in existence.
One embodiment of the method of drug design involves evaluating the potential association of a candidate therapeutic compound with the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. The method of drug design thus includes computationally evaluating the potential of a selected ligand to associate with any of the molecules or molecular complexes set forth above. This method includes the steps of: (a) employing computational means, for example, such as a programmable computer including the appropriate software known in the art or as disclosed herein, to perform a fitting operation between the potential therapeutic compound and the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof and (b) analyzing the results of the fitting operation to quantify the association between the potential therapeutic compound and the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. Several methods can be used to screen potential therapeutic compounds for the ability to associate with the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. Selected potential therapeutic compounds may be positioned in a variety of orientations associating with the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. This may be accomplished using software such as QUANTA (Molecular Simulations, Inc., San Diego, CA, USA.) and SYBYL (TRIPOS, St. Louis, MO, USA), followed by energy minimization and molecular dynamics with standard molecular mechanics force fields, such as CHARMM (Molecular Simulations, Inc., San Diego, CA, USA) and AMBER (P. A. Kollman, University of California at San Francisco, San Francisco, CA, USA).
Any of the biological or biochemical functions mediated by the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof can be used as an endpoint assay to identify an agent that modulates protozoan tyrosyl-tRNA synthetase activity (a putative therapeutic compound). The assays may include all of the
biochemical or biochemical/biological events described herein, in the references-cited herein, incorporated by reference for these endpoint assay targets, and other functions known to those of ordinary skill in the art or that can be readily identified. Compounds can be identified through cellular assays. Cellular assays may involve, for instance, expressing the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof in cells and testing a variety of compounds for their ability to bind to the expressed peptide. The assay may be performed with labeled compounds, facilitating identification of the compound that binds. In another embodiment a biological readout can be used to identify a putative therapeutic compound. Biological assays will allow for the identification of both agonists and antagonists or inhibitors. Competition binding assays may also be used to discover compounds that interact with the protozoan tyrosyl- tRNA synthetase or the adenylate binding pocket thereof (e.g. binding partners and/or ligands). Thus, a compound is exposed to the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof under conditions that allow the compound to bind or to otherwise interact with the polypeptide. A peptide or antibody or fragment thereof against the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof may be added to the mixture. If the test compound interacts with the protozoan tyrosyl- tRNA synthetase or the adenylate binding pocket thereof, it decreases the amount of peptide or antibody that can bind to the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof. To perform cell free drug screening assays, it is sometimes desirable to immobilize the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof, or its target molecule to facilitate separation of complexes from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Agents that modulate the protozoan tyrosyl-tRNA synthetase or the adenylate binding pocket thereof can be identified using one or more of the above assays, alone or in combination. It is generally preferable to use a cell-based or cell free system first and then confirm activity in an animal or other model system. Such model systems are well known in the art and can readily be employed in this context.
Some additional sequences for tyrosyl -tRNA synthetases are included below.
Cryptosporidium parvum (GL323509769): MVILVKYSKT SNIGKVVSLL VNYLLKQNTE LKIEESIIDE NSTNEKNINQ VVLIKDKENC NDQLESIVDI LIYLGSFGKN LLGKDSSLIN ESKEIIEKLI KINFNFSKGT EMSEFNEMIK GKSFFLGRSL TIVDLVIYIS LYSYFESLKD QNQDYIPEYP NLSTFFEQIQ IVTLIRQSCP EGINYLDLPF FKKKLVKKEK KNTGEHGNNS NNNKQEERPL DDPTRIALRV GRILSVEKHP TADKLYLEKI DVGEDEPRTI LSGLVGVYDL TQKINKLVVI VSNLKPRAMR GITSNGMLLC ASSAPSGDNN NNNSQNQSSK EYCEPVSVPK DAKVGELIFY NDFKGEPDVV LNTKTGKDPF AAVQPNYNVS SDLLCRFKES TMMTSAGPVF VENKNLIHGK LS (SEQ ID NO. 2)
Human (GI: 119627912 or 2665519): MGDAPSPEEK LHLITRNLQE
VLGEEKLKEI LKERELKIYW GTATTGKPHV AYFVPMSKIA DFLKAGCEVT ILFADLHAYL DNMKAPWELL ELRVSYYENV IKAMLESIGV PLEKLKFIKG TDYQLSKEYT LDVYRLSSVV TQHDSKKAGA EVVKQVEHPL LSGLLYPGLQ ALDEEYLKVD AQFGGIDQRK IFTFAEKYLP ALGYSKRVHL MNPMVPGLTG SKMSSSEEES KIDLLDRKED VKKKLKKAFC EPGNVENNGV LSFIKHVLFP LKSEFVILRD EKWGGNKTYT AYVDLEKDFA AEVVHPGDLK NSVEVALNKL LDPIREKFNT PALKKLASAA YPDPSKQKPM AKGPAKNSEP EEVIPSRLDI RVGKIITVEK HPDADSLYVE KIDVGEAEPR TVVSGLVQFV PKEELQDRLV VVLCNLKPQK MRGVESQGML LCASIEGINR QVEPLDPPAG SAPGEHVFVK GYEKGQPDEE LKPKKKVFEK LQADFKISEE CIAQWKQTNF MTKLGSISCK SLKGGNIS (SEQ ID NO 3)
Escherichia coli str. K-12 (GI: 16129595): MASSNLIKQL QERGLVAQVT DEEALAERLA QGPIALYCGF DPTADSLHLG HLVPLLCLKR FQQAGHKPVA LVGGATGLIG DPSFKAAERK LNTEETVQEW VDKIRKQVAP FLDFDCGENS AIAANNYDWF GNMNVLTFLR DIGKHFSVNQ MINKEAVKQR LNREDQGISF TEFSYNLLQG YDFACLNKQY GVVLQIGGSD QWGNITSGID LTRRLHQNQV FGLTVPLITK ADGTKFGKTE GGAVWLDPKK TSPYKFYQFW INTADADVYR FLKFFTFMSI EEINALEEED KNSGKAPRAQ YVLAEQVTRL VHGEEGLQAA KRITECLFSG SLSALSEADF EQLAQDGVPM VEMEKGADLM QALVDSELQP SRGQARKTIA SNAITINGEK QSDPEYFFKE EDRLFGRFTL LRRGKKNYCL ICWK (SEQ ID NO. 4).
Staphylococcus aureus (GI: 16975033): MTNVLIEDLK WRGLIYQQTD EQGIEDLLNK EQVTLYCGAD PTADSLHIGH LLPFLTLRRF QEHGHRPIVL IGGGTGMIGD PSGKSEERVL QTEEQVDKNI EGISKQMHNI FEFGTDHGAV LVNNRDWLGQ ISLISFLRDY GKHVGVNYML GKDSIQSRLE HGISYTEFTY TILQAIDFGH LNRELNCKIQ VGGSDQWGNI TSGIELMRRM YGQTDAYGLT IPLVTKSDGK KFGKSESGAV WLDAEKTSPY EFYQFWINQS DEDVIKFLKY FTFLGKEEID RLEQSKNEAP HLREAQKTLA EEVTKFIHGE DALNDAIRIS QALFSGDLKS LSAKELKDGF KDVPQVTLSN DTTNIVEVLI ETGISPSKRQ AREDVNNGAI YINGERQQDV NYALAPEDKI DGEFTIIRRG KKKYFMVNYQ
(SEQ ID NO. 5).
Definitions of specific functional groups and chemical terms are described in more detail below. The chemical elements are identified in accordance with the Periodic Table of the Elements, CAS version, Handbook of Chemistry and Physics, 75th Ed., inside cover, and specific functional groups are generally defined as described therein. Additionally, general principles of organic chemistry, as well as specific functional moieties and reactivity, are described in Organic Chemistry, Thomas Sorrell, University Science Books, Sausalito, 1999; Smith and March March's Advanced Organic
Chemistry, 5th Edition, John Wiley & Sons, Inc., New York, 2001; Larock,
Comprehensive Organic Transformations, VCH Publishers, Inc., New York, 1989; and
Carruthers, Some Modern Methods of Organic Synthesis, 3 rd Edition, Cambridge University Press, Cambridge, 1987.
Compounds described herein can comprise one or more asymmetric centers, and thus can exist in various stereoisomeric forms, e.g., enantiomers and/or diastereomers. For example, the compounds described herein can be in the form of an individual enantiomer, diastereomer or geometric isomer, or can be in the form of a mixture of stereoisomers, including racemic mixtures and mixtures enriched in one or more stereoisomer. Isomers can be isolated from mixtures by methods known to those skilled in the art, including chiral high pressure liquid chromatography (HPLC) and the formation and crystallization of chiral salts; or preferred isomers can be prepared by asymmetric syntheses. See, for example, Jacques et ah, Enantiomers, Racemates and Resolutions (Wiley Interscience, New York, 1981); Wilen et ah, Tetrahedron 33:2725 (1977); Eliel, E.L. Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and Wilen, S.H. Tables of Resolving Agents and Optical Resolutions p. 268 (E.L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, IN 1972). The invention additionally encompasses compounds as individual isomers substantially free of other isomers, and alternatively, as mixtures of various isomers.
When a range of values is listed, it is intended to encompass each value and subrange within the range. For example "C^ alkyl" is intended to encompass, C1; C2, C3,
C4, C5, C6, Ci_6, Ci_5, Cn, Ci_3, Ci_2, C2-6, C2_5, C-2-A, C2_3, C3_6, C3_5, C3^, C4_6, C4--5, and C5_6 alkyl.
As used herein, "alkyl" refers to a radical of a straight-chain or branched saturated hydrocarbon group having from 1 to 10 carbon atoms ("C^o alkyl"). In some embodiments, an alkyl group has 1 to 9 carbon atoms ("C^ alkyl"). In some embodiments, an alkyl group has 1 to 8 carbon atoms ("C^ alkyl"). In some embodiments, an alkyl group has 1 to 7 carbon atoms ("C^ alkyl"). In some embodiments, an alkyl group has 1 to 6 carbon atoms ("C^ alkyl"). In some embodiments, an alkyl group has 1 to 5 carbon atoms ("Q-s alkyl"). In some embodiments, an alkyl group has 1 to 4 carbon atoms ("C^ alkyl"). In some
embodiments, an alkyl group has 1 to 3 carbon atoms ("Ci_3 alkyl"). In some
embodiments, an alkyl group has 1 to 2 carbon atoms ("Ci_2 alkyl"). In some
embodiments, an alkyl group has 1 carbon atom ("Ci alkyl"). In some embodiments, an alkyl group has 2 to 6 carbon atoms ("C2-6 alkyl"). Examples of Ci_6 alkyl groups include methyl (CO, ethyl (C2), n-propyl (C3), isopropyl (C3), n-butyl (C4), tert-butyl (C4), sec-butyl (C4), iso-butyl (C4), n-pentyl (C5), 3-pentanyl (C5), amyl (C5), neopentyl (C5), 3-methyl-2-butanyl (C5), tertiary amyl (C5), and n-hexyl (C6). Additional examples of alkyl groups include n-heptyl (C7), n-octyl (Cg) and the like. Unless otherwise specified, each instance of an alkyl group is independently unsubstituted (an "unsubstituted alkyl") or substituted (a "substituted alkyl") with one or more
substituents. In certain embodiments, the alkyl group is an unsubstituted Ci-w alkyl (e.g., -CH ). In certain embodiments, the alkyl group is a substituted Cno alkyl.
"Perhaloalkyl" is a substituted alkyl group as defined herein wherein all of the hydrogen atoms are independently replaced by a halogen, e.g., fluoro, bromo, chloro, or iodo. In some embodiments, the alkyl moiety has 1 to 8 carbon atoms ("Ci_8
perhaloalkyl"). In some embodiments, the alkyl moiety has 1 to 6 carbon atoms ("Ci_6 perhaloalkyl"). In some embodiments, the alkyl moiety has 1 to 4 carbon atoms ("Ci^ perhaloalkyl"). In some embodiments, the alkyl moiety has 1 to 3 carbon atoms ("Ci_3 perhaloalkyl"). In some embodiments, the alkyl moiety has 1 to 2 carbon atoms ("Ci_2 perhaloalkyl"). In some embodiments, all of the hydrogen atoms are replaced with fluoro. In some embodiments, all of the hydrogen atoms are replaced with chloro.
Examples of perhaloalkyl groups include -CF3,
-CF2CF3, -CF2CF2CF3, -CC13, -CFC12, -CF2C1, and the like.
As used herein, "alkenyl" refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms ("C2-io alkenyl"). In some embodiments, an alkenyl group has 2 to 9 carbon atoms ("C2-9 alkenyl"). In some embodiments, an alkenyl group has 2 to 8 carbon atoms ("C2-8 alkenyl"). In some embodiments, an alkenyl group has 2 to 7 carbon atoms ("C2_7 alkenyl"). In some embodiments, an alkenyl group has 2 to 6 carbon atoms ("C2-6 alkenyl"). In some embodiments, an alkenyl group has 2 to 5 carbon atoms ("C2-5 alkenyl"). In some embodiments, an alkenyl group has 2 to 4 carbon atoms ("C2_4 alkenyl"). In some embodiments, an alkenyl group has 2 to 3 carbon atoms ("C2_3 alkenyl"). In some embodiments, an alkenyl group has 2 carbon atoms ("C2 alkenyl"). The one or more carbon-carbon double bonds can be internal (such as in 2-butenyl) or terminal (such as in 1-butenyl). Examples of C2- alkenyl groups include ethenyl (C2), 1-propenyl (C3), 2-propenyl (C3), 1-butenyl (C4), 2-butenyl (C4), butadienyl (C4), and the like. Examples of C2_6 alkenyl groups include the aforementioned C2_ alkenyl groups as well as pentenyl (C5), pentadienyl (C5), hexenyl (C6), and the like. Additional examples of alkenyl include heptenyl (C7), octenyl (Cg), octatrienyl (Cg), and the like. Unless otherwise specified, each instance of an alkenyl group is independently unsubstituted (an "unsubstituted alkenyl") or substituted (a "substituted alkenyl") with one or more substituents. In certain embodiments, the alkenyl group is an unsubstituted C2_10 alkenyl. In certain embodiments, the alkenyl group is a substituted C2_io alkenyl.
As used herein, "alkynyl" refers to a radical of a straight-chain or branched hydrocarbon group having from 2 to 10 carbon atoms ("C^o alkynyl"). In some embodiments, an alkynyl group has 2 to 9 carbon atoms ("C2_9 alkynyl"). In some embodiments, an alkynyl group has 2 to 8 carbon atoms ("C2_g alkynyl"). In some embodiments, an alkynyl group has 2 to 7 carbon atoms ("C2_7 alkynyl"). In some embodiments, an alkynyl group has 2 to 6 carbon atoms ("C2_6 alkynyl"). In some embodiments, an alkynyl group has 2 to 5 carbon atoms ("C2_5 alkynyl"). In some embodiments, an alkynyl group has 2 to 4 carbon atoms ("C2^ alkynyl"). In some embodiments, an alkynyl group has 2 to 3 carbon atoms ("C2_3 alkynyl"). In some embodiments, an alkynyl group has 2 carbon atoms ("C2 alkynyl"). The one or more carbon-carbon triple bonds can be internal (such as in 2-butynyl) or terminal (such as in 1-butynyl). Examples of C2_ alkynyl groups include, without limitation, ethynyl (C2), 1-propynyl (C3), 2-propynyl (C3), 1-butynyl (C4), 2-butynyl (C4), and the like.
Examples of C2_6 alkenyl groups include the aforementioned C2^ alkynyl groups as well as pentynyl (C5), hexynyl (C6), and the like. Additional examples of alkynyl include heptynyl (C7), octynyl (Cg), and the like. Unless otherwise specified, each instance of an alkynyl group is independently unsubstituted (an "unsubstituted alkynyl") or substituted (a "substituted alkynyl") with one or more substituents. In certain embodiments, the alkynyl group is an unsubstituted C2_10 alkynyl. In certain embodiments, the alkynyl group is a substituted C2_10 alkynyl.
As used herein, heteroalkyl, heteroalkenyl, and heteroalkynyl refers to an alkyl, alkenyl, and alkynyl moiety, as defined herein, wherein 1, 2, 3, or 4 carbons of the parent chain are replaced with oxygen, nitrogen, or sulfur atoms.
As used herein, "carbocyclyl" refers to a radical of a non-aromatic cyclic hydrocarbon group having from 3 to 10 ring carbon atoms ("C^o carbocyclyl") and zero heteroatoms in the non-aromatic ring system. In some embodiments, a carbocyclyl group has 3 to 8 ring carbon atoms ("C3_g carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms ("C3_6 carbocyclyl"). In some
embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms ("C3_6 carbocyclyl"). In some embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms ("Cs-io carbocyclyl"). Exemplary C3_6 carbocyclyl groups include, without limitation, cyclopropyl (C3), cyclopropenyl (C3), cyclobutyl (C4), cyclobutenyl (C4), cyclopentyl (C5), cyclopentenyl (C5), cyclohexyl (C6), cyclohexenyl (C6), cyclohexadienyl (C6), and the like. Exemplary C3_g carbocyclyl groups include, without limitation, the
aforementioned C3_6 carbocyclyl groups as well as cycloheptyl (C7), cycloheptenyl (C7), cycloheptadienyl (C7), cycloheptatrienyl (C7), cyclooctyl (Cg), cyclooctenyl (Cg), bicyclo[2.2.1]heptanyl (C7), bicyclo[2.2.2]octanyl (Cg), and the like. Exemplary C3_10 carbocyclyl groups include, without limitation, the aforementioned C3_g carbocyclyl groups as well as cyclononyl (Cg), cyclononenyl (Cg), cyclodecyl (C10), cyclodecenyl (Cio), octahydro-lH-indenyl (Cg), decahydronaphthalenyl (C10), spiro[4.5]decanyl (C10), and the like. As the foregoing examples illustrate, in certain embodiments, the carbocyclyl group is either monocyclic ("monocyclic carbocyclyl") or polycyclic (e.g., containing a fused, bridged or spiro ring system such as a bicyclic system ("bicyclic carbocyclyl") or tricyclic system ("tricyclic carbocyclyl")) and can be saturated or can contain one or more carbon-carbon double or triple bonds. "Carbocyclyl" also includes ring systems wherein the carbocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups wherein the point of attachment is on the carbocyclyl ring, and in such instances, the number of carbons continue to designate the number of carbons in the carbocyclic ring system. Unless otherwise specified, each instance of a carbocyclyl group is independently unsubstituted (an "unsubstituted carbocyclyl") or substituted (a "substituted carbocyclyl") with one or more substituents. In certain embodiments, the carbocyclyl group is an unsubstituted C3_10 carbocyclyl. In certain embodiments, the carbocyclyl group is a substituted C3_10 carbocyclyl.
In some embodiments, "carbocyclyl" is a monocyclic, saturated carbocyclyl group having from 3 to 10 ring carbon atoms ("Cs-io cycloalkyl"). In some
embodiments, a cycloalkyl group has 3 to 8 ring carbon atoms ("C3_8 cycloalkyl"). In some embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms ("C3_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 6 ring carbon atoms ("C5_6 cycloalkyl"). In some embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms ("Cs-io cycloalkyl"). Examples of C5_6 cycloalkyl groups include cyclopentyl (C5) and cyclohexyl (C5). Examples of C3_6 cycloalkyl groups include the aforementioned C5_6 cycloalkyl groups as well as cyclopropyl (C3) and cyclobutyl (C4). Examples of C3_8 cycloalkyl groups include the aforementioned C3_6 cycloalkyl groups as well as cycloheptyl (C7) and cyclooctyl (C8). Unless otherwise specified, each instance of a cycloalkyl group is independently unsubstituted (an "unsubstituted cycloalkyl") or substituted (a "substituted cycloalkyl") with one or more substituents. In certain embodiments, the cycloalkyl group is an unsubstituted C3_io cycloalkyl. In certain embodiments, the cycloalkyl group is a substituted C3_10 cycloalkyl.
As used herein, "heterocyclyl" refers to a radical of a 3- to 14-membered non- aromatic ring system having ring carbon atoms and 1 to 4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("3-14 membered heterocyclyl"). In heterocyclyl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. A heterocyclyl group can either be monocyclic ("monocyclic heterocyclyl") or polycyclic (e.g., a fused, bridged or spiro ring system such as a bicyclic system ("bicyclic heterocyclyl") or tricyclic system ("tricyclic heterocyclyl")), and can be saturated or can contain one or more carbon-carbon double or triple bonds. Heterocyclyl polycyclic ring systems can include one or more heteroatoms in one or both rings. "Heterocyclyl" also includes ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more carbocyclyl groups wherein the point of attachment is either on the carbocyclyl or heterocyclyl ring, or ring systems wherein the heterocyclyl ring, as defined above, is fused with one or more aryl or heteroaryl groups, wherein the point of attachment is on the heterocyclyl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heterocyclyl ring system. Unless otherwise specified, each instance of heterocyclyl is independently unsubstituted (an "unsubstituted heterocyclyl") or substituted (a "substituted heterocyclyl") with one or more substituents. In certain embodiments, the heterocyclyl group is an unsubstituted 3- 14 membered heterocyclyl. In certain embodiments, the heterocyclyl group is a substituted 3-14 membered heterocyclyl.
In some embodiments, a heterocyclyl group is a 5-10 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-8 membered non-aromatic ring system having ring carbon atoms and 1-4 ring
heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-6 membered non-aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered heterocyclyl"). In some embodiments, the 5-6 membered heterocyclyl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered
heterocyclyl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur.
Exemplary 3-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azirdinyl, oxiranyl, thiorenyl. Exemplary 4-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azetidinyl, oxetanyl and thietanyl. Exemplary 5-membered heterocyclyl groups containing 1 heteroatom include, without limitation, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl and pyrrolyl-2,5-dione. Exemplary 5- membered heterocyclyl groups containing 2 heteroatoms include, without limitation, dioxolanyl, oxathiolanyl and dithiolanyl. Exemplary 5-membered heterocyclyl groups containing 3 heteroatoms include, without limitation, triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary 6-membered heterocyclyl groups containing 1 heteroatom include, without limitation, piperidinyl, tetrahydropyranyl, dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, piperazinyl, morpholinyl, dithianyl, dioxanyl. Exemplary 6-membered heterocyclyl groups containing 2 heteroatoms include, without limitation, triazinanyl. Exemplary 7-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl groups containing 1 heteroatom include, without limitation, azocanyl, oxecanyl and thiocanyl. Exemplary bicyclic heterocyclyl groups include, without limitation, indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl, tetrahydrobenzothienyl, tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl, tetrahydroisoquinolinyl, decahydroquinolinyl, decahydroisoquinolinyl, octahydrochromenyl,
octahydroisochromenyl, decahydronaphthyridinyl, decahydro-1 ,8-naphthyridinyl, octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl, naphthalimidyl, chromanyl, chromenyl, lH-benzo[e] [l,4]diazepinyl, l,4,5,7-tetrahydropyrano[3,4-b]pyrrolyl, 5,6- dihydro-4H-furo[3,2-b]pyrrolyl, 6,7-dihydro-5H-furo[3,2-b]pyranyl, 5,7-dihydro- 4H-thieno[2,3-c]pyranyl, 2,3-dihydro-lH-pyrrolo[2,3-b]pyridinyl, 2,3- dihydrofuro[2,3-b]pyridinyl, 4,5,6,7-tetrahydro-lH-pyrrolo[2,3-b]pyridinyl, 4,5,6,7- tetrahydrofuro[3,2-c]pyridinyl, 4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl, 1 ,2,3,4- tetrahydro-l,6-naphthyridinyl, and the like.
As used herein, "aryl" refers to a radical of a monocyclic or polycyclic (e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 π electrons shared in a cyclic array) having 6-14 ring carbon atoms and zero heteroatoms provided in the aromatic ring system ("C6-i4 aryl"). In some embodiments, an aryl group has 6 ring carbon atoms ("C6 aryl"; e.g., phenyl). In some embodiments, an aryl group has 10 ring carbon atoms ("Cio aryl"; e.g., naphthyl such as 1-naphthyl and 2-naphthyl). In some embodiments, an aryl group has 14 ring carbon atoms ("C14 aryl"; e.g., anthracyl). "Aryl" also includes ring systems wherein the aryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the radical or point of attachment is on the aryl ring, and in such instances, the number of carbon atoms continue to designate the number of carbon atoms in the aryl ring system. Unless otherwise specified, each instance of an aryl group is independently unsubstituted (an "unsubstituted aryl") or substituted (a "substituted aryl") with one or more substituents. In certain embodiments, the aryl group is an unsubstituted C6-i4 aryl. In certain embodiments, the aryl group is a substituted C6-i4 aryl.
"Aralkyl" is a subset of "alkyl" and refers to an alkyl group, as defined herein, substituted by an aryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
As used herein, "heteroaryl" refers to a radical of a 5-14 membered monocyclic or polycyclic (e.g., bicyclic, tricyclic) 4n+2 aromatic ring system (e.g., having 6, 10, or 14 π electrons shared in a cyclic array) having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen and sulfur ("5-14 membered heteroaryl"). In heteroaryl groups that contain one or more nitrogen atoms, the point of attachment can be a carbon or nitrogen atom, as valency permits. Heteroaryl polycyclic ring systems can include one or more heteroatoms in one or both rings. "Heteroaryl" includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more carbocyclyl or heterocyclyl groups wherein the point of attachment is on the heteroaryl ring, and in such instances, the number of ring members continue to designate the number of ring members in the heteroaryl ring system. "Heteroaryl" also includes ring systems wherein the heteroaryl ring, as defined above, is fused with one or more aryl groups wherein the point of attachment is either on the aryl or heteroaryl ring, and in such instances, the number of ring members designates the number of ring members in the fused polycyclic (aryl/heteroaryl) ring system. Polycyclic heteroaryl groups wherein one ring does not contain a heteroatom (e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of attachment can be on either ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl) or the ring that does not contain a heteroatom (e.g., 5-indolyl).
In some embodiments, a heteroaryl group is a 5-10 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-10 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-8 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl"). In some embodiments, a heteroaryl group is a 5-6 membered aromatic ring system having ring carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring system, wherein each heteroatom is independently selected from nitrogen, oxygen, and sulfur ("5-6 membered
heteroaryl"). In some embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom selected from nitrogen, oxygen, and sulfur. Unless otherwise specified, each instance of a heteroaryl group is independently unsubstituted (an "unsubstituted heteroaryl") or substituted (a "substituted heteroaryl") with one or more substituents. In certain embodiments, the heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In certain embodiments, the heteroaryl group is a substituted 5-14 membered heteroaryl.
Exemplary 5-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyrrolyl, furanyl and thiophenyl. Exemplary 5-membered heteroaryl groups containing 2 heteroatoms include, without limitation, imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary 5-membered heteroaryl groups containing 3 heteroatoms include, without limitation, triazolyl, oxadiazolyl, and thiadiazolyl. Exemplary 5-membered heteroaryl groups containing 4 heteroatoms include, without limitation, tetrazolyl. Exemplary 6-membered heteroaryl groups containing 1 heteroatom include, without limitation, pyridinyl. Exemplary 6-membered heteroaryl groups containing 2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary 6-membered heteroaryl groups containing 3 or 4 heteroatoms include, without limitation, triazinyl and tetrazinyl, respectively. Exemplary 7-membered heteroaryl groups containing 1 heteroatom include, without limitation, azepinyl, oxepinyl, and thiepinyl. Exemplary 5,6-bicyclic heteroaryl groups include, without limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl, benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl, benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl, benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and purinyl. Exemplary 6,6-bicyclic heteroaryl groups include, without limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl. Exemplary tricyclic heteroaryl groups include, without limitation, phenanthridinyl, dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl and phenazinyl.
"Heteroaralkyl" is a subset of "alkyl" and refers to an alkyl group, as defined herein, substituted by a heteroaryl group, as defined herein, wherein the point of attachment is on the alkyl moiety.
As used herein, the term "partially unsaturated" refers to a ring moiety that includes at least one double or triple bond. The term "partially unsaturated" is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aromatic groups (e.g., aryl or heteroaryl moieties) as herein defined.
As used herein, the term "saturated" refers to a ring moiety that does not contain a double or triple bond, i.e. , the ring contains all single bonds.
Affixing the suffix "-ene" to a group indicates the group is a divalent moiety, e.g. , alkylene is the divalent moiety of alkyl, alkenylene is the divalent moiety of alkenyl, and alkynylene is the divalent moiety of alkynyl, each as defined herein.
Alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl groups, as defined herein, are optionally substituted (e.g., "substituted" or "unsubstituted" alkyl, "substituted" or "unsubstituted" alkenyl, "substituted" or "unsubstituted" alkynyl, "substituted" or "unsubstituted" heteroalkyl, "substituted" or "unsubstituted" heteroalkenyl, "substituted" or "unsubstituted" heteroalkynyl, "substituted" or "unsubstituted" carbocyclyl, "substituted" or
"unsubstituted" heterocyclyl, "substituted" or "unsubstituted" aryl or "substituted" or "unsubstituted" heteroaryl group). In general, the term "substituted", whether preceded by the term "optionally" or not, means that at least one hydrogen present on a group (e.g., a carbon or nitrogen atom) is replaced with a permissible substituent, e.g., a substituent which upon substitution results in a stable compound, e.g., a compound which does not spontaneously undergo transformation such as by rearrangement, cyclization, elimination, or other reaction. Unless otherwise indicated, a "substituted" group has a substituent at one or more substitutable positions of the group, and when more than one position in any given structure is substituted, the substituent is either the same or different at each position. The term "substituted" is contemplated to include substitution with all permissible substituents of organic compounds, any of the substituents described herein that results in the formation of a stable compound. The present invention contemplates any and all such combinations in order to arrive at a stable compound. For purposes of this invention, heteroatoms such as nitrogen may have hydrogen substituents and/or any suitable substituent as described herein which satisfy the valencies of the heteroatoms and results in the formation of a stable moiety.
Exemplary carbon atom substituents include, but are not limited to, halogen, - CN, -N02, -N3, -S02H, -S03H, -OH, -OR^, -ON(Rbb)2, -N(Rbb)2, -N(Rbb)3 +X , - N(ORcc)Rbb, -SH, -SR^, -SSRCC, -C(=0)Raa, -C02H, -CHO, -C(ORcc)2, -CChR^, - OC(=0)Raa, -OCOaR^, -C(=0)N(Rbb)2, -OC(=0)N(Rbb)2, -NRbbC(=0)Raa, - NR^COaR^, -NRbbC(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORaa, -OC(=NRbb)Raa, - OC(=NRbb)ORaa, -C(=NRbb)N(Rbb)2, -OC(=NRbb)N(Rbb)2, -NRbbC(=NRbb)N(Rbb)2, - C(=0)NRbbS02Raa, -NR^SOaR^, -S02N(Rbb)2, -S02Raa, -SOaOR^, -OS02Raa, -
S(=0)Raa, -OS(=0)Raa, -Si(Raa)3, -OSi(Raa)3 -C(=S)N(Rbb)2, -C(=0)SRaa, -C(=S)SRaa, -SC(=S)SRaa, -SC(=0)SRaa, -OC(=0)SRaa, -SC(=0)ORaa, -SC(=0)Raa, -P(=0)2Raa, - ΟΡ(=0)^, -P(=0)(Raa)2, -OP(=0)(Raa)2, -OP(=0)(ORcc)2, -P(=0)2N(Rbb)2, - OP(=0)2N(Rbb)2, -P(=0)(NRbb)2, -OP(=0)(NRbb)2, -NRbbP(=0)(ORcc)2, - NRbbP(=0)(NRbb)2, -P(RCC)2, -P(RCC)3, -OP(Rcc)2, -OP(Rcc)3, -B(Raa)2, -B(ORcc)2, - BR^OR^), Ci_io alkyl, Cuo perhaloalkyl, C2_10 alkenyl, C2_10 alkynyl, Ci_i0 heteroalkyl, C2_io heteroalkenyl, C^ioheteroalkynyl, C3_14 carbocyclyl, 3-14 membered heterocyclyl, C6-i4 aryl, and 5-14 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
or two geminal hydrogens on a carbon atom are replaced with the group =0, =S, =NN(Rbb)2, =NNRbbC(=0)Raa, =NNRbbC(=0)ORaa, =NNRbbS(=0)2Raa, =NRbb, or =NORcc;
each instance of R^ is, independently, selected from C^o alkyl, C^o perhaloalkyl, C2_io alkenyl, C2_io alkynyl, C^o heteroalkyl, C2_io heteroalkenyl, C2 ioheteroalkynyl, C3_10 carbocyclyl, 3-14 membered heterocyclyl, C6-i4 aryl, and 5-14 membered heteroaryl, or two groups are joined to form a 3-14 membered
heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
each instance of Rbb is, independently, selected from hydrogen, -OH, -OR3*, - N(RCC)2, -CN, -C(=0)Raa, -C(=0)N(Rcc)2, -C02Raa, -SO^, -C(=NRcc)ORaa, - C(=NRCC)N(RCC)2, -S02N(Rcc)2, -S02Rcc, -S02ORcc, -SORaa, -C(=S)N(RCC)2, - C(=0)SRcc, -C(=S)SRCC, -Ρ(=0)^, -P(=0)(Raa)2, -P(=0)2N(Rcc)2, -P(=0)(NRcc)2, Ci 10 alkyl, C^o perhaloalkyl, C2_10 alkenyl, C2_10 alkynyl, C^o heteroalkyl, C2_10 heteroalkenyl, C^ioheteroalkynyl, C3_io carbocyclyl, 3-14 membered heterocyclyl, C6-i4 aryl, and 5-14 membered heteroaryl, or two Rbb groups are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
each instance of Rcc is, independently, selected from hydrogen, Ci-io alkyl, Ci-io perhaloalkyl, C2_10 alkenyl, C2_10 alkynyl, C^o heteroalkyl, C2_10 heteroalkenyl, C2 10heteroalkynyl, C3_io carbocyclyl, 3-14 membered heterocyclyl, C6-i4 aryl, and 5-14 membered heteroaryl, or two Rcc groups are joined to form a 3-14 membered
heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rdd groups;
each instance of Rdd is, independently, selected from halogen, -CN, -N02, -N3, - S02H, -S03H, -OH, -ORee, -ON(Rff)2, -N(Rff)2, -N(Rff)3 +X , -N(ORee)Rff, -SH, -SRee, -SSRee, -C(=0)Ree, -C02H, -C02Ree, -OC(=0)Ree, -OC02Ree, -C(=0)N(Rff)2, - OC(=0)N(Rff)2, -NRffC(=0)Ree, -NRffC02Ree, -NRffC(=0)N(Rff)2, -C(=NRff)ORee, - OC(=NRff)Ree, -OC(=NRff)ORee, -C(=NRff)N(Rff)2, -OC(=NRff)N(Rff)2, - NRffC(=NRff)N(Rff)2,-NRffS02Ree, -S02N(Rff)2, -S02Ree, -S02ORee, -OS02Ree, - S(=0)Ree, -Si(Ree)3, -OSi(Ree)3, -C(=S)N(Rff)2, -C(=0)SRee, -C(=S)SRee, -SC(=S)SRee, -P(=0)2Ree, -P(=0)(Ree)2, -OP(=0)(Ree)2, -OP(=0)(ORee)2, d 6 alkyl, d 6
perhaloalkyl, C2_6 alkenyl, C2_6 alkynyl, C^ heteroalkyl, C2_6 heteroalkenyl, C2
6heteroalkynyl, C3_10 carbocyclyl, 3-10 membered heterocyclyl, C6-io aryl, 5-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups, or two geminal Rdd substituents can be joined to form =0 or =S;
each instance of Ree is, independently, selected from d_6 alkyl, d_6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, d_6 heteroalkyl, C2-6 heteroalkenyl, C2-6heteroalkynyl, -io carbocyclyl, C6-io aryl, 3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups;
ff
each instance of R is, independently, selected from hydrogen, d_6 alkyl, d_6 perhaloalkyl, C2-6 alkenyl, C2-6 alkynyl, d_6 heteroalkyl, C2-6 heteroalkenyl, C2
6heteroalkynyl, d-io carbocyclyl, 3-10 membered heterocyclyl, d-io aryl and 5-10 membered heteroaryl, or two R ff groups are joined to form a 3-14 membered
heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 Rgg groups; and
each instance of Rgg is, independently, halogen, -CN, -N02, -N3, -S02H, - S03H, -OH, -OCi-6 alkyl, -ON(Ci_6 alkyl)2, -N(Ci_6 alkyl)2, -N(Ci_6 alkyl)3 +X- - NH(Ci_6 alkyl)2 +X~, -NH2(d-6 alkyl) +X~ -NH X , -N(Od_6 alkyl)(Ci_6 alkyl), - N(OH)(Ci_6 alkyl), -NH(OH), -SH, -SCi_6 alkyl, -SS(Ci_6 alkyl), -C(=0)(Ci_6 alkyl), - C02H, -C02(d_6 alkyl), -OC(=0)(d 6 alkyl), -OC02(d 6 alkyl), -C(=0)NH2, - C(=0)N(Ci_6 alkyl)2, -OC(=0)NH(C^ alkyl), -NHC(=0)( Ci-e alkyl), -N(Ci_6 alkyl)C(=0)( Ci_6 alkyl), -NHC02(Ci_6 alkyl), -NHC(=0)N(Ci_6 alkyl)2, - NHC(=0)NH(Ci_6 alkyl), -NHC(=0)NH2, -C(=NH)0(Ci_6 alkyl),-OC(=NH)(Ci_6 alkyl), -OC(=NH)OCi_6 alkyl, -C(=NH)N(C^ alkyl)2, -C(=NH)NH(Ci_6 alkyl), - C(=NH)NH2, -OC(=NH)N(Ci_6 alkyl)2, -OC(NH)NH(Ci_6 alkyl), -OC(NH)NH2, - NHC(NH)N(Ci_6 alkyl)2, -NHC(=NH)NH2, -NHS02(Ci^ alkyl), -S02N(Ci_6 alkyl)2, - S02NH(Ci_6 alkyl), -S02NH2,-S02Ci^ alkyl, -S02OCi_6 alkyl, -OS02Ci_6 alkyl, - SOd_6 alkyl, -Si(d_6 alkyl)3, -OSi(C^ alkyl)3 -C(=S)N(d_6 alkyl)2, C(=S)NH(C^ alkyl), C(=S)NH2, -C(=0)S(Ci_6 alkyl), -C(=S)SCi_6 alkyl, -SC(=S)SCi_6 alkyl, - P(=0)2(C^ alkyl), -P(=0)(d_6 alkyl)2, -OP(=0)(C^ alkyl)2, -OP(=0)(Od 6 alkyl)2, Ci_6 alkyl, d_6 perhaloalkyl, C2_6 alkenyl, C2_6 alkynyl, d_6heteroalkyl, C2_6 heteroalkenyl, C2_6heteroalkynyl, d-io carbocyclyl, ds-io aryl, 3-10 membered heterocyclyl, 5-10 membered heteroaryl; or two geminal Rgg substituents can be joined to form =0 or =S; wherein X is a counterion.
As used herein, the term "halo" or "halogen" refers to fluorine (fluoro, -F), chlorine (chloro, -CI), bromine (bromo, -Br), or iodine (iodo, -I).
As used herein, a "counterion" is a negatively charged group associated with a positively charged quarternary amine in order to maintain electronic neutrality.
Exemplary counterions include halide ions (e.g., F , CT, Br , Γ), NO3 , C104 , OH~, H2P04 , HS04 , sulfonate ions (e.g., methansulfonate, trifluoromethanesulfonate, p- toluenesulfonate, benzenesulfonate, 10-camphor sulfonate, naphthalene-2-sulfonate, naphthalene-l-sulfonic acid-5-sulfonate, ethan-l-sulfonic acid-2-sulfonate, and the like), and carboxylate ions (e.g., acetate, ethanoate, propanoate, benzoate, glycerate, lactate, tartrate, glycolate, and the like).
Nitrogen atoms can be substituted or unsubstituted as valency permits, and include primary, secondary, tertiary, and quarternary nitrogen atoms. Exemplary nitrogen atom substitutents include, but are not limited to, hydrogen, -OH, -OR^, - N(RCC)2, -CN, -C(=0)Raa, -C(=0)N(Rcc)2, -C02Raa, -SOaR^, -C(=NRbb)Raa, - C(=NRcc)ORaa, -C(=NRCC)N(RCC)2, -S02N(Rcc)2, -S02Rcc, -S02ORcc, -SORaa, -
C(=S)N(RCC)2, -C(=0)SRcc, -C(=S)SRCC, -Ρ(=0)^, -P(=0)(Raa)2, -P(=0)2N(Rcc)2, - P(=0)(NRcc)2, Ci_io alkyl, Cn0 perhaloalkyl, C2_i0 alkenyl, C2_i0 alkynyl, Cn0 heteroalkyl, C2_io heteroalkenyl, C2_io heteroalkynyl, -io carbocyclyl, 3-14 membered heterocyclyl, C6-i4 aryl, and 5-14 membered heteroaryl, or two Rcc groups attached to an N atom are joined to form a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R groups, and wherein Raa, Rbb, Rcc and Rdd are as defined above.
In certain embodiments, the substituent present on the nitrogen atom is an nitrogen protecting group (also referred to herein as an "amino protecting group"). Nitrogen protecting groups include, but are not limited to, -OH, -OR^, -N(RCC)2, - C(=0)Raa, -C(=0)N(Rcc)2, -COaR^, -S02Raa, -C(=NRcc)Raa, -C(=NRcc)ORaa, - C(=NRCC)N(RCC)2, -S02N(Rcc)2, -S02Rcc, -S02ORcc, -SORaa, -C(=S)N(RCC)2, - C(=0)SRcc, -C(=S)SRCC, Ci_io alkyl {e.g., aralkyl, heteroaralkyl), C2_10 alkenyl, C2-10 alkynyl, Ci-w heteroalkyl, C2_10 heteroalkenyl, C2_10 heteroalkynyl, C3_io carbocyclyl, 3- 14 membered heterocyclyl, Ce_14 aryl, and 5-14 membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5 R groups, and wherein R^, Rbb, Rcc and Rdd are as defined herein. Nitrogen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
For example, nitrogen protecting groups such as amide groups (e.g., -C(=0)Raa) include, but are not limited to, formamide, acetamide, chloroacetamide,
trichloroacetamide, trifluoroacetamide, phenylacetamide, 3-phenylpropanamide, picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl derivative, benzamide, p- phenylbenzamide, o-nitophenylacetamide, o-nitrophenoxyacetamide, acetoacetamide, (N'-dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide, 3-(o- nitrophenyl)propanamide, 2-methyl-2-(o-nitrophenoxy)propanamide, 2-methyl-2-(o- phenylazophenoxy)propanamide, 4-chlorobutanamide, 3-methyl-3-nitrobutanamide, o- nitrocinnamide, N-acetylmethionine derivative, o-nitrobenzamide and o- (benzoyloxymethyl)benzamide.
Nitrogen protecting groups such as carbamate groups {e.g., -C(=0)ORaa) include, but are not limited to, methyl carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc), 9-(2-sulfo)fluorenylmethyl carbamate, 9-(2,7-dibromo)fluoroenylmethyl carbamate, 2,7-di-t-butyl-[9-( 10,10-dioxo-l 0, 10,10,10-tetrahydrothioxanthyl)]methyl carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc), 2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl carbamate (Teoc), 2-phenylethyl carbamate (hZ), l-(l-adamantyl)-l-methylethyl carbamate (Adpoc), l,l-dimethyl-2-haloethyl carbamate, l,l-dimethyl-2,2-dibromoethyl carbamate (DB-i-BOC), 1,1-dimethyl- 2,2,2-trichloroethyl carbamate (TCBOC), l-methyl-l-(4-biphenylyl)ethyl carbamate (Bpoc), l-(3,5-di-i-butylphenyl)-l-methylethyl carbamate (i-Bumeoc), 2-(2'- and 4'- pyridyl)ethyl carbamate (Pyoc), 2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t- butyl carbamate (BOC), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc), cinnamyl carbamate (Coc), 4- nitrocinnamyl carbamate (Noc), 8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz), p- nitobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl carbamate, 2,4- dichlorobenzyl carbamate, 4-methylsulfinylbenzyl carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl carbamate, 2-methylthioethyl carbamate, 2- methylsulfonylethyl carbamate, 2-(p-toluenesulfonyl)ethyl carbamate, [2-(l,3- dithianyl)] methyl carbamate (Dmoc), 4-methylthiophenyl carbamate (Mtpc), 2,4- dimethylthiophenyl carbamate (Bmpc), 2-phosphonioethyl carbamate (Peoc), 2- triphenylphosphonioisopropyl carbamate (Ppoc), l,l-dimethyl-2-cyanoethyl carbamate, m-chloro-p-acyloxybenzyl carbamate, /?-(dihydroxyboryl)benzyl carbamate, 5- benzisoxazolylmethyl carbamate, 2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc), m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate, o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate, phenyl(o-nitrophenyl)methyl carbamate, i-amyl carbamate, S-benzyl thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate, cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl carbamate, o-(N,N- dimethylcarboxamido)benzyl carbamate, l,l-dimethyl-3-(N,N- dimethylcarboxamido)propyl carbamate, 1, 1-dimethylpropynyl carbamate, di(2- pyridyl)methyl carbamate, 2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl carbamate, isobutyl carbamate, isonicotinyl carbamate, p-(p '-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl carbamate, 1-methylcyclohexyl carbamate, 1 -methyl- 1- cyclopropylmethyl carbamate, l-methyl-l-(3,5-dimethoxyphenyl)ethyl carbamate, 1- methyl-l-(p-phenylazophenyl)ethyl carbamate, 1 -methyl- 1-phenylethyl carbamate, 1- methyl-l-(4-pyridyl)ethyl carbamate, phenyl carbamate, /?-(phenylazo)benzyl carbamate, 2,4,6-tri-i-butylphenyl carbamate, 4-(trimethylammonium)benzyl carbamate, and 2,4,6-trimethylbenzyl carbamate.
Nitrogen protecting groups such as sulfonamide groups (e.g., -S(=0)2Raa) include, but are not limited to, p-toluenesulfonamide (Ts), benzenesulfonamide, 2,3,6,- trimethyl-4-methoxybenzenesulfonamide (Mtr), 2,4,6-trimethoxybenzenesulfonamide (Mtb), 2,6-dimethyl-4-methoxybenzenesulfonamide (Pme), 2,3,5, 6-tetramethyl-4- methoxybenzenesulfonamide (Mte), 4-methoxybenzenesulfonamide (Mbs), 2,4,6- trimethylbenzenesulfonamide (Mts) , 2,6-dimethoxy-4-methylbenzenesulf onamide (iMds), 2,2,5,7, 8-pentamethylchroman-6-sulfonamide (Pmc), methanesulfonamide (Ms), β-trimethylsilylethanesulfonamide (SES), 9-anthracenesulfonamide, 4-(4',8'- dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS), benzylsulfonamide, trifluoromethylsulfonamide, and phenacylsulfonamide.
Other nitrogen protecting groups include, but are not limited to, phenothiazinyl- (lO)-acyl derivative, N'-p-toluenesulfonylaminoacyl derivative, N'- phenylaminothioacyl derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide, N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide, N-2,5-dimethylpyrrole, N-l, 1,4,4- tetramethyldisilylazacyclopentane adduct (STABASE), 5-substituted 1,3-dimethyl- 1 ,3,5-triazacyclohexan-2-one, 5-substituted 1 ,3-dibenzyl-l ,3,5-triazacyclohexan-2- one, 1-substituted 3,5-dinitro-4-pyridone, N-methylamine, N-allylamine, N-[2- (trimethylsilyl)ethoxy]methylamine (SEM), N-3-acetoxypropylamine, N-(l-isopropyl- 4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary ammonium salts, N-benzylamine, N-di(4-methoxyphenyl)methylamine, N-5-dibenzosuberylamine, N- triphenylmethylamine (Tr), N-[(4-methoxyphenyl)diphenylmethyl] amine (MMTr), N- 9-phenylfluorenylamine (PhF), N-2,7-dichloro-9-fluorenylmethyleneamine, N- ferrocenylmethylamino (Fcm), N-2-picolylamino N'-oxide, N-1,1- dimethylthiomethyleneamine, N-benzylideneamine, N-p-methoxybenzylideneamine, N- diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine, N-(N',N'- dimethylaminomethylene)amine, N,N'-isopropylidenediamine, N-p- nitrobenzylideneamine, N-salicylideneamine, N-5-chlorosalicylideneamine, N-(5- chloro-2-hydroxyphenyl)phenylmethyleneamine, N-cyclohexylideneamine, N-(5,5- dimethyl-3-oxo-l-cyclohexenyl)amine, N-borane derivative, N-diphenylborinic acid derivative, N-[phenyl(pentaacylchromium- or tungsten) acyl] amine, N-copper chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine N-oxide, diphenylphosphinamide (Dpp), dimethylthiophosphinamide (Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates, dibenzyl phosphoramidate, diphenyl phosphoramidate,
benzenesulfenamide, o-nitrobenzenesulfenamide (Nps), 2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide, 2-nitro-4-methoxybenzenesulfenamide,
triphenylmethylsulfenamide, and 3-nitropyridinesulfenamide (Npys).
In certain embodiments, the substituent present on an oxygen atom is an oxygen protecting group (also referred to herein as an "hydroxyl protecting group"). Oxygen protecting groups include, but are not limited to, -Raa, -N(Rbb)2, -C(=0)SRaa, - C(=0)Raa, -COaR^, -C(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORaa, - C(=NRbb)N(Rbb)2, -S(=0)Raa, -SOaR^, -Si(Raa)3, -P(RCC)2, -P(RCC)3, -Ρ(=0)^, - P(=0)(Raa)2, -P(=0)(ORcc)2, -P(=0)2N(Rbb)2, and -P(=0)(NRbb)2, wherein R^, Rbb, and Rcc are as defined herein. Oxygen protecting groups are well known in the art and include those described in detail in Protecting Groups in Organic Synthesis, T. W.
Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
Exemplary oxygen protecting groups include, but are not limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM), i-butylthiomethyl,
(phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM), p- methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM),
guaiacolmethyl (GUM), i-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl, 2- methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl, bis(2- chloroethoxy)methyl, 2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP), 3-bromotetrahydropyranyl, tetrahydrothiopyranyl, 1-methoxycyclohexyl, 4- methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl, 4- methoxytetrahydrothiopyranyl S,S-dioxide, l-[(2-chloro-4-methyl)phenyl]-4- methoxypiperidin-4-yl (CTMP), l,4-dioxan-2-yl, tetrahydrofuranyl,
tetrahydrothiofuranyl, 2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7- methanobenzofuran-2-yl, 1-ethoxyethyl, l-(2-chloroethoxy)ethyl, 1-methyl-l- methoxyethyl, 1-methyl-l-benzyloxyethyl, l-methyl-l-benzyloxy-2-fluoroethyl, 2,2,2-trichloroethyl, 2-trimethylsilylethyl, 2-(phenylselenyl)ethyl, i-butyl, allyl, p- chlorophenyl, p-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), /?-methoxybenzyl, 3,4- dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl, 2,6-dichlorobenzyl, p- cyanobenzyl, p-phenylbenzyl, 2-picolyl, 4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl, p,p '-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl, a- naphthyldiphenylmethyl, /7-methoxyphenyldiphenylmethyl, di(p- methoxyphenyl)phenylmethyl, tri(p-methoxyphenyl)methyl, 4-(4'- bromophenacyloxyphenyl)diphenylmethyl, 4,4',4"-tris(4,5- dichlorophthalimidophenyl)methyl, 4,4',4"-tris(levulinoyloxyphenyl)methyl, 4,4',4"- tris(benzoyloxyphenyl)methyl, 3-(imidazol-l-yl)bis(4',4"-dimethoxyphenyl)methyl, l,l-bis(4-methoxyphenyl)-r-pyrenylmethyl, 9-anthryl, 9-(9-phenyl)xanthenyl, 9-(9- phenyl-10-oxo)anthryl, l,3-benzodithiolan-2-yl, benzisothiazolyl S,S-dioxido, trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl (TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl (DEIPS), dimethylthexylsilyl, i-butyldimethylsilyl (TBDMS), i-butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl, triphenylsilyl, diphenylmethylsilyl (DPMS), i-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate, acetate, chloroacetate, dichloroacetate, trichloroacetate, trifhioroacetate, methoxyacetate, triphenylmethoxyacetate, phenoxyacetate, p-chlorophenoxyacetate, 3- phenylpropionate, 4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate
(levulinoyldithioacetal), pivaloate, adamantoate, crotonate, 4-methoxycrotonate, benzoate, /?-phenylbenzoate, 2,4,6-trimethylbenzoate (mesitoate), alkyl methyl carbonate, 9-fluorenylmethyl carbonate (Fmoc), alkyl ethyl carbonate, alkyl 2,2,2- trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl carbonate (TMSEC), 2- (phenylsulfonyl) ethyl carbonate (Psec), 2-(triphenylphosphonio) ethyl carbonate (Peoc), alkyl isobutyl carbonate, alkyl vinyl carbonate alkyl allyl carbonate, alkyl p-nitrophenyl carbonate, alkyl benzyl carbonate, alkyl p-methoxybenzyl carbonate, alkyl 3,4- dimethoxybenzyl carbonate, alkyl o-nitrobenzyl carbonate, alkyl p-nitrobenzyl carbonate, alkyl S-benzyl thiocarbonate, 4-ethoxy-l-napththyl carbonate, methyl dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate, 4-nitro-4-methylpentanoate, o- (dibromomethyl)benzoate, 2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl, 4- (methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate, 2,6-dichloro-4- methylphenoxyacetate, 2,6-dichloro-4-(l, l,3,3-tetramethylbutyl)phenoxyacetate, 2,4- bis( 1 , l-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate, isobutyrate,
monosuccinoate, (E)-2-methyl-2-butenoate, o-(methoxyacyl)benzoate, a-naphthoate, nitrate, alkyl N,N,N',N'-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate, borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate, sulfate,
methanesulfonate (mesylate), benzylsulfonate, and tosylate (Ts).
In certain embodiments, the substituent present on an sulfur atom is a sulfur protecting group (also referred to as a "thiol protecting group"). Sulfur protecting groups include, but are not limited to, -Raa, -N(Rbb)2, -C(=0)SRaa, -C(=0)Raa, -CO^, - C(=0)N(Rbb)2, -C(=NRbb)Raa, -C(=NRbb)ORaa, -C(=NRbb)N(Rbb)2, -S(=0)Raa, -SOaR^, -Si(Raa)3 -P(RCC)2, -P(RCC)3, -Ρ(=0)^, -P(=0)(Raa)2, -P(=0)(ORcc)2, -P(=0)2N(Rbb)2, and -P(=0)(NRbb)2, wherein R^, Rbb, and Rcc are as defined herein. Sulfur protecting groups are well known in the art and include those described in detail in Protecting
Groups in Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3 rd edition, John Wiley & Sons, 1999, incorporated herein by reference.
These and other exemplary substituents are described in more detail in the Detailed Description, Examples, and claims. The invention is not intended to be limited in any manner by the above exemplary listing of substituents.
As used herein, the term "salt" refers to any and all salts.
The term "pharmaceutically acceptable salt" refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio. Pharmaceutically acceptable salts are well known in the art. For example, Berge et al. , describes pharmaceutically acceptable salts in detail in /. Pharmaceutical Sciences (1977) 66: 1- 19. Pharmaceutically acceptable salts of the compounds of this invention include those derived from suitable inorganic and organic acids and bases. Examples of
pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange. Other pharmaceutically acceptable salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2- hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, p-toluenesulfonate, undecanoate, valerate salts, and the like. Pharmaceutically acceptable salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N+(Ci_ 4alkyl)4 salts. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like. Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate, and aryl sulfonate.
As used herein, the term "prodrug" means a compound that can react under biological conditions (e.g., in vitro or in vivo enzymatic conditions) to provide a pharmacologically active compound. In certain cases, a prodrug has improved physical and/or delivery properties over the parent compound. Prodrugs are typically designed to enhance pharmacologically, pharmaceutically and/or pharmacokinetically based properties associated with the parent compound. The advantage of a prodrug can lie in its physical properties, such as enhanced water solubility compared to the parent compound, enhanced transport across a cell membrane, and/or enhanced drug stability for long-term storage.
Having thus described several aspects of at least one embodiment of this invention, it is to be appreciated various alterations, modifications, and improvements will readily occur to those skilled in the art. Such alterations, modifications, and improvements are intended to be part of this disclosure, and are intended to be within the spirit and scope of the invention. Accordingly, the foregoing description and drawings are by way of example only.
What is claimed is:

Claims

1. A method for treating protozoan disease, comprising: administering to a subject having a protozoan disease an inhibitor of protozoan tyrosyl-tRNA synthetase in an effective amount to treat the protozoan disease, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase does not inhibit mammalian tyrosyl- tRNA synthetase.
2. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase specifically binds to an adenylate binding pocket of protozoan tyrosyl-tRNA synthetase.
3. The method of claim 2, wherein the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, K84, C85 and F127 of SEQ ID NO. 1.
4. The method of claim 2, wherein the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, and F127 of SEQ ID
NO. 1.
5. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is also an inhibitor of bacterial tyrosyl-tRNA synthetase.
6. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is not an inhibitor of bacterial tyrosyl-tRNA synthetase.
7. The method of claim 1, wherein the protozoan disease is selected from the group consisting of malaria, toxoplasma, , leishmaniasis, giardiasis, trypanosomiasis (sleeping sickness, Chagas disease), amoebic dysentery, and trichomoniasis.
8. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is a compound of Formula (I)
Figure imgf000060_0001
Formula (I) or a salt thereof;
wherein:
each instance of R1; R2, R3, and R4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl.
9. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 219383.
10. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 239629.
11. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 243545.
12. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 284485.
13. A composition, comprising: an inhibitor of protozoan tyrosyl-tRNA synthetase, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase does not inhibit mammalian or bacterial tyrosyl- tRNA synthetase.
14. A method of selecting or designing a compound that interacts with a protozoan tyrosyl-tRNA synthetase and modulates protozoan tyrosyl-tRNA synthetase activity, the method comprising the step of assessing the stereochemical
complementarity between the compound and a topographic region of protozoan tyrosyl- tRNA synthetase, wherein the topographic region of the protozoan tyrosyl-tRNA synthetase is characterized by at least a portion of the amino acids positioned at an adenylate binding pocket of the protozoan tyrosyl-tRNA synthetase.
15. The method of claim 14, wherein the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, K84, C85 and F127 of SEQ ID NO. 1.
16. The method of claim 14, wherein the adenylate binding pocket is a region of the protozoan tyrosyl-tRNA synthetase corresponding to F70, Q80, and F127 of SEQ ID NO. 1.
17. A composition comprising inhibitor of protozoan tyrosyl-tRNA synthetase and an anti-protozoan agent.
18. The method of claim 1, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is a compound of Formula (I)
Figure imgf000062_0001
Formula (I) or a salt thereof;
wherein:
each instance of R1; R2, R3, and R4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl.
19. The method of claim 17, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 219383.
20. The method of claim 17, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 239629.
21. The method of claim 17, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 243545.
22. The method of claim 17, wherein the inhibitor of protozoan tyrosyl-tRNA synthetase is SB 284485.
23. A compound of the formula (I) or (II):
Figure imgf000063_0001
Formula (I)
Figure imgf000064_0001
Formula (II) or a salt thereof;
wherein:
each instance of R1 ; R2, R3, and R4 is, independently, hydrogen, hydroxyl, substituted or unsubstituted OR', substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl, substituted or unsubstituted carbocyclyl, substituted or unsubstituted heterocyclyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl;
R' is substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl;
wherein each instance of R5, R6, R7j Rg and R9 is, independently, hydrogen, halogen, substituted or unsubstituted alkyl, substituted or unsubstituted alkenyl, substituted or unsubstituted alkynyl; and
provided that the compound of Formula (I) is not a compound wherein Ri is a butyl ester or OH and R2, R3, and R^ are all OH,
provided that the compound of Formula (II) is not a compound wherein Ri is a butyl ester or OH, and R2, R3, R4, R5, and R7 are all OH, R9 are all H and one OH, and R6 and R8 are both H.
24. The compound of claim 23, wherein the 3' and 4' hydroxyl groups on the ring are modified such that the compound has a strong reaction with an amino acid in the adenylate binding pocket corresponding to Cys residue at position 85 of SEQ ID NO.l.
PCT/US2013/050310 2012-07-13 2013-07-12 Methods and products related to protozoan disease Ceased WO2014012014A1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US14/414,557 US20150166562A1 (en) 2012-07-13 2013-07-12 Methods and products related to protozoan disease

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261671596P 2012-07-13 2012-07-13
US61/671,596 2012-07-13

Publications (1)

Publication Number Publication Date
WO2014012014A1 true WO2014012014A1 (en) 2014-01-16

Family

ID=49916574

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/050310 Ceased WO2014012014A1 (en) 2012-07-13 2013-07-12 Methods and products related to protozoan disease

Country Status (2)

Country Link
US (1) US20150166562A1 (en)
WO (1) WO2014012014A1 (en)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104231024A (en) * 2014-10-11 2014-12-24 吉首大学 Oxadiazole and inosine type compound served as TyrRS inhibitor and preparation method and purpose thereof
CN104262433A (en) * 2014-10-11 2015-01-07 吉首大学 Oxadiazole-adenosine compounds serving as TyrRS inhibitors as well as preparation methods and applications thereof
CN104327140A (en) * 2014-10-11 2015-02-04 吉首大学 Oxazolidone-adenosine type multi-target antibacterial compounds and preparation method and application thereof
CN104341475A (en) * 2014-10-11 2015-02-11 吉首大学 Linezolid-adenosine type multi-target-point antibacterial compound as well as preparation method and application thereof
CN104341476A (en) * 2014-10-11 2015-02-11 吉首大学 Linezolid-inosine type multi-target antibacterial compounds as well as preparation method and application thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014184797A2 (en) * 2013-05-15 2014-11-20 National Institute Of Immunology Hemoglobin receptor as novel vaccine for leishmaniasis

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010096170A2 (en) * 2009-02-19 2010-08-26 President And Fellows Of Harvard College Inhibition of trna synthetases and therapeutic applications thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2010096170A2 (en) * 2009-02-19 2010-08-26 President And Fellows Of Harvard College Inhibition of trna synthetases and therapeutic applications thereof

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
BERGE J.M. ET AL.: "Synthesis and Activity of Analogues of SB-219383: Novel Potent Inhibitors of Bacterial Tyrosyl tRNA Synthetase", THE JOURNAL OF ANTIBIOTICS, vol. 53, no. 11, November 2000 (2000-11-01), pages 1282 - 1292 *
BHATT T.K. ET AL.: "Malaria parasite tyrosyl-tRNA synthetase secretion triggers pro- inflammatory responses", NATURE COMMUNICATIONS, vol. 2, no. 530, 8 November 2011 (2011-11-08), Retrieved from the Internet <URL:http://www.nature.com/ncomms/joumal/v2/nl l/full/ncommsl522.html> [retrieved on 20130816] *
GREENWOOD R.C. ET AL.: "Confirmation of the Antibacterial Mode of Action of SB- 219383, a Novel Tyrosyl tRNA Synthetase Inhibitor from a Micromonospora sp.", THE JOURNAL OF ANTIBIOTICS, vol. 55, no. 4, April 2002 (2002-04-01), pages 423 - 426 *
JARVEST, R.L. ET AL.: "Inhibitors of Bacterial Tyrosyl tRNA Synthetase: Synthesis of Carbocyclic Analogues of the Natural Product SB-219383", BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 11, 2001, pages 2499 - 2502 *
LARSON ET AL.: "The double-length tyrosyl-tRNA synthetase from the eukaryote Leishmania major forms an intrinsically asymmetric pseudo-dimer", JOURNAL OF MOLECULAR BIOLOGY, vol. 409, no. 2, 3 June 2011 (2011-06-03), Retrieved from the Internet <URL:http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3095712/pdf/nihms283788.pdf> [retrieved on 20130818] *
QIU X. ET AL.: "Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors", PROTEIN SCIENCE, vol. 10, 2001, pages 2008 - 2016 *
STEFANSKA A.L. ET AL.: "SB-219383, a Novel Tyrosyl tRNA Synthetase Inhibitor from a Micromonospora sp. I. Fermentation, Isolation and Properties", THE JOURNAL OF ANTIBIOTICS, vol. 53, no. 4, April 2000 (2000-04-01), pages 345 - 350 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN104231024A (en) * 2014-10-11 2014-12-24 吉首大学 Oxadiazole and inosine type compound served as TyrRS inhibitor and preparation method and purpose thereof
CN104262433A (en) * 2014-10-11 2015-01-07 吉首大学 Oxadiazole-adenosine compounds serving as TyrRS inhibitors as well as preparation methods and applications thereof
CN104327140A (en) * 2014-10-11 2015-02-04 吉首大学 Oxazolidone-adenosine type multi-target antibacterial compounds and preparation method and application thereof
CN104341475A (en) * 2014-10-11 2015-02-11 吉首大学 Linezolid-adenosine type multi-target-point antibacterial compound as well as preparation method and application thereof
CN104341476A (en) * 2014-10-11 2015-02-11 吉首大学 Linezolid-inosine type multi-target antibacterial compounds as well as preparation method and application thereof
CN104327140B (en) * 2014-10-11 2016-06-15 吉首大学 Oxazolidone-adenosine type Mutiple Targets antimicrobial compound and method for making thereof and purposes

Also Published As

Publication number Publication date
US20150166562A1 (en) 2015-06-18

Similar Documents

Publication Publication Date Title
US20150166562A1 (en) Methods and products related to protozoan disease
JP2019514884A (en) EZH2 inhibitors and their use
US10526341B2 (en) Thienopyrimidines and uses thereof
EP2791210A1 (en) Alpha-aminoamidine polymers and uses thereof
US20190389904A2 (en) Malt1 inhibitors and uses thereof
US20250325659A1 (en) Use of toll-like receptor 2 (tlr-2) agonist for modulating human immune response
US8648198B2 (en) Phenylethanolamine-based NMDA receptor antagonists
US12274679B2 (en) Substituted alkylphenols as HCN1 antagonists
WO2019067587A1 (en) Use of metformin and analogs thereof to reduce ran protein levels in the treatment of neurological disorders
US10106555B2 (en) Max binders as MYC modulators and uses thereof
US20210106687A1 (en) Bolaamphiphilic compounds, compositions and uses thereof
WO2013152277A2 (en) Moenomycin analogs, methods of synthesis, and uses thereof
WO2013016193A2 (en) Activators of class i histone deacetlyases (hdacs) and uses thereof
US12246021B2 (en) Compounds for uses in pharmacological induction of HBF for treatment of sickle cell disease and ß-thalassemia
US12611456B2 (en) Use of thiazole amide compounds for modulating human immune response
EP3416958B1 (en) Thiosemicarbazides as antifungal compounds and their uses
AU2020205665A1 (en) DOT1L degraders and uses thereof
WO2025090920A1 (en) Compositions and methods for treating dysfunction of glucose metabolism and/or regulation
WO2025075976A2 (en) Methyl-branched liposomes for sustained drug delivery
WO2026107134A1 (en) Use of small molecule glutaminase inhibitors for treating age-related disorders
WO2018227012A1 (en) Polymer-lipid materials for delivery of nucleic acids

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13816176

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 14414557

Country of ref document: US

122 Ep: pct application non-entry in european phase

Ref document number: 13816176

Country of ref document: EP

Kind code of ref document: A1