WO2013192521A1 - β-LACTAMASE TARGETED PHOTOSENSITIZER FOR PESTICIDE AND PEST DETECTION - Google Patents

β-LACTAMASE TARGETED PHOTOSENSITIZER FOR PESTICIDE AND PEST DETECTION Download PDF

Info

Publication number
WO2013192521A1
WO2013192521A1 PCT/US2013/047045 US2013047045W WO2013192521A1 WO 2013192521 A1 WO2013192521 A1 WO 2013192521A1 US 2013047045 W US2013047045 W US 2013047045W WO 2013192521 A1 WO2013192521 A1 WO 2013192521A1
Authority
WO
WIPO (PCT)
Prior art keywords
pest
composition
photosensitizer
lactamase
spp
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2013/047045
Other languages
French (fr)
Inventor
Tayyaba Hasan
Ulysses W. Sallum
Barton Slatko
Jeremy Foster
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
General Hospital Corp
New England Biolabs Inc
Original Assignee
General Hospital Corp
New England Biolabs Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by General Hospital Corp, New England Biolabs Inc filed Critical General Hospital Corp
Priority to US14/410,389 priority Critical patent/US20160073634A1/en
Publication of WO2013192521A1 publication Critical patent/WO2013192521A1/en
Anticipated expiration legal-status Critical
Priority to US16/013,333 priority patent/US10874107B2/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N43/00Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds
    • A01N43/90Biocides, pest repellants or attractants, or plant growth regulators containing heterocyclic compounds having two or more relevant hetero rings, condensed among themselves or with a common carbocyclic ring system
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01NPRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N25/00Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of application, e.g. seed treatment or sequential application; Substances for reducing the noxious effect of the active ingredients to organisms other than pests
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D501/00Heterocyclic compounds containing 5-thia-1-azabicyclo [4.2.0] octane ring systems, i.e. compounds containing a ring system of the formula:, e.g. cephalosporins; Such ring systems being further condensed, e.g. 2,3-condensed with an oxygen-, nitrogen- or sulfur-containing hetero ring
    • C07D501/14Compounds having a nitrogen atom directly attached in position 7
    • C07D501/16Compounds having a nitrogen atom directly attached in position 7 with a double bond between positions 2 and 3
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N21/00Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
    • G01N21/62Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light
    • G01N21/63Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light optically excited
    • G01N21/64Fluorescence; Phosphorescence
    • G01N21/6428Measuring fluorescence of fluorescent products of reactions or of fluorochrome labelled reactive substances, e.g. measuring quenching effects, using measuring "optrodes"
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N21/00Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
    • G01N21/62Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light
    • G01N21/63Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light optically excited
    • G01N21/64Fluorescence; Phosphorescence
    • G01N21/6428Measuring fluorescence of fluorescent products of reactions or of fluorochrome labelled reactive substances, e.g. measuring quenching effects, using measuring "optrodes"
    • G01N2021/6432Quenching
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N21/00Investigating or analysing materials by the use of optical means, i.e. using sub-millimetre waves, infrared, visible or ultraviolet light
    • G01N21/62Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light
    • G01N21/63Systems in which the material investigated is excited whereby it emits light or causes a change in wavelength of the incident light optically excited
    • G01N21/64Fluorescence; Phosphorescence
    • G01N21/6428Measuring fluorescence of fluorescent products of reactions or of fluorochrome labelled reactive substances, e.g. measuring quenching effects, using measuring "optrodes"
    • G01N2021/6439Measuring fluorescence of fluorescent products of reactions or of fluorochrome labelled reactive substances, e.g. measuring quenching effects, using measuring "optrodes" with indicators, stains, dyes, tags, labels, marks

Definitions

  • Human filariasis is a major global health problem.
  • the diseases are caused by infections with parasitic filarial nematode worms leading_two related disorders.
  • the nematode species responsible for_human lymphatic filariasis (LF) are
  • Onchocerciasis is cutaneous, wherein adult worms reside in palpable fibrous nodules, which are a result of inflammation to dead microfilaria (the Fl generation released by adult females after mating).
  • One other aspect of the malady is blindness caused by microfilaria migration and invasion of the cornea, keratitis, retinal lesions and degeneration of the optic nerve.
  • Lymphatic filariasis is a disease associated with dysfunction of lymphatic tissue and lymphodema, leading to a disease state known as elephantiasis, including hydrocoele.
  • Control programs rely on sustained delivery of antiparasitic drugs, such as DEC (diethylcarbamazine), albendazole, and ivermectin, which have been the mainline drugs of choice for filariasis control.
  • DEC diethylcarbamazine
  • albendazole albendazole
  • ivermectin ivermectin
  • these drugs are not effective adulticides and repeated community- wide doses (as part of MDA, mass drug administration) are required to suppress microfilarial production and reduce transmission.
  • Over time insects have become both more numerous and more destructive to plants, both agriculturally and domestically. A host of small insects attack grasses and forage crops, many of them being so small that they are unnoticed though their aggregate injury is enormous.
  • Photosensitizers are light-sensitive compounds which undergo a photochemical reaction after the absorption of light quantum. Such photodynamic compounds have been successfully used for antibacterial photodynamic therapies acting throughout the body.
  • a strength of such photodynamic therapy is the broad range of targets hit by the reactive molecular species it produces. Targeting the photoreactivity of PSs through catalysis by parasite-specific enzymes maintains this advantage. Still, the current state of PDT has focused on the targeting of parasite-specific enzymes within the human body.
  • photodynamic compounds having improved specificity for athropod, nematode, insect and parasite- specific enzymes capable of targeting and killing an insect (or other unwanted organism that produces an enzyme capable of hydrolyzing the construct) such as mosquitoes, biting flies, fruit flies, sand flies, barnacles, Crustacea, and cockroaches, outside of the human body, would be desirable.
  • the invention provides, inter alia, novel methods to control and/or kill arthropods, nematodes, insects and parasites in plant and animal (e.g., human) hosts via the targeted release of free photosensitizer from a quenched to an unquenched and active state by ⁇ -lactamases that are produced by the insect.
  • the invention is based, at least in part, on the discovery that when a pest, e.g., an insect, ingests an enzyme-cleavable ⁇ -lactamase specific construct, the construct is cleaved by ⁇ - lactamases that are produced by the insect, resulting in the release of free photosensitizer within the insect. When the insect is then exposed to light, the free photosensitizer is converted to a phototoxic species that kills the insect.
  • the insect also fluoresces as a result of the cleavage allowing for insect detection via fluorescence emission.
  • the invention provides a pesticidal composition
  • a pesticidal composition comprising a pesticidally effective amount of one or more photosensitizers that are linked by one or more moieties cleavable by ⁇ -lactamase, wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light-activation.
  • the invention provides a pesticidal composition
  • a pesticidal composition comprising pesticidally effective amount of one or more photosensitizers and one or more binders effective to quench photoactivation, wherein the photosensitizers are connected to the binder through one or more moieties cleavable by a ⁇ -lactamase expressed by a pest and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light-activation.
  • the binder is a fluorophore.
  • the invention provides a pesticidal composition
  • a pesticidal composition comprising a backbone coupled to one or more photosensitizers and one or more binders effective to quench photoactivation, wherein the binders are connected to the backbone through one or more moieties cleavable by a ⁇ -lactamase expressed by a pest and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light- activation.
  • the invention provides a pesticidal composition
  • a pesticidal composition comprising a backbone coupled to a plurality of photosensitizers and one or more binders effective to quench photoactivation, wherein the photosensitizers are connected to the backbone through one or more moieties cleavable by ⁇ -lactamase.
  • the pest is an animal that expresses ⁇ - lactamase.
  • the pest is an animal that expresses a ⁇ - lactamase comrpising the protein domain sequence:
  • the pest expresses a ⁇ -lactamase comprising a protein domain sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO:l or a fragment thereof.
  • the pest is an animal that expresses a ⁇ -lactamase comrpising the protein domain sequence:
  • the pest expresses a ⁇ -lactamase comprising a protein domain sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO:2 or a fragment thereof.
  • the host is an animal, e.g., human.
  • the host is a plant.
  • Plants in accordance with the invention include, but are not limited to corn, maize, wheat, tobacco, cotton, rice, soybean, peanut, sugarcane, hay, sorghum, lettuces, kales, cabbages, fruit trees, or horitcultural flowers.
  • the pests targeted in plants include, but are not limited to, nematodes, grubs, weevils, borers, aphids, moths, mosquitoes, flies, ticks, termites, beetles, caterpillar, cutworms, earworms, armyworms, or budworms.
  • the photosensitizer is a porphyrin.
  • the porphyrin can be, but is not limited to, a porfimer sodium, hematoporphyrin IX,
  • hematoporphyrin ester dihematoporphyrin ester, synthetic diporphyrin, O- substituted tetraphenyl porphyrin, 3,1-meso tetrakis porphyrin, hydroporphyrin, benzoporphyrin derivative, benzoporphyrin monoacid derivative, monoacid ring derivative, tetracyanoethylene adduct of benzoporphyrin, dimethyl
  • the photosensitizer is a photoactive dye.
  • the photoactive dye includes, but is not limited to, a merocyanine, phthalocyanine, chloroaluminum phthalocyanine, sulfonated aluminum PC, ring-substituted cationic PC, sulfonated AlPc, disulfonated or tetrasulfonated derivative, sulfonated aluminum naphthalocyanine, naphthalocyanine, tetracyanoethylene adduct, crystal violet, azure ⁇ chloride, benzophenothiazinium, benzophenothiazinium chloride (EtNBS), phenothiazine derivative, phenothiaziniums such as rose Bengal, toluidine blue derivatives, toluidine blue O (TBO), methylene blue (MB), new methylene blue N (NMMB), new methylene blue BB, new methylene blue FR, 1,9- dimethyl
  • the photosensitizer includes, but is not limited to, a Diels-Alder adduct, dimethyl acetylene dicarboxylate adduct, anthracenedione, anthrapyrazole, aminoanthraquinone, phenoxazine dye, chalcogenapyrylium dye, cationic selena, tellurapyrylium derivative, cationic imminium salt, or tetracycline.
  • the photosensitizer composition comprises a plurality of the same photosensitizer.
  • the photosensitizer composition comprises a cephalosporin, a penicillin, a penem, a carbapenem, a monocyclic monobactem, or a fragment thereof.
  • the moiety cleavable by ⁇ -lactamase of the photosensitizer composition comprises a cephalosporin, a penicillin, or a fragment thereof.
  • the cephalosporin or penicillin fragment can comprise a beta- lactam ring, and the enzyme cleavage site can be cleaved by a lactamase.
  • the moiety cleavable by ⁇ -lactamase is a cephalosporin. At least one photosensitizer can be bound at the 3' position of the cephalosporin.
  • a binder is present and connected to the photosensitizer by one or more moieties cleavable by ⁇ -lactamase.
  • binder can be a fluorophore or an other photosensitizer.
  • the invention provides a pharmaceutical composition comprising a pesticidally effective amount of a photosensitizer composition of the invention and a pharmaceutically acceptable excipient or carrier.
  • the invention provides a method of eliminating a pest from a host, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more
  • photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein the one or more moieties cleavable by the ⁇ - lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby eliminating the pest from the host.
  • phototoxic species is also flourescent.
  • the pest is an arthropod, a nematode or an insect and the host is a plant.
  • the pest is selected from the group consisting of nematodes, grubs, weevils, borers, aphids, moths, mosquitoes, flies, ticks, termites, beetles, caterpillar, cutworms, earworms, armyworms, and budworms.
  • the plant is selected from the group consisting of corn, maize, wheat, tobacco, cotton, rice, soybean, peanut, sugarcane, hay, sorghum, lettuces, kales, cabbages, fruit trees, and horitcultural flowers.
  • the pest is a parasite and the host is an animal or human.
  • the parasite is selected from the group consisting of ticks, lice, mites, ascarids, filarias, hookworms, pinworms, whipworms, strongyles, Trichinella spiralis, Dirofilaria immitis, Haemonchus contortus, Brugia malayi and Myrmeconema neotropicum.
  • the invention provides a method for eliminating a pest from an industrial material, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein the one or more moieties cleavable by the ⁇ - lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby eliminating the pest from said host.
  • the pest is selected from the group consisting of beetles, termites, and hymenopterons.
  • the industrial material is selected from the group consisting of plastics, adhesives, sizes, paper and card, leather, wood and processed wood products.
  • the invention provides a method for eliminating a pest from an enclosed space, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more
  • photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein the one or more moieties cleavable by the ⁇ - lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby eliminating the pest from said space.
  • the pest is selected from the group consisting of scorpions, spiders, woodlice, pillbugs, bedbugs, millipedes, centipedes, caterpillars, moths, silverfish, cockroaches, grasshoppers, locusts, flies and mosquitoes.
  • the invention provides a method for detecting a pest, said method comprising the steps of: contacting the pest with a quenched photosensitizer composition comprising a plurality of photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein said linked photosensitizers are present in an amount sufficient to quench photoactivation of said photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition; and light- activating the composition to produce a fluorescent species, and detecting the pest by observing the fluorescence, thereby detecting the presence of the pest.
  • the florescent species is also phototoxic.
  • the invention provides a method for controlling an insect pest, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein the one or more moieties cleavable by the ⁇ -lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light- activating the composition to produce a phototoxic species, thereby controlling said insect pest.
  • a pesticidal composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a
  • the insect is Aedes albopictus.
  • the invention provides a method for controlling a filarial nematode, the method comprising the steps of: contacting the worm with an effective amount of a pesticidal composition comprising one or more
  • photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein the one or more moieties cleavable by the ⁇ - lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby controlling said worm.
  • the filarial nematode is Wuchereria bancrofti, Brugia malayi, or B. timori.
  • the invention provides a method for ameliorating filariasis in a subject, the method comprising the steps of: administering to the subject an effective amount of a composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein the one or more moieties cleavable by the ⁇ -lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light- activating the composition to produce a phototoxic species, thereby ameliorating filariasis.
  • the filariasis is associated with Wuchereria bancrofti
  • Brugia malayi Brugia malayi, and/or B. timori.
  • the method reduces the filarial load in the subject by at least about 10-25% or more.
  • the invention provides a method for controlling a fouling pest on an object in contact with saltwater or brackish water, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein the one or more moieties cleavable by the ⁇ -lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked
  • photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light- activating the composition to produce a phototoxic species, thereby controlling the pest.
  • the fouling pest is a goose barnacle, an acorn barnacle or a sessile Oligochaeta.
  • Methods of the invention may further comprise the step of obtaining the photosensitizer composition, linker or binder.
  • the light- activation in the methods of the invention may be from exposure to sunlight, administration of LED lighting, or administration of laser lighting.
  • the invention provides a kit for eliminating a pest the comprising a pesticidal composition of the invention and instructions for using the pesticidal composition to eliminate the pest in accordance with the methods of the invention.
  • the invention provides a kit for detecting a pest the a photosensitizer composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a ⁇ -lactamase expressed by the pest, wherein said linked moieties are present in an amount sufficient to quench photoactivation of said photosensitizers and wherein said one or more photosenitizers are capable of generating a fluorescent species upon dequenching and light-activation, and instructions for using the photosensitizer composition to detect the pest.
  • Figure 1 schematically depicts the development of a carbamate-linked photosensitizer (PS) that is inactive (with or without light) while linked and is light- activatable only when released by the ⁇ -lactamase enzyme-mediated cleavage.
  • PS carbamate-linked photosensitizer
  • Figure 2a shows 'Ft NMR spectra obtained for 7-[(2-phenylacetyl)amino] cephalosporanic acid in CDC13 as a solvent.
  • Figure 2b shows 'Ft NMR spectrum obtained for 7-[(2-phenylacetyl)amino] 3 -hydrodxymethy cephalosporanic acid in DMSO-d6 as a solvent. Major proton peaks are marked on the spectra.
  • Figure 3 shows MS spectra obtained for (a) 7-[(2-phenylacetyl)amino] 3- hydrodxymethy cephalosporanic acid; and (b) cephalosporanic acid-toluidine blue O prodrug.
  • FIG. 4 shows UV- visible spectra obtained for the photosensitizer (TBO) (black line) vs. the Cephalosporanic acid-photosensitizer prodrug (red line) in ethanol at a concentration of 2.0 xl0-5 M.
  • Figure 5 shows fluorescence emission spectra obtained for the
  • TBO photosensitizer
  • red line the Cephalosporanic acid-photosensitizer prodrug
  • Figure 6 shows plots of (a) fluorescence emission vs. wavelength and (b) flurorescence emission vs. time for the Cephalosporanic acid-photosensitizer prodrug, depicting the enzyme-mediated cleavage of the prodrug.
  • Figure 7 shows the synthesis of ⁇ -LEAP
  • Figure 8 shows the increasing relative fluorescence resulting from activation of ⁇ -LEAP by enzymatic cleavage in Brugia malayi adults and 1st stage larvae (microfilariae).
  • Figure 9 shows a confocal laser scanning micrograph of Brugia malayi adults and 1st stage larvae following exposure to ⁇ -LEAP and 650 nm light.
  • Figure 10 shows a confocal laser scanning microscopy of an adult Brugia malayi female following exposure to ⁇ -LEAP and 650 nm light.
  • FIG. 11 shows the effects of photodynamic therapy with the
  • Figure 12 shows the increasing relative fluorescence resulting from activation of ⁇ -LEAP by enzymatic cleavage in Aedes albopictus cells.
  • photosensitizer refers to a photoactivatable compound, or a biological precursor thereof, that produces a reactive species (e.g., oxygen) having a photochemical (e.g., cross linking) or phototoxic effect on a cell, cellular component or biomolecule.
  • a photosensitizer refers to a substance which, upon irradiation with electromagnetic energy of the appropriate wavelength (e.g., light), produces a cytotoxic effect.
  • fluorescent dye refers to dyes that are fluorescent when illuminated with light but do not produce reactive species that are phototoxic or otherwise capable of reacting with biomolecules.
  • a photosensitizer will fluoresce when illuminated with a certain wavelength and power of light and also produce reactive species that is phototoxic under the same or different wavelength and power of light.
  • photoactive dye means that the illuminated photosensitizer produces a fluorescent species, but not necessarily a reactive species in phototoxic amounts (i.e., a phototoxic species).
  • a photosensitizer can be activated to fluoresce and, therefore, act as a photoactive dye, but not produce a phototoxic species.
  • the wavelength and power of light can be adapted by methods known to those skilled in the art to bring about a phototoxic effect where desired.
  • backbone refers to an agent that functions to couple one or more components of a photosensitizer composition of the invention, such as, for example, a polyamino acid or like agent that is linked to one or more photosensitizers and/or one or more binders and/or one or more targeting moieties
  • the backbone itself additionally can be a targeting moiety, e.g. polylysine.
  • a "backbone” as used herein is as a moiety higher in molecular weight and capable of loading more photoactive molecules than a "linker”.
  • Backbone can be a polymeric structure which provides a base to add multiple units (more than three).
  • backbones examples include, but are not limited to polyethylene glycol and polyproline.
  • linker or "moiety cleavable by ⁇ -lactamase” refers to an agent capable of linking two components of the photosensitizer composition together (e.g., a photosensitizer to another photosensitizer, a photosensitizer to a binder, a photosensitizer to a backbone, or a binder to a backbone).
  • binder refers to an agent that absorbs energy from an adjacent, activated photosensitizer or otherwise inactivates the photosensitizer, and, thus, quenches the photosensitizer.
  • nucleic acid is intended to include nucleic acid molecules, e.g. , polynucleotides which include an open reading frame encoding a polypeptide, and can further include non-coding regulatory sequences, and introns.
  • the terms are intended to include one or more genes that map to a functional locus.
  • the terms are intended to include a specific gene for a selected purpose.
  • the term is intended to include any gene encoding a ⁇ -lactamase.
  • peptide As used herein, the terms “peptide”, “polypeptide”, and “protein” are, unless specified otherwise, used interchangeably. Peptides, polypeptides, and proteins used in methods and compositions described herein can be recombinant, purified from natural sources, or chemically synthesized. For example, reference to the use of a bacterial protein or a protein from bacteria, includes the use of recombinantly produced molecules, molecules purified from natural sources, or chemically synthesized molecules.
  • plurality refers to at least two, preferably at least about 10 and even more preferably, at least about 20 or more photosensitizer or binder molecules present in a composition of the invention.
  • host is used herein to include both living hosts and non- living/inanimate hosts.
  • living hosts include plants and animals, e.g., humans.
  • Non-living/inanimate hosts include industrial sites, public areas, and man- made surfaces including household surfaces (kitchen surfaces, floors, walls, ceilings, etc.), patios and the like.
  • animal is used herein to refer to a living animal, including a human, that carries an unwanted organism, the unwanted organism being the target of the methods described herein.
  • plant is used herein to refer to any plant including, but not limited to agricultural crops, fruit trees, nut trees, domestic crops, and flowers.
  • Such plants and crops include, but are not limited to, corn, maize, wheat, tobacco, cotton, rice, soybean, peanut, sugarcane, hay, sorghum, lettuces, kales, cabbages, apples, oranges, pears, pumpkins, tomatoes, fruit trees, or horitcultural flowers.
  • pests or “target organism” means an animal, e.g., insect, parasite or otherwise, that expresses a ⁇ -lactamase capable of cleaving the moieties which bind the photosensitizers in the compositions of the inventions.
  • pests include any pest that adversely impacts on the health and productivity of plants or other animals, or compromises the integrity of an industrial material or dwelling.
  • Specific pests include, but are not limited to, nematodes, grubs, weevils, borers, aphids, moths, mosquitoes, flies, ticks, termites, beetles, caterpillar, cutworms, earworms, armyworms, or budworms.
  • the mosquito is Ades albopictus.
  • the term "parasite” includes an animal organism that lives in or on another and takes its nourishment from that other organism.
  • Parasites in accordance with the invention include, e.g., protozoa, nematodes, helminths and arthropods.
  • Parasites in accordance with the invention further include symbiotic animal organisms.
  • the parasite is Brugia malayi.
  • Methods of the invention include controlling or eliminating Brugia malayi from a human or insect host (e.g., Aedes albopictus).
  • a pesticidally effective amount of a photosensitizer composition as described herein is a quantity sufficient to result in the death of a pest so that the adverse effects of the pest are reduced or alleviated.
  • a composition of the invention comprises an effective amount of a prodrug construct with a photosensitizer and a quencher linked by a beta-lactam ring, resulting in a diminished phototoxicity. This construct is refered to as beta-lactamase enzyme-activated-photosexisitizer CP- LEAP). The synthesis of ⁇ -LEAP is provided at Figure 7.
  • control is meant reducing the survival, proliferation, or reproduction of a pest. Such reduction may be by at least about 10%, 25%, 50%, 75% or more.
  • a composition of the invention ameliorates or controls a parasite infestation (for example, as in filariasis) by reducing the parasitic load in a subject by at least about 5, 10, 50, 75 or 100%.
  • a "peptide antibiotic” is a linear or cyclic oligopeptide, or an active fragment, or analog thereof, which possesses antibiotic activity against bacterial or fungal species, and which is synthesized enzymatic ally on a multi- protein complex to which it is attached by a thioether bond.
  • a peptide antibiotic may include non-ribosomal amino acids such as D amino acids, and may include non-amino acid residues such as esters of lactic acid or valeric acid.
  • Photosensitizers known in the art are typically selected for use according to: 1) efficacy in delivery, 2) proper localization in target tissues, 3) wavelengths of absorbance, 4) proper excitatory wavelength, 5) purity, and 6) in vivo effects on pharmacokinetics, metabolism, and reduced toxicity.
  • a photosensitizer for clinical use is optimally amphiphilic, meaning that it shares the opposing properties of being water-soluble, yet hydrophobic.
  • the photosensitizer should be water-soluble in order to pass through the bloodstream systemically, however it should also be hydrophobic enough to pass across cell membranes.
  • Modifications such as attaching polar residues (amino acids, sugars, and nucleosides) to the hydrophobic porphyrin ring, can alter polarity and partition coefficients to desired levels. Such methods of modification are well known in the art.
  • photosensitizers of the present invention absorb light at a relatively long wavelength, thereby absorbing at low energy.
  • Low-energy light can travel further through tissue than high-energy light, which becomes scattered.
  • Optimal tissue penetration by light occurs between about 650 and about 800 nm.
  • Porphyrins found in red blood cells typically absorb at about 630 nm, and new, modified porphyrins have optical spectra that have been "red-shifted", in other words, absorbs lower energy light.
  • Photosensitizers of the invention can be any known in the art, and optionally coupled to molecular carriers.
  • Porphyrins and hydroporphyrins can include, but are not limited to,
  • Photofrin ® RTM (porfimer sodium), hematoporphyrin IX, hematoporphyrin esters, dihematoporphyrin ester, synthetic diporphyrins, O-substituted tetraphenyl porphyrins (picket fence porphyrins), 3,1-meso tetrakis (o-propionamido phenyl) porphyrin, hydroporphyrins, benzoporphyrin derivatives, benzoporphyrin monoacid derivatives (BPD-MA), monoacid ring "a” derivatives, tetracyanoethylene adducts of benzoporphyrin, dimethyl acetylenedicarboxylate adducts of benzoporphyrin, endogenous metabolic precursors, ⁇ -aminolevulinic acid,
  • benzonaphthoporphyrazines naturally occurring porphyrins, ALA-induced protoporphyrin IX, synthetic dichlorins, bacteriochlorins of the tetra(hydroxyphenyl) porphyrin series, purpurins, tin and zinc derivatives of octaethylpurpurin, etiopurpurin, tin-etio-purpurin, porphycenes, chlorins, chlorin e 6 , mono-l-aspartyl derivative of chlorin e 6 , di-l-aspartyl derivative of chlorin e 6 , tin(IV) chlorin e 6 , meta-tetrahydroxyphenylchlorin, chlorin e 6 monoethylendiamine monamide, verdins such as, but not limited to zinc methyl pyroverdin (ZNMPV), copro II verdin trimethyl ester (CVTME) and deuteroverdin methyl ester (DVME),
  • Porphyrins, hydroporphyrins, benzoporphyrins, and derivatives are all related in structure to hematoporphyrin, a molecule that is a biosynthetic precursor of heme, which is the primary constituent of hemoglobin, found in erythrocytes.
  • First-generation and naturally occurring porphyrins are excited at about 630 nm and have an overall low fluorescent quantum yield and low efficiency in generating reactive oxygen species. Light at about 630 nm can only penetrate tissues to a depth of about 3 mm, however there are derivatives that have been 'red-shifted' to absorb at longer wavelengths, such as the benzoporphyrins BPD-MA (Verteporfin). Thus, these 'red-shifted' derivatives show less collateral toxicity compared to first- generation porphyrins.
  • Chlorins and bacteriochlorins are also porphyrin derivatives, however these have the unique property of hydrogenated exo-pyrrole double bonds on the porphyrin ring backbone, allowing for absorption at wavelengths greater than about 650 nm.
  • Chlorins are derived from chlorophyll, and modified chlorins such as meta- tetra hydroxyphenylchlorin (mTHPC) have functional groups to increase solubility.
  • Bacteriochlorins are derived from photosynthetic bacteria and are further red-shifted to about 740 nm.
  • a specific embodiment of the invention uses chlorin e 6.
  • Purpurins, porphycenes, and verdins are also porphyrin derivatives that have efficacies similar to or exceeding hematoporphyrin.
  • Purpurins contain the basic porphyrin macrocycle, but are red-shifted to about 715 nm. Porphycenes have similar activation wavelengths to hematoporphyrin (about 635nm), but have higher fluorescence quantum yields.
  • Verdins contain a cyclohexanone ring fused to one of the pyrroles of the porphyrin ring. Phorbides and pheophorbides are derived from chlorophylls and have 20 times the effectiveness of hematoporphyrin.
  • Texaphyrins are new metal-coordinating expanded porphyrins.
  • the unique feature of texaphyrins is the presence of five, instead of four, coordinating nitrogens within the pyrrole rings. This allows for coordination of larger metal cations, such as trivalent lanthanides.
  • Gadolinium and lutetium are used as the coordinating metals.
  • the photosensitizer can be Antrin®, otherwise known as motexafin lutetium.
  • 5 -aminolevulinic acid (ALA) is a precursor in the heme biosynthetic pathway, and exogenous administration of this compound causes a shift in equilibrium of downstream reactions in the pathway.
  • protoporphyrin IX the immediate precursor to heme, protoporphyrin IX, is dependent on the rate of 5 -aminolevulinic acid synthesis, governed in a negative-feedback manner by concentration of free heme. Conversion of protoporphyrin IX is slow, and where desired, administration of exogenous ALA can bypass the negative-feedback mechanism and result in accumulation of phototoxic levels of ALA-induced protoporphyrin IX. ALA is rapidly cleared from the body, but like
  • hematoporphyrin has an absorption wavelength of about 630 nm.
  • Photofrin ® is derived from
  • Photofrin ® is characterized as a complex and inseparable mixture of monomers, dimers, and higher oligomers. There has been substantial effort in the field to develop pure substances that can be used as successful photosensitizers.
  • the photosensitizer is a
  • BPD benzoporphyrin derivative
  • BPD-MA benzoporphyrin derivative
  • Verteporfin has been thoroughly characterized (Richter et al., 1987; Aveline et al., 1994; Levy, 1994) and it has been found to be a highly potent photosensitizer for PDT. Verteporfin has been used in PDT treatment of certain types of macular degeneration, and is thought to specifically target sites of new blood vessel growth, or angiogenesis, such as those observed in "wet" macular degeneration.
  • Verteporfin is typically administered intravenously, with an optimal incubation time range from 1.5 to 6 hours. Verteporfin absorbs at 690 nm, and is activated with commonly available light sources.
  • One tetrapyrrole-based photosensitizer having recent success in the clinic is MV0633 (Miravant).
  • the photosensitizer has a chemical structure that includes multiple conjugated rings that allow for light absorption and
  • Cyanine and other dyes include but are not limited to a merocyanine, phthalocyanine, chloroaluminum phthalocyanine, sulfonated aluminum PC, ring- substituted cationic PC, sulfonated AlPc, disulfonated or tetrasulfonated derivative, sulfonated aluminum naphthalocyanine, naphthalocyanine, tetracyanoethylene adduct, crystal violet, azure ⁇ chloride, benzophenothiazinium,
  • phenothiaziniums such as rose Bengal, toluidine blue derivatives, toluidine blue O (TBO), methylene blue (MB), new methylene blue N (NMMB), new methylene blue BB, new methylene blue FR, 1,9-dimethylmethylene blue chloride (DMMB), methylene blue derivatives, methylene green, methylene violet Bernthsen, methylene violet 3RAX, Nile blue, Nile blue derivatives, malachite green, Azure blue A, Azure blue B, Azure blue C, safranine O, neutral red, 5-ethylamino-9- diethylaminobenzo[a]phenothiazinium chloride, 5-ethylamino-9- diethylaminobenzo[a]phenoselenazinium chloride, thiopyronine, or thionine.
  • TBO toluidine blue O
  • MB methylene blue
  • NMMB new methylene blue N
  • BB new
  • Cyanines are deep blue or purple compounds that are similar in structure to porphyrins. However, these dyes are much more stable to heat, light, and strong acids and bases than porphyrin molecules. Cyanines, phthalocyanines, and naphthalocyanines are chemically pure compounds that absorb light of longer wavelengths than hematoporphyrin derivatives with absorption maxima at about 680 nm. Phthalocyanines, belonging to a new generation of substances for PDT are chelated with a variety of diamagnetic metals, chiefly aluminum and zinc, which enhance their phototoxicity. A ring substitution of the phthalocyanines with sulfonated groups will increase solubility and affect the cellular uptake.
  • Methylene blue is a phenothiazine cationic dye that is exemplified by its ability to specifically target mitochondrial membrane potential.
  • Rose-bengal and fluorescein are xanthene dyes that are well documented in the art for use in photodynamic therapy.
  • Rose bengal diacetate is an efficient, cell- permeant generator of singlet oxygen. It is an iodinated xanthene derivative that has been chemically modified by the introduction of acetate groups.
  • anthracenediones, anthrapyrazoles, aminoanthraquinone, phenoxazine dyes, chalcogenapyrylium dyes such as cationic selena and tellurapyrylium derivatives, cationic imminium salts, and tetracyclines are other compounds that also exhibit photoactive properties and can be used advantageously in photodynamic therapy.
  • Other photosensitizers that do not fall in either of the aforementioned categories have other uses besides photodynamic therapy, but are also photoactive.
  • anthracenediones, anthrapyrazoles, aminoanthraquinone compounds are often used as anticancer therapies (i.e. mitoxantrone, doxorubicin).
  • Chalcogenapyrylium dyes such as cationic selena- and tellurapyrylium derivatives have also been found to exhibit photoactive properties in the range of about 600 to about 900 nm range, more preferably from about 775 to about 850 nm.
  • antibiotics such as tetracyclines and fluoroquinolone compounds have demonstrated photoactive properties.
  • Linkers of the invention are capable of linking two components of the photosensitizer composition together (e.g., a photosensitizer to another
  • any bond which is capable of linking the components such that they are stable under physiological conditions for the time needed for administration, ingestion by the pest and activation within the pest is suitable, but covalent linkages are preferred.
  • the link between two components may be direct, e.g., where a photosensitizer is linked directly to another photosensitizer, or indirect, e.g., where a photosensitizer is linked to an intermediate, e.g., linked to a backbone, and that intermediate is linked to another photosensitizer.
  • a linker should function under conditions of temperature, pH, salt, solvent system, and other reactants that substantially retain the chemical stability of the photosensitizer and the backbone (if present).
  • Linkers according to the invention comprise moieties cleavable by a ⁇ - lactamase enzyme.
  • linker cleavage by a ⁇ -lactamase causes reduction of the quenching that results from the conformation adopted by the multiple photosensitizers linked to one another.
  • linker cleavage by ⁇ -lactamase causes reduction of the quenching that results from inclusion of a binder.
  • a linker can link components without the addition to the linked components of elements of the linker.
  • Other linkers result in the addition of elements of the linker to the linked components.
  • linkers can be cross-linking agents that are homo- or hetero-bifunctional, and wherein one or more atomic components of the agent can be retained in the composition.
  • Linkers react with an amine and a carboxylate, to form an amide, or an alcohol and a carboxylate to form an ester.
  • Linkers are known in the art, see, e.g., M. Bodansky, "Principles of Peptide Synthesis", 2nd ed., referenced herein, and T. Greene and P. Wuts, "Protective Groups in Organic Synthesis," 2nd Ed, 1991, John Wiley, NY.
  • Linkers should link component moieties stably, but such that there is only minimal or no denaturation or deactivation of the photosensitizer or other linked component.
  • the pesticidal compositions of the invention can be prepared by linking the photosensitizers to one another or to other components using methods known in the art.
  • linkers including cross-linking agents, can be used for covalent conjugation.
  • cross-linking agents include ⁇ , ⁇ '- dicyclohexylcarbodiimide (DCC), N-succinimidyl-S-acetyl-thioacetate (SATA), N- succinimidyl-3-(2-pyridyldithio)propionate (SPDP), ortho-phenylenedimaleimide (o-PDM), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohexane-l-carboxylate (sulfo-SMCC) (Karpovsky et al.
  • DCC is a useful linker (Pierce #20320; Rockland, IL).
  • DCC ⁇ , ⁇ '- dicyclohexylcarbodiimide
  • SPDP is a heterobifunctional cross-linker for use with primary amines and sulfhydryl groups. SPDP produces cleavable cross-linking such that, upon further reaction, the agent is eliminated, so the photosensitizer can be linked directly to a backbone or molecular carrier.
  • Additional useful linking agents are hydrazines or hydrazine derivatives, compounds that are very soluble in water and soluble in alcohol. Hydrazines are corrosive and strong reducing agents, though they constitute weaker bases than ammonia. Hydrazines are dibasic and form many salts, e.g., mono- and di- hydrochlorides, mono- and di-nitrates, and two sulfates.
  • the hydrazine resin has been found to be a novel and highly useful platform for polyamide synthesis. The hydrazine resin is stable to elevated coupling temperatures, yet is cleaved rapidly at moderate temperatures by a wide range of nucleophiles following a mild and selective oxidation protocol.
  • Photosensitizers which contain carboxyl groups can be joined to lysine s- amino groups in target polypeptides either by preformed reactive esters (such as N- hydroxy succinimide ester) or esters conjugated in situ by a carbodiimide-mediated reaction. The same applies to photosensitizers that contain sulfonic acid groups, which can be transformed to sulfonyl chlorides, which react with amino groups.
  • Photosensitizers that have carboxyl groups can be joined to amino groups on the polypeptide by an in situ carbodiimide method or by hydrazine or hydrazine derivatives.
  • Photosensitizers can also be attached to hydroxyl groups, of serine or threonine residues or to sulfhydryl groups, of serine or threonine residues or to sulfhydryl groups of cysteine residues.
  • Methods of joining components of a composition can use heterobifunctional cross linking reagents. These agents bind a functional group in one chain and a different functional group in a second chain. These functional groups typically are amino, carboxyl, sulfhydryl, and aldehyde. There are many permutations of appropriate moieties that will react with these groups and with differently formulated structures, to join them together (described in the Pierce Catalog and Merrifield et al. (1994) Ciba Found Symp. 186:5-20).
  • the photosensitizer compositions of the invention can be prepared by linking the photosensitizer to another photosensitizer, a binder and/or a backbone using methods described in the following Examples or by methods known in the art.
  • linkers can be used for covalent conjugation.
  • Yield from linking reactions can be assessed by spectroscopy of product eluting from a chromatographic fractionation in the final step of purification.
  • the presence of unlinked photosensitizer and reaction products containing the photosensitizer can be followed by the physical property that the photosensitizer absorbs light at a characteristic wavelength and extinction coefficient, so incorporation into products can be monitored by absorbance at that wavelength or a similar wavelength.
  • Linking of one or more photosensitizer molecules to another or to a binder or to a backbone shifts the peak of absorbance in the elution profile in fractions eluted using sizing gel chromatography, e.g., with the appropriate choice of Sephadex G50, G100, or G200 or other such matrices (Pharmacia-Biotech, Piscataway N.J.)- Choice of appropriate sizing gel, for example Sephadex gel, can be determined by that gel in which the photosensitizer elutes in a fraction beyond the excluded volume of material too large to interact with the bead, i.e., the uncoupled starting photosensitizer composition interacts to some extent with the fractionation bead and is concomitantly retarded to some extent.
  • sizing gel chromatography e.g., with the appropriate choice of Sephadex G50, G100, or G200 or other such matrices (Pharmacia-Biotech, Piscataway N
  • the correct useful gel can be predicted from the molecular weight of the uncoupled photosensitizer.
  • the successful reaction products of photosensitizer compositions coupled to additional moieties generally have characteristic higher molecular weights, causing them to interact with the chromatographic bead to a lesser extent, and thus appear in fractions eluting earlier than fractions containing the uncoupled photosensitizer substrate.
  • Unreacted photosensitizer substrate generally appears in fractions characteristic of the starting material, and the yield from each reaction can thus be assessed both from size of the peak of larger molecular weight material, and the decrease in the peak of characteristic starting material.
  • the area under the peak of the product fractions is converted to the size of the yield using the molar extinction coefficient.
  • the product can be analyzed using NMR, integrating areas of appropriate product peaks, to determine relative yields with different linkers.
  • a red shift in absorption of a photosensitizer of several nm has often been observed following coupling to a polyamino acid.
  • Linking to a larger moiety such as a protein might produces a comparable shift, as linking to an antibody resulted in a shift of about 3-5 nm in that direction compared to absorption of the free photosensitizer.
  • the binder may, without limitation, be a peptide, a cyclic peptide, a polypeptide, a peptidomimetic, a protein, a fusion protein, a hybrid molecule or a dimer, multimer, or a conjugate of the above that binds or quenches, and, thus, may inhibit, suppress, neutralize, or decrease activity of, the photosensitizer.
  • the binder may include, without limitation, a naturally occurring inhibitor, a receptor, a soluble receptor, an antibody, a polyclonal antibody, a monoclonal antibody, a bispecific antibody, an antibody fragment, a single chain antibody, anti-idiotype antibodies, a peptabody, a peptide, an oligopeptides, an oligonucleotide, a cyclic peptide (i.e., a peptide that is circular in nature), a peptide-lipid conjugate, a hormone, an antigen, an epitope, a receptor, a chemokine, a nucleic acid, a ligand or a dimer, multimer, or a conjugate of the above.
  • Naturally occurring binders are binders that quench the photosensitizer and are found in nature.
  • the binder is a fluorophore.
  • the property that renders a fluorophore (or any other binder) a suitable quencher is the capability of absorbing energy from the activated photosensitizer.
  • Fluorophores of the present invention can be any known in the art, including photosensitizers, fluorescent dyes, and photoactive dyes.
  • Photosensitizers can be any known in the art, as previously described.
  • hematoporphyrin derivatives have been used as fluorescent probes to investigate the development of human atherosclerotic plaques (Spokojny (1986) J. Am. Coll. Cardiol. 8:1387-1392).
  • the photosensitizer acting as a binder has a different excitation wavelength than the photosensitizer acting to produce a cytotoxic effect on the pathogen or host cell infected with the pathogen.
  • Fluorescent dyes of the present invention can be any known in the art, including, but not limited to 6-carboxy-4',5'-dichloro-2', 7'-dimethoxyfluorescein succinimidyl ester; 5-(and-6)-carboxyeosin; 5-carboxyfluorescein; 6- carboxyfluorescein; 5-(and-6)-carboxyfluorescein; 5-carboxyfluorescein-bis-(5- carboxymethoxy-2-nitrobenzyl) ether, -alanine-carboxamide, or succinimidyl ester; 5- carboxyfluorescein succinimidyl ester; 6-carboxyfluorescein succinimidyl ester; 5- (and-6)-carboxyfluorescein succinimidyl ester; 5-(4,6-dichlorotriazinyl)
  • Fluorescent dyes of the present invention can also be, for example, bodipy dyes commercially available from Molecular Probes, including, but not limited to BODIPY® FL; BODIPY® TMR STP ester; BODIPY® TR-X STP ester;
  • BODIPY® 630/650-X STP ester BODIPY® 650/665-X STP ester; 6-dibromo-4,4- difluoro-5, 7-dimethyl-4-bora-3a,4a-diaza- s-indacene- 3 -propionic acid succinimidyl ester; 4,4-difluoro-4-bora-3a,4a- diaza-s-indacene-3,5-dipropionic acid; 4,4- difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3-pentanoic acid; 4,4- difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3-pentanoic acid; 4,4- difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3-
  • succinimidyl ester 4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3- propionic acid; 4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3- propionic acid succinimidyl ester; 4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s- indacene- 3-propionic acid sulfosuccinimidyl ester or sodium salt; 6-((4,4-difluoro- 5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene-3-propionyl)amino)hexanoic acid; 6- ((4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indace
  • Fluorescent dyes the present invention can also be, for example, alexa fluor dyes commercially available from Molecular Probes, including but not limited to Alexa Fluor® 350 carboxylic acid; Alexa Fluor® 430 carboxylic acid; Alexa Fluor® 488 carboxylic acid; Alexa Fluor® 532 carboxylic acid; Alexa Fluor® 546 carboxylic acid; Alexa Fluor® 555 carboxylic acid; Alexa Fluor® 568 carboxylic acid; Alexa Fluor® 594 carboxylic acid; Alexa Fluor® 633 carboxylic acid; Alexa Fluor® 647 carboxylic acid; Alexa Fluor® 660 carboxylic acid; and Alexa Fluor® 680 carboxylic acid.
  • Alexa Fluor® 350 carboxylic acid
  • Alexa Fluor® 430 carboxylic acid
  • Alexa Fluor® 488 carboxylic acid Alexa Fluor® 532 carboxylic acid
  • Alexa Fluor® 546 carboxylic acid Alexa Fluor® 555 carboxylic acid
  • Fluorescent dyes the present invention can also be, for example, cy dyes commercially available from Amersham-Pharmacia Biotech, including, but not limited to Cy3 NHS ester; Cy 5 NHS ester; Cy5.5 NHS ester; and Cy 7 NHS ester.
  • Photoactive dyes of the present invention can be any photosensitizer known in the art which will fluoresce but not necessarily produce a reactive species in phototoxic amounts when illuminated. Depending on the wavelength and power of light administered, a photosensitizer can be activated to fluoresce and, therefore, act as a photoactive dye, but not produce a phototoxic effect unless, in some cases, the wavelength and power of light is suitably adapted to induce a phototoxic effect.
  • any reference to a binder should be construed to refer to each of the binders identified and contemplated herein and to each biologically equivalent molecule.
  • "Biologically equivalent” means compositions of the present invention which are capable of preventing action of the photosensitizer in a similar fashion, but not necessarily to the same degree.
  • Pesticidal compositions according to the invention include those in which a "backbone” moiety, such as a polyamino acid, is linked to a photosensitizer and/or to a binder.
  • a "backbone” moiety such as a polyamino acid
  • a backbone in a composition with a photosensitizer and/or binder can provide a number of advantages, including the provision of greater stoichiometric ranges of photosensitizers and/or binders and/or targeting moieties coupled per backbone. If the backbone possesses intrinsic affinity for a target pest, the affinity of the composition can be enhanced by coupling to the backbone.
  • Peptides useful in the methods and compounds of the invention for design and characterization of backbone moieties include poly-amino acids which can be homo- and hetero-polymers of L-, D-, racemic DL- or mixed L- and D-amino acid composition, and which can be of defined or random mixed composition and sequence.
  • Examples of naturally-occurring peptides with mixed D and L amino acid residues include bacitracin and tyrocidin. These peptides may be modeled after particular natural peptides, and optimized by the technique of phage display and selection for enhanced binding to a chosen target, so that the selected peptide of highest affinity is characterized and then produced synthetically.
  • non-peptide backbones include nucleic acids and derivatives of nucleic acids such as DNA, RNA and peptide nucleic acids;
  • polysaccharides and derivatives such as starch, pectin, chitins, celluloses and hemi- methylated celluloses; lipids such as triglyceride derivatives and cerebrosides; synthetic polymers such as polyethylene glycols (PEGs) and PEG star polymers; dextran derivatives, polyvinyl alcohols, N-(2-hydroxypropyl)-methacrylamide copolymers, poly (DL-glycolic acid-lactic acid); and compositions containing elements of any of these classes of compounds.
  • PEGs polyethylene glycols
  • PEG star polymers such as polyethylene glycols (PEGs) and PEG star polymers
  • dextran derivatives polyvinyl alcohols, N-(2-hydroxypropyl)-methacrylamide copolymers, poly (DL-glycolic acid-lactic acid); and compositions containing elements of any of these classes of compounds.
  • the pesticidal compositions are suitable for protecting plants and plant organs, for increasing the harvest yields, for improving the quality of the harvested goods and for controlling animal pests, in particular insects, arachnids and nematodes, which are encountered in agriculture, in forests, in gardens and leisure facilities, in the protection of stored products and of materials, and in the hygiene sector, and have good plant tolerance, favorable toxicity to warm-blooded animals and good environmental compatibility. They may preferably be employed as crop protection agents.
  • the pesticidal compositions according to the invention can be used, for example, and without limitation, to treat propagation material such as tubers or rhizomes, but also seeds, seedlings or seedlings pricking out and plants or plants pricking out. These methods of treatment can also be useful to treat roots.
  • the methods of treatment according to the invention can also be useful to treat the overground parts of the plant such as trunks, stems or stalks, leaves, flowers and fruit of the concerned plant.
  • Plants in accordance with the invention include, but are not limited to corn; tobacco; cotton; soybean; sugarcane; hay; sorghum; kales; cabbages; flax; vine; fruit or vegetable crops such as Rosaceae sp. (for instance pip fruit such as apples and pears, but also stone fruit such as apricots, almonds and peaches), Ribesioidae sp., Juglandaceae sp., Betulaceae sp., Anacardiaceae sp., Fagaceae sp., Moraceae sp., Oleaceae sp., Actimidaceae sp., Lauraceae sp., Musaceae sp.
  • Rosaceae sp. for instance pip fruit such as apples and pears, but also stone fruit such as apricots, almonds and peaches
  • Ribesioidae sp. Juglandaceae sp.
  • Rubiaceae sp. for instance banana trees and plantains
  • Rubiaceae sp. Theaceae sp., Sterculiceae sp., Rutaceae sp. (for instance lemons, oranges and grapefruit); Solanaceae sp. (for instance tomatoes), Liliaceae sp., Asteraceae sp. (for instance lettuces), Umbelliferae sp., Cruciferae sp., Chenopodiaceae sp., Cucurbitaceae sp., Papilionaceae sp. (for instance peas), Rosaceae sp. (for instance strawberries); major crops such as Graminae sp.
  • Asteraceae sp. for instance sunflower
  • Cruciferae sp. for instance colza
  • Fabacae sp. for instance peanuts
  • Papilionaceae sp. for instance soybean
  • Solanaceae sp. for instance potatoes
  • Chenopodiaceae sp. for instance beetroots
  • horticultural and forest crops including flowers; as well as genetically modified homologues of these crops.
  • the pesticidal compositions according to the invention can be also used, for example, and without limitation, in connection with the following plants:
  • Monocotyledonous weeds of the genera Aegilops, Agropyron, Agrostis, Alopecurus, Apera, Avena, Brachiaria, Bromus, Cenchrus, Commelina, Cynodon, Cyperus, Dactyloctenium, Digitaria, Echinochloa, Eleocharis, Eleusine, Eragrostis, Eriochloa, Festuca, Fimbristylis,
  • Monocotyledonous crops of the genera Allium, Ananas, Asparagus, Avena, Hordeum, Oryza, Panicum, Saccharum, Secale, Sorghum, Triticale, Triticum, Zea.
  • pesticidal compositions of the invention can be used as such, in the form of their formulations or in the use forms prepared therefrom by further dilution, such as ready-to-use solutions, suspensions, emulsions, powders, pastes and granules. They are used in a customary manner, for example by watering, spraying, atomizing or broadcasting.
  • the pesticidal compositions of the invention can be applied both before and after emergence of the plants. They can also be incorporated into the soil before sowing.
  • Plants are to be understood as meaning in the present context all plants and plant populations such as desired and undesired wild plants or crop plants (including naturally occurring crop plants).
  • Crop plants can be plants which can be obtained by conventional plant breeding and optimization methods or by biotechnological and recombinant methods or by combinations of these methods, including the transgenic plants and inclusive of the plant cultivars protectable or not protectable by plant breeders' rights.
  • Plant parts are to be understood as meaning all parts and organs of plants above and below the ground, such as shoot, leaf, flower and root, examples which may be mentioned being leaves, needles, stalks, stems, flowers, fruit bodies, fruits, seeds, roots, tubers and rhizomes.
  • the plant parts also include harvested material, and vegetative and generative propagation material, for example cuttings, tubers, rhizomes, offsets and seeds.
  • Treatment according to the invention of the plants and plant parts with the pesticidal compositions is carried out directly or by allowing the compounds to act on their surroundings, environment or storage space by the customary treatment methods, for example by immersion, spraying, evaporation, fogging, scattering, painting on and, in the case of propagation material, in particular in the case of seeds, also by applying one or more coats.
  • the pesticidal compositions can be converted to the customary formulations, such as solutions, emulsions, wettable powders, suspensions, powders, dusts, pastes, soluble powders, granules, suspension-emulsion concentrates, natural and synthetic materials impregnated with active compound and microencapsulations in polymeric substances.
  • formulations are produced in a known manner, for example by mixing the pesticidal compositions with extenders, that is, liquid solvents, and/or solid carriers, optionally with the use of surfactants, that is emulsifiers and/or dispersants, and/or foam-formers.
  • extenders that is, liquid solvents, and/or solid carriers
  • surfactants that is emulsifiers and/or dispersants, and/or foam-formers.
  • suitable liquid solvents are: aromatics such as xylene, toluene or alkylnaphthalenes, chlorinated aromatics or chlorinated aliphatic hydrocarbons such as chlorobenzenes, chloroethylenes or methylene chloride, aliphatic hydrocarbons such as cyclohexane or paraffins, for example petroleum fractions, mineral and vegetable oils, alcohols such as butanol or glycol and also their ethers and esters, ketones such as acetone, methyl ethyl ketone, methyl isobutyl ketone or cyclohexanone, strongly polar solvents such as dimethylformamide and dimethyl sulphoxide, and also water.
  • aromatics such as xylene, toluene or alkylnaphthalenes
  • chlorinated aromatics or chlorinated aliphatic hydrocarbons such as chlorobenzenes, chloroethylenes or methylene chloride
  • aliphatic hydrocarbons
  • Suitable Solid Carriers are: for example ammonium salts and ground natural minerals such as kaolins, clays, talc, chalk, quartz, attapulgite, montmorillonite or diatomaceous earth, and ground synthetic minerals, such as highly disperse silica, alumina and silicates; suitable solid carriers for granules are: for example crushed and fractionated natural rocks such as calcite, marble, pumice, sepiolite and dolomite, and also synthetic granules of inorganic and organic meals, and granules of organic material such as sawdust, coconut shells, maize cobs and tobacco stalks; suitable emulsifiers and/or foam-formers are: for example nonionic and anionic emulsifiers, such as polyoxyethylene fatty acid esters, polyoxyethylene fatty alcohol ethers, for example alkylaryl polyglycol ethers, alkylsulphonates, alkyl sulphates, arylsulphonates and
  • Tackifiers such as carboxymethylcellulose and natural and synthetic polymers in the form of powders, granules or latices, such as gum arabic, polyvinyl alcohol and polyvinyl acetate, as well as natural phospholipids such as cephalins and lecithins, and synthetic phospholipids, can be used in the formulations.
  • Other possible additives are mineral and vegetable oils.
  • colorants such as inorganic pigments, for example iron oxide, titanium oxide and Prussian Blue, and organic dyestuffs, such as alizarin dyestuffs, azo dyestuffs and metal phthalocyanine dyestuffs, and trace nutrients such as salts of iron, manganese, boron, copper, cobalt, molybdenum and zinc.
  • organic dyestuffs such as alizarin dyestuffs, azo dyestuffs and metal phthalocyanine dyestuffs
  • trace nutrients such as salts of iron, manganese, boron, copper, cobalt, molybdenum and zinc.
  • pesticidal compositions of the invention can be used in the form of concentrates or generally customary formulations, such as powders, granules, solutions, suspensions, emulsions or pastes.
  • the formulations mentioned can be prepared in a manner known per se, for example by mixing the active compounds with at least one solvent or diluent, emulsifier, dispersing agent and/or binder or fixing agent, a water repellent, if appropriate siccatives and UV stabilizers and if appropriate dyestuffs and pigments, and also other processing auxiliaries.
  • the pesticidal compositions of the invention are used alone or in combination with other suitable active compounds, such as phosphoric acid esters, carbamates, pyrethroids, neonicotinoides, growth regulators or active compounds from other known classes of pesticides.
  • suitable active compounds such as phosphoric acid esters, carbamates, pyrethroids, neonicotinoides, growth regulators or active compounds from other known classes of pesticides.
  • the pesticidal compositions of the invention can be used in aerosols, pressure-free spray products, for example pump and atomizer sprays, automatic fogging systems, foggers, foams, gels, evaporator products with evaporator tablets made of cellulose or polymer, liquid evaporators, gel and membrane evaporators, propeller-driven evaporators, energy-free or passive evaporation systems, moth papers, moth bags and moth gels, as granules or dusts, in baits for spreading or in bait stations.
  • pump and atomizer sprays for example pump and atomizer sprays, automatic fogging systems, foggers, foams, gels, evaporator products with evaporator tablets made of cellulose or polymer, liquid evaporators, gel and membrane evaporators, propeller-driven evaporators, energy-free or passive evaporation systems, moth papers, moth bags and moth gels, as granules or dusts, in baits for spreading or in bait stations
  • the pesticidal compositions can be used to control fouling by mixing the compositions into ready-to-use antifouling paints
  • the ready-to-use antifouling paints can additionally comprise other active compounds, preferably algicides, fungicides, herbicides, molluscicides, or other antifouling active compounds.
  • the antifouling compositions used comprise the active compound according to the invention of the compounds according to the invention in a concentration of 0.001 to 50% by weight, in particular 0.01 to 20% by weight.
  • the antifouling compositions according to the invention comprise the customary components such as, for example, those described in Ungerer, Chem. Ind. 1985, 37, 730-732 and Williams, Antifouling Marine Coatings, Noyes, Park Ridge, 1973.
  • Antifouling paints can further comprise, in particular, binders.
  • binders are polyvinyl chloride in a solvent system, chlorinated rubber in a solvent system, acrylic resins in a solvent system, in particular in an aqueous system, vinyl chloride/vinyl acetate copolymer systems in the form of aqueous dispersions or in the form of organic solvent systems, butadiene/styrene/acrylonitrile rubbers, drying oils such as linseed oil, resin esters or modified hardened resins in combination with tar or bitumens, asphalt and epoxy compounds, small amounts of chlorine rubber, chlorinated polypropylene and vinyl resins.
  • the pesticidal compositions of the invention can be used in a known manner by enteral administration in the form of, for example, tablets, capsules, potions, drenches, granules, pastes, boluses, the feed- through process and suppositories, by parenteral administration, such as, for example, by injection (intramuscular, subcutaneous, intravenous, intraperitoneal and the like), implants, by nasal administration, by dermal use in the form, for example, of dipping or bathing, spraying, pouring on and spotting on, washing and powdering, and also with the aid of moulded articles containing the active compound, such as collars, ear marks, tail marks, limb bands, halters, marking devices and the like.
  • parenteral administration such as, for example, by injection (intramuscular, subcutaneous, intravenous, intraperitoneal and the like), implants, by nasal administration, by dermal use in the form, for example, of dipping or bathing, spraying, pouring on and
  • a therapeutically effective amount of a composition of the invention can be administered in one or more doses.
  • An effective amount is an amount that is sufficient to palliate, ameliorate, reduce, stabilize, reverse or slow the progression of a pest infestation, such as a parasite infestation, or tick infestation.
  • a therapeutically effective amount can be provided in one or a series of
  • the effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art.
  • the dosage for in vivo therapeutics or diagnostics will vary.
  • compositions of the present invention may be administered by a mode appropriate for the form of composition.
  • Available routes of administration include subcutaneous, intramuscular, intraperitoneal, intradermal, oral, intranasal, intrapulmonary (i.e., by aerosol), intravenously, intramuscularly, subcutaneously, intracavity, intrathecally or transdermally, alone or in combination with nanoparticle compositions.
  • Therapeutic nanoparticle compositions e.g., a nanoparticle containing a photosensitizer core, a polymer shell, and a targeting aptamer fixed to the surface of the shell in an appropriate excipient
  • compositions for oral, intranasal, or topical administration can be supplied in solid, semi-solid or liquid forms, including tablets, capsules, powders, liquids, and suspensions.
  • Compositions for injection can be supplied as liquid solutions or suspensions, as emulsions, or as solid forms suitable for dissolution or suspension in liquid prior to injection.
  • a preferred composition is one that provides a solid, powder, or liquid aerosol when used with an appropriate aerosolizer device.
  • compositions are preferably supplied in unit dosage form suitable for administration of a precise amount.
  • Also contemplated by this invention are slow release or sustained release forms, whereby a relatively consistent level of the active compound are provided over an extended period.
  • Intralesional administration of various forms are useful in that they do not cause the toxicity seen with systemic administration of immunologic agents (Fletcher and Goldstein, 1987), (Rabinowich et al., 1987), (Rosenberg et al., 1986), (Pizza et al., 1984).
  • the pesticidal compositions are active against normally sensitive and resistant species and against all or some stages of development.
  • pests include, but are not limited to: From the order of the Isopoda, for example, Oniscus asellus, Armadillidium vulgare and Porcellio scaber.
  • Diplopoda for example, Blaniulus guttulatus.
  • Chilopoda for example, Geophilus carpophagus and Scutigera spp.
  • Symphyla for example, Scutigerella immaculata.
  • Thysanura for example, Lepisma saccharina.
  • Gryllotalpa spp. Locusta migratoria migratorioides, Melanoplus spp. and Schistocerca gregaria.
  • Phthiraptera From the order of the Phthiraptera, for example, Pediculus humanus corporis, Haematopinus spp., Linognathus spp., Trichodectes spp. and Damalinia spp.
  • Thysanoptera From the order of the Thysanoptera, for example, Hercinothrips femoralis, Thrips tabaci, Thrips palmi and Frankliniella accidentalis.
  • Euscelis bilobatus Nephotettix cincticeps, Lecanium corni, Saissetia oleae, Laodelphax striatellus, Nilaparvata lugens, Aonidiella aurantii, Aspidiotus hederae, Pseudococcus spp. and Psylla spp.
  • Ceuthorrhynchus assimilis Hypera postica, Dermestes spp., Trogoderma spp., Anthrenus spp., Attagenus spp., Lyctus spp., Meligethes aeneus, Ptinus spp., Niptus hololeucus, Gibbium psylloides, Tribolium spp., Tenebrio molitor, Agriotes spp., Conoderus spp., Melolontha melolontha,
  • Hymenoptera From the order of the Hymenoptera, for example, Diprion spp., Hoplocampa spp., Lasius spp., Monomorium pharaonis and Vespa spp.
  • Aedes spp. From the order of the Diptera, for example, Aedes spp., Anopheles spp., Culex spp., Drosophila melanogaster, Musca spp., Fannia spp., Calliphora erythrocephala, Lucilia spp., Chrysomyia spp., Cuterebra spp., Gastrophilus spp., Hyppobosca spp., Stomoxys spp., Oestrus spp.,
  • hypoderma spp. Tabanus spp., Tannia spp., Bibio hortulanus, Oscinellafrit, Phorbia spp., Pegomyia hyoscyami, Ceratitis capitata, Dacus oleae, Tipula paludosa, Hylemyia spp. and Liriomyza spp.
  • compositions of the invention are active act against phytoparasitic nematodes including, but are not limited to:
  • Pratylenchus spp. Radopholus similis, Ditylenchus dipsaci, Tylenchulus semipenetrans, Heterodera spp., Globodera spp., Meloidogyne spp., Aphelenchoides spp., Longidorus spp., Xiphinema spp., Trichodorus spp., Bursaphelenchus spp. iii. Veterinary and livestock pests
  • the pesticidal compositions of the invention are also useful in the veterinary medicine sector against animal parasites (ectoparasites), such as hard ticks, soft ticks, mange mites, harvest mites, flies (biting and licking), parasitic fly larvae, lice, hair lice, feather lice and fleas.
  • animal parasites ectoparasites
  • ectoparasites such as hard ticks, soft ticks, mange mites, harvest mites, flies (biting and licking), parasitic fly larvae, lice, hair lice, feather lice and fleas.
  • parasites include, but are not limited to:
  • Anoplurida for example, Haematopinus spp., Linognathus spp., Pediculus spp., Phtirus spp. and Solenopotes spp.
  • Nematocerina and Brachycerina for example, Aedes spp., Anopheles spp., Culex spp., Simulium spp., Eusimulium spp., Phlebotomus spp., Lutzomyia spp., Culicoides spp., Chrysops spp., Hybomitra spp., Atylotus spp., Tabanus spp., Haematopota spp., Philipomyia spp., Braula spp., Musca spp., Hydrotaea spp., Stomoxys spp., Haematobia spp., Morellia spp., Fannia spp., Glossina spp., Calliphora spp., Glossina spp., Chrysomyia s
  • Actinedida Prostigmata
  • Acaridida Acaridida
  • Acarapis spp. Cheyletiella spp., Ornitrocheyletia spp., Myobia spp., Psorergates spp., Demodex spp., Trombicula spp., Listrophorus spp., Acarus spp., Tyrophagus spp., Caloglyphus spp., Hypodectes spp., Pterolichus spp., Psoroptes spp., Chorioptes spp.,
  • Otodectes spp. Sarcoptes spp., Notoedres spp., Knemidocoptes spp., Cytodites spp. and Laminosioptes spp.
  • compositions of the invention are also suitable for controlling arthropods which infest agricultural productive livestock, such as, for example, cattle, sheep, goats, horses, pigs, donkeys, camels, buffalo, rabbits, chickens, turkeys, ducks, geese and bees, other pets, such as, for example, dogs, cats, caged birds and aquarium fish, and also so-called test animals, such as, for example, hamsters, guinea pigs, rats and mice.
  • arthropods cases of death and reduction in productivity (for meat, milk, wool, hides, eggs, honey etc.) should be diminished, so that more economic and easier animal husbandry is possible by use of the active compounds according to the invention.
  • the pesticidal compositions of the invention are also useful against insects which destroy industrial materials.
  • pests include, but are not limited to:
  • Hymenopterons such as Sirex juvencus, Urocerus gigas, Urocerus gigas taignus, Urocerus augur.
  • Termites such as Kalotermes flavicollis, Cryptotermes brevis, Heterotermes indicola, Reticulitermes flavipes, Reticulitermes santonensis, Reticulitermes lucifugus, Mastotermes darwiniensis, Zootermopsis nevadensis, Coptotermes formosanus.
  • Bristletails such as Lepisma saccharina.
  • Industrial materials in the present connection are to be understood as meaning non-living materials, such as, preferably, plastics, adhesives, sizes, paper and card, leather, wood and processed wood products and coating compositions.
  • Wood and processed wood products are materials to be protected, especially preferably, from insect infestation.
  • Wood and processed wood products which can be protected by the agents according to the invention or mixtures comprising these are to be understood as meaning, for example: building timber, wooden beams, railway sleepers, bridge components, boat jetties, wooden vehicles, boxes, pallets, containers, telegraph poles, wood paneling, wooden windows and doors, plywood, chipboard, joinery or wooden products which are used quite generally in house-building or in building joinery. v. Enclosed Spaces / Household Pests
  • the pesticidal compositions of the invention are also suitable for controlling animal pests, in particular insects, arachnids and mites, which are found in enclosed spaces such as, for example, dwellings, factory halls, offices, vehicle cabins and the like. They can be employed alone or in combination with other active compounds and auxiliaries in domestic pesiticide products for controlling these pests. They are active against sensitive and resistant species and against all developmental stages. These pests include, but are not limited to:
  • Scorpionidea for example, Buthus occitanus.
  • Acarina for example, Argas persicus, Argas reflexus, Bryobia ssp., Dermanyssus gallinae, Glyciphagus domesticus, Ornithodorus moubat, Rhipicephalus sanguineus, Trombicula alfreddugesi,
  • Opiliones From the order of the Opiliones, for example, Pseudoscorpiones chelifer, Pseudoscorpiones cheiridium, Opiliones phalangium.
  • Chilopoda for example, Geophilus spp.
  • Zygentoma for example, Ctenolepisma spp., Lepisma saccharina, Lepismodes inquilinus.
  • Anthrenus spp. From the order of the Coleptera, for example, Anthrenus spp., Attagenus spp., Dermestes spp., Latheticus oryzae, Necrobia spp., Ptinus spp., Rhizopertha dominica, Sitophilus granarius, Sitophilus oryzae,
  • erythrocephala Chrysozona pluvialis, Culex quinquefasciatus, Culex pipiens, Culex tarsalis, Drosophila spp., Fannia canicularis, Musca domestica, Phlebotomus spp., Sarcophaga carnaria, Simulium spp., Stomoxys calcitrans, Tipula paludosa.
  • Lepidoptera From the order of the Lepidoptera, for example, Achroia grisella, Galleria mellonella, Plodia interpunctella, Tinea cloacella, Tinea pellionella, Tineola bisselliella.
  • Ctenocephalides canis Ctenocephalides felis, Pulex irritans, Tunga penetrans, Xenopsylla cheopis.
  • the pesticidal compositions of the invention are also suitable for controlling parasites which can infest animals and humans . They can be employed alone or in combination with other active compounds for controlling these pests and symptoms related to the infestation of such pests. They are active against sensitive and resistant species and against all developmental stages. These pests include, but are not limited to ticks, lice, mites, strongyles, nematode parasites, such as ascarids (Ascaris) (including Ascaris lumbricoides (Large Roundworm of Man)), filarias, hookworms, pinworms (including Enter obius vermicularis - (The Human Pinworm)) whipworms (Trichuris trichiura), Trichinella spiralis, Dirofilaria immitis
  • the pesticidal compositions of the invention are also suitable for controlling pests which cause fouling of ships and other objects which come into contact with saltwater or brackish water, such as hulls, screens, nets, buildings, moorings and signalling systems, against fouling.
  • Such fouling includes, but is not limited to, fouling by sessile Oligochaeta, such as Serpulidae, and by shells and species from the Ledamorpha group (goose barnacles), such as various Lepas and Scalpellum species, or by species from the Ledamorpha group (goose barnacles), such as various Lepas and Scalpellum species, or by species from the Ledamorpha group (goose barnacles), such as various Lepas and Scalpellum species, or by species from the Ledamorpha group (goose barnacles), such as various Lepas and Scalpellum species, or by species from the Ledamorpha group (goose barnacles), such as various Lepas and Scalpellum species, or by species from the Ledamorpha group (goose barnacles), such as various Lepas and Scalpellum species, or by species from the Ledamorpha group (goose barnacles), such as various Lepas
  • Balanomorpha group (acorn barnacles), such as Balanus or Pollicipes species, increases the frictional drag of ships and, as a consequence, leads to a marked increase in operation costs owing to higher energy consumption and additionally frequent residence in the dry dock.
  • Pests expressing ⁇ -Lacatamase acorn barnacles
  • Balanus or Pollicipes species increases the frictional drag of ships and, as a consequence, leads to a marked increase in operation costs owing to higher energy consumption and additionally frequent residence in the dry dock.
  • the invention is based, at least in part, on the discovery that when a pest, e.g., an arthopod, a nematode, an insect, or a parasite, ingests an enzyme-cleavable ⁇ -lactamase specific construct, the construct is cleaved by ⁇ -lactamases that are produced by the pest, resulting in the release of free photosensitizer within the insect. The pest then dies when exposed to light.
  • the pest is an animal that expresses ⁇ -lactamase.
  • the pest is an animal that expresses a ⁇ -lactamase comprising the protein domain sequence:
  • the pest expresses a ⁇ -lactamase comprising a protein domain of at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO: 1 or a fragment thereof.
  • the pest is an animal that expresses a ⁇ -lactamase comprising the protein domain sequence:
  • the pest expresses a ⁇ -lactamase comprising a protein domain of at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO: 2 or a fragment thereof.
  • the sequences are aligned for optimal comparison purposes (e.g. , gaps can be introduced in the sequence of a first protein sequence for optimal alignment with a second protein sequence).
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm.
  • a particular, non- limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Karlin and Altschul (1990) Proc. Natl. Acad. Sci. USA 87:2264-68, modified as in Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-77.
  • Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul et al. (1990) /. Mol. Biol. 215:403-10.
  • Gapped BLAST can be utilized as described in Altschul et al. (1997) Nucleic Acids Research 25(17):3389-3402.
  • the default parameters of the respective programs e.g. , XBLAST and NBLAST
  • the percent identity between two protein sequences can be determined using the GAP program in the GCG software package, using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 12, 10, 8, 6, or 4 and a length weight of 2, 3, or 4.
  • percent identity is determined at the polynucleotide level.
  • a ⁇ -lactamase polynucleotide is one that encodes a B -lactamase polypeptide.
  • a polynucleotide encoding a ⁇ -lactamase polypeptide are identified by hybridizing the polynucleotide sequence with a ⁇ -lactamase probe.
  • Hybridization conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, Ausubel et ah , eds., John Wiley & Sons, Inc. (1995), sections 2, 4 and 6. Additional stringent conditions can be found in Molecular Cloning: A Laboratory Manual, Sambrook et ah , Cold Spring Harbor Press, Cold Spring Harbor, NY (1989), chapters 7, 9 and 11.
  • a particular, non- limiting example of stringent hybridization conditions includes hybridization in 4X sodium chloride/sodium citrate (SSC), at about 65-70°C (or hybridization in 4X SSC plus 50% formamide at about 42-50°C) followed by one or more washes in IX SSC, at about 65-70°C.
  • a particular, non-limiting example of highly stringent hybridization conditions includes hybridization in IX SSC, at about 65-70°C (or hybridization in IX SSC plus 50% formamide at about 42-50°C) followed by one or more washes in 0.3X SSC, at about 65-70°C.
  • a particular, non-limiting example of reduced stringency hybridization conditions includes hybridization in 4X SSC, at about 50-60°C (or alternatively hybridization in 6X SSC plus 50% formamide at about 40-45°C) followed by one or more washes in 2X SSC, at about 50-60°C. Ranges intermediate to the above-recited values, e.g. , at 65-70°C or at 42-50°C are also intended to be encompassed by the present invention.
  • SSPE (IX SSPE is 0.15 M NaCl, lOmM NaH 2 P0 4 , and 1.25 mM EDTA, pH 7.4) can be substituted for SSC (IX SSC is 0.15 M NaCl and 15 mM sodium citrate) in the hybridization and wash buffers; washes are performed for 15 minutes each after hybridization is complete.
  • additional reagents can be added to hybridization and/or wash buffers to decrease non-specific hybridization to membranes, for example, nitrocellulose or nylon membranes, including but not limited to blocking agents (e.g. , BSA or salmon or herring sperm carrier DNA), detergents (e.g.
  • the pesticidal compositions of the invention can be used as a mixture with other known active compounds, such as additional pesticide materials, fungicides, insecticides, acaricides, nematicides, bird repellents, plant nutrients and agents which improve soil structure, is also possible.
  • the pesticidal composition of the present invention may include attractants such as cockroach pheromones (e.g., sex attractants, aggregation pheromones) or food-based attractants (e.g.,
  • the pesticidal compositions of the invention can be used as a mixture with known acaricides, nematicides or insecticides.
  • Suitable Insecticides/ Acaricides/Nematicides include, but are not limited to, the following compounds:
  • chlorfenvinphos chlorfluazuron, chlormephos, chlorpyrifos, chlorpyrifos M, chlovaporthrin, chromafenozide, cis-resmethrin, cispermethrin, clocythrin, cloethocarb, clofentezine, clothianidine, cyanophos, cycloprene,
  • cycloprothrin cyfluthrin, cyhalothrin, cyhexatin, cypermethrin, cyromazine, deltamethrin, demeton M, demeton S, demeton-S-methyl, diafenthiuron, diazinon, dichlorvos, dicofol, diflubenzuron, dimethoate, dimethylvinphos, dinetofuran, diofenolan, disulfoton, docusat-sodium, dofenapyn, eflusilanate, emamectin, empenthrin, endosulfan, Entomopfthora spp., esfenvalerate, ethiofencarb, ethion, ethiprole, ethoprophos, etofenprox, etoxazole, etrimfos, fenamiphos
  • fenpyroximate fenthion, fenvalerate, fipronil, fluazinam, fluazuron, flubrocythrinate, flucycloxuron, flucythrinate, flufenoxuron, flumethrin, flupyrazofos, flutenzine, fluvalinate, fonophos, fosmethilan, fosthiazate, fubfenprox, furathiocarb, granulosis viruses, halofenozide, HCH, heptenophos, hexaflumuron, hexythiazox, hydroprene, imidacloprid, indoxacarb, isazofos, isofenphos, isoxathion, ivermectin, nuclear
  • polyhedrosis viruses lambda-cyhalothrin, lufenuron, malathion, mecarbam, metaldehyde, methamidophos, Metharhizium anisopliae, metharhizium flavoviride, methidathion, methiocarb, methoprene, methomyl,
  • methoxyfenozide metolcarb, metoxadiazone, mevinphos, milbemectin, milbemycin, monocrotophos, naled, nitenpyram, nithiazine, novaluron, omethoate, oxamyl, oxydemethon M, Paecilomyces fumosoroseus, parathion A, parathion M, permethrin, phenthoate, phorate, phosalone, phosmet, phosphamidon, phoxim, pirimicarb, pirimiphos A, pirimiphos M, profenofos, promecarb, propargite, propoxur, prothiofos, prothoate, pymetrozine, pyraclofos, pyresmethrin, pyrethrum, pyridaben, pyridathion, pyrimidifen,
  • pesticidal compositions of the invention with other known active compounds, such as herbicides, fertilizers and growth regulators, or safeners or semiochemicals.
  • a pesticidal composition according to the invention is followed by a sufficient period of time to allow accumulation thereof in the pest.
  • the ⁇ -lactamase cleavage site of the linker is cleaved by ⁇ -lactamase produced by the pest.
  • the photosensitizers are no longer quenched.
  • the photosensitizers can, subsequently, be activated by irradiation. This is accomplished by applying light of a suitable wavelength and intensity, for an effective length of time, so as to kill the pest.
  • irradiation refers to the use of light to induced a chemical reaction of a photosensitizer.
  • Photoactivating dosages depend on various factors, including the amount of the pesticide administered, the wavelength of the photoactivating light, the intensity of the photoactivating light, and the duration of illumination by the photoactivating light. Thus, the dose can be adjusted to a therapeutically effective dose by adjusting one or more of these factors. Such adjustments are within the level of ordinary skill in the art.
  • Irradiation of the appropriate wavelength for a given compound may be administered by a variety of methods. Methods for irradiation include, but are not limited to, the administration of laser, nonlaser, or broad band light. Irradiation can be produced by extracorporeal or intraarticular generation of light of the appropriate wavelength. Light used in the invention may be administered using any device capable of delivering the requisite power of light including, but not limited to, fiber optic instruments, arthroscopic instruments, or instruments that provide
  • transillumination Delivery of the light to a recessed, or otherwise inaccessible physiological location can be facilitated by flexible fiber optics (implicit in this statement is the idea that one can irradiate either a broad field, such as the lung or a lobe of the lung, or a narrow field where bacterial cells may have localized).
  • the source of the light needed to inactivate the pest can be an inexpensive diode laser or a non-coherent light source.
  • the photosensitizer compositions of the invention should be stable during the course of at least a single round of treatment by continued or pulsed irradiation, during which the photosensitizer within the composition would, preferably, be repeatedly excited to the energized state, undergoing multiple rounds of generation of singlet oxygen.
  • the suitable wavelength, or range of wavelengths will depend on the particular photosensitizer(s) used, and can range from about 350 nm to about 550 nm, from about 550 nm to about 650 nm, from about 650 nm to about 750 nm, from about 750 nm to about 850 nm and from about 850 nm to about 950 nm.
  • pests are illuminated with red light.
  • red and/or near infrared light best penetrates animal tissues
  • photosensitizers with strong absorbances in the range of about 600 nm to about 900 nm are optimal for PDT.
  • the wavelength of light is matched to the electronic absorption spectrum of the photosensitizer so that the photosensitizer absorbs photons and the desired photochemistry can occur.
  • Wavelength specificity for photoactivation generally depends on the molecular structure of the photosensitizer. Photoactivation can also occur with sub-ablative light doses. Determination of suitable wavelength, light intensity, and duration of illumination is within ordinary skill in the art.
  • the pest are illuminated with sunlight (i.e. solar radiation).
  • sunlight i.e. solar radiation
  • Such exposure can be direct, indirect, focussed or diffused.
  • the effective penetration depth, 5 eff of a given wavelength of light is a function of the optical properties of the tissue, such as absorption and scatter.
  • the fluence (light dose) in a tissue is related to the depth, d, as: e "d /5 eff .
  • the effective penetration depth is about 2 to 3 mm at 630 nm and increases to about 5 to 6 nm at longer wavelengths (about 700 to about 800 nm) (Svaasand and Ellingsen, (1983) Photochem Photobiol. 38:293-299). Altering the biologic interactions and physical characteristics of the photosensitizer can alter these values. In general, photosensitizers with longer absorbing wavelengths and higher molar absorption coefficients at these wavelengths are more effective photodynamic agents.
  • the light for photoactivation can be produced and delivered to the site of infestation by any suitable means known in the art.
  • Photoactivating light can be delivered to the site of infestation from a light source, such as a laser or optical fiber.
  • a light source such as a laser or optical fiber.
  • optical fiber devices that directly illuminate the site of infestation deliver the photoactivating light.
  • the light can be delivered by optical fibers threaded through small gauge hypodermic needles.
  • Light can be delivered by an appropriate intravascular catheter, such as those described in U.S. Patent Nos.
  • 6,246,901 and 6,096,289 which can contain an optical fiber.
  • Optical fibers can also be passed through arthroscopes.
  • light can be transmitted by
  • suitable light sources include broadband conventional light sources, broad arrays of light-emitting diodes (LEDs), and defocused laser beams.
  • Transillumination can be performed using a variety of devices.
  • the devices can utilize laser or non-laser sources, (e.g., lightboxes or convergent light beams).
  • the dosage of pesticidal composition, and light activating the photosensitizer composition is administered in an amount sufficient to produce a phototoxic species effective to kill the pest
  • Irradiation of the appropriate wavelength for a given compound may be administered by a variety of wavelengths. Methods for irradiation include, but are not limited to, the administration of laser, nonlaser, or broad band light. Irradiation can be produced by extracorporeal or intraarticular generation of light of the appropriate wavelength. Light used in the invention may be administered using any device capable of delivering the requisite power of light including, but not limited to, fiber optic instruments, arthroscopic instruments, or instruments that provide transillumination.
  • the wavelength and power of light can be adjusted according to standard methods known in the art to control the production of phototoxic species.
  • a fluorescent species is primarily produced from the photosensitizer and any reactive species produced has a negligible effect.
  • these conditions are easily adapted to bring about the production of a phototoxic species.
  • the photosensitizer is chlorin e 6
  • the light dose administered to produce a fluorescent species and an insubstantial reactive species is less than about 10 J/cm, preferably less than about 5 J/cm and more preferably less than about 1 J/cm. Determination of suitable wavelength, light intensity, and duration of illumination for any photosensitizer is within the level of ordinary skill in the art.
  • the administration of the compositions of the invention, followed by photoactivation does not kill the pest but instead results in the pest fluorescing.
  • the invention provides a method for detecting the presence of pests, the method comprising the steps of: contacting the pest with a photosensitizer composition of the invention; cleaving one or more moieties cleavable by a6-lactamase expressed by the pest to dequench the photosensitizer composition, light- activating the composition to produce a fluorescent species, thereby causing the pest to fluoresce and observing the fluorescence thereby detecting the presence of pests .
  • the administration of the pesticidal compositions of the invention, followed by photoactivation results in both the termination of the pest and the pest fluorescing.
  • the invention provides a method of eliminating and detecting a pest, the method comprising the steps of: contacting the pest with a photosensitizer composition of the invention; cleaving one or more moieties cleavable by the ⁇ -lactamase to dequench the photosensitizer composition and light- activating the composition to produce a fluorescent, phototoxic species, thereby eliminating the pest and causing the pest to fluoresce and observing the fluorescence thereby also detecting the presence of the pest.
  • the invention is additionally described by way of the following illustrative, non- limiting Examples that provide a better understanding of the present invention and of its many advantages.
  • the synthesis of the conjugates is based on cephalosporin, the most often used ⁇ -lactam. It is conceivable to develop penem or carbapenem derivatives subsequently.
  • the photosensitizer (a porphyrin molecule with at least one propionic side chain) is represented by PS-CH 2 -CH 2 -COOH.
  • the polymer used in the synthetic routes shown below is a linear or branched poly(ethylene glycol) with propionic acid groups (PEG-CH 2 -CH 2 -COOH) (Senter, P.D., et al. (1995) Bioconjug. Chem. 6:389-394).
  • the chemistry is applicable to similar polymeric materials containing available carboxylic side chains.
  • the porphyrin molecule is preferably linked at the 3'-position of the cephalosporin. The cephalosporin-porphyrin moiety obtained can then be conjugated to the polymer using the amino group on the ⁇ -lactam ring.
  • cephalosporin-prophyrin ester The preparation of a cephalosporin-prophyrin ester comprises the following steps:
  • cephalothin the following molecule (which comes with a protected amino group) is called cephalothin.
  • cephalosporin-porphyrin carbamate The preparation of a cephalosporin-porphyrin carbamate comprises the following steps:
  • cephalosporin derivatives described above retain their properties as substrates for ⁇ -lactamases, one can expect to observe the enzyme-dependent release of three different porphyrin moieties:
  • the lactam ring opening of the prodrugs releases the photosensitizer and make it light-activatable for photokilling ( Figure 1).
  • tetrabutylammonium hydroxide (30% solution in water, 1.53 g, 1.92 mmol) was added at -18°C in 30 minutes.
  • the reaction mixture was maintained at -18°C for nearly 7.0 h and acidified to pH 5.0 using glacial acetic acid. Purification was done using C-18 reverse phase column and pure product was obtained as white solid in 67% yield.
  • UV- visible spectra revealed blue shift in the absorption spectra of the prodrug, indicating extended conjugation, as well as quenching, of carbamate linked TBO photosensitizer (Figure 4).
  • Fluorescence spectra revealed nearly an 8-fold reduction in fluorescence emission maxima at 635 nm excitation, indicating quantitative quenching of the photosensitizer upon conjugation with the cephalosporin moiety (Figure 5).
  • Brugia malayi adults and 1st stage larvae activate the ⁇ -LEAP photosensitizer-containing construct by cleavage of the cephalosporin moiety.
  • Negative controls included reactions lacking worms and reactions lacking ⁇ - LEAP.
  • Data was collected by a SpectraMax fluorimeter every minute over a 3 hour period with excitation set at 650 nm and emission at 700 nm. Increasing relative fluorescence resulting from activation of ⁇ -LEAP by enzymatic cleavage over the first hour of data collection is shown.
  • Worms recovered from the assay described above were fixed, incubated with RNase and then their nucleic acids stained with propidium iodide. Samples were mounted on glass slides in mounting medium containing DAPI (also stains DNA). Images were acquired using an Olympus FV1000 confocal laser scanning microscope. Images of adult worms are at the region of the reproductive tissue. All images are at 100X magnification and a 50 ⁇ scale bar is provided for reference. The widespread red coloration indicates fluorescence released from ⁇ -LEAP, Blue is fluorescence from DAPI and green is fluorescence from propidium iodide.
  • a female worm recovered from the assay described above was fixed, incubated with RNase and then it' s nucleic acids stained with propidium iodide.
  • the worm was mounted on a glass slide in mounting medium containing DAPI (also stains DNA).
  • the images were acquired using an Olympus FV1000 confocal laser scanning microscope. Images are at the region of the reproductive tissue and reveal the intestine. Panel A 20X magnification; Panel B 100X magnification.
  • the widespread red coloration indicates fluorescence released from ⁇ -LEAP, Blue is fluorescence from DAPI and green is fluorescence from propidium iodide.
  • Aedes albopictus cells activate the ⁇ -LEAP photosensitizer-containing construct by cleavage of the cephalosporin moiety.
  • Figure 11 The Aedes albopictus cell line C6/36 was grown to high density in tissue culture flasks and then 1,000,000 cells were transferred to each of 3 wells of a 96 well microtiter plate and incubated with 10 ⁇ ⁇ -LEAP. Positive control was commercially available Bacillus cereus ⁇ -lactamase (0.25 U/ml). Negative controls included reactions lacking cells and reactions lacking ⁇ -LEAP. Data was collected by a SpectraMax fluorimeter every minutre over a 3 hour period with excitation set at 650 nm and emission at 700 nm. Increasing relative fluorescence units (RFU) resulting from activation of ⁇ -LEAP by enzymatic cleavage over the first hour of data collection is shown.
  • Example 5 The Aedes albopictus cell line C6/36 was grown to high
  • Field soil is packed in 350 cm 2 plastic pots and seedlings of corn, wheat, sorghum, soybean, and tobacco are sown and covered with soil of about 1 cm thickness.
  • ⁇ -LEAP pellets are spread or a ⁇ - LEAP flowable formulation is diluted with a stock solution or water were sprayed uniformly in a spray volume of 200 ml per m 2 .
  • the test is performed in a glass greenhouse box at a temperature of from 18 to 30°C, and the soil is appropriately moistened from the bottom side.
  • Pests common to each type of plant are introduced into the respective greenhouse box and allowed to ingest the ⁇ -LEAP. After 1 hour, the greenhouse boxes are exposed to sunlight or red LED lighting.

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Pest Control & Pesticides (AREA)
  • Plant Pathology (AREA)
  • Engineering & Computer Science (AREA)
  • Dentistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Environmental Sciences (AREA)
  • Agronomy & Crop Science (AREA)
  • Immunology (AREA)
  • Physics & Mathematics (AREA)
  • Toxicology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Optics & Photonics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Agricultural Chemicals And Associated Chemicals (AREA)

Description

TITLE OF THE INVENTION β-LACTAMASE TARGETED PHOTOSENSITIZER FOR PESTICIDE AND PEST DETECTION
CROSS-REFERENCE TO RELATED APPLICATION
This application claims the benefit of U.S. Provisional Application No.: 61/663,410, filed on June 22, 2012, the entire contents of which are incorporated herein by reference.
RELATED DISCLOSURES
The subject matter disclosed in this application may be related to the subject matter disclosed in U.S. patent application publication no. US 2010-0016208 Al, published on January 21, 2010, and U.S. patent application publication no. US 2011- 0112059 Al, published on May 12, 2011, each of which is hereby expressly incorporated herein in its entirety by reference.
INCORPORATION BY REFERENCE
Each of the applications and patents cited in this text, as well as each document or reference cited in each of the applications and patents (including during the prosecution of each issued patent; "application cited documents"), and each of the PCT and foreign applications or patents corresponding to and/or paragraphing priority from any of these applications and patents, and each of the documents cited or referenced in each of the application cited documents, are hereby expressly incorporated herein in their entireties by reference. More generally, documents or references are cited in this text, either in a Reference List before the paragraphs, or in the text itself; and, each of these documents or references ("herein-cited references"), as well as each document or reference cited in each of the herein-cited references (including any manufacturer's specifications, instructions, etc.), are hereby expressly incorporated herein in their entireties by reference. BACKGROUND OF THE INVENTION
Human filariasis is a major global health problem. The diseases are caused by infections with parasitic filarial nematode worms leading_two related disorders. The nematode species responsible for_human lymphatic filariasis (LF) are
Wuchereria bancrofti, Brugia malayi and to a less extent, B. timori, while human onchocerciasis is_caused by the related filarial nematode, Onchocerca volvulus.
Onchocerciasis is cutaneous, wherein adult worms reside in palpable fibrous nodules, which are a result of inflammation to dead microfilaria (the Fl generation released by adult females after mating). One other aspect of the malady is blindness caused by microfilaria migration and invasion of the cornea, keratitis, retinal lesions and degeneration of the optic nerve. Lymphatic filariasis, on the other hand, is a disease associated with dysfunction of lymphatic tissue and lymphodema, leading to a disease state known as elephantiasis, including hydrocoele.
More than 150 million individuals in 80 countries are infected with parasitic filarial nematode worms responsible for lymphatic filariasis (LF) and onchocerciasis (river blindness), with an estimated 1 billion people at risk of infection, ranking filariasis as one of the major causes of global morbidity .
The life cycle of these parasites requires an arthropod vector; LF is transmitted by both anopheline and culicine mosquitoes whereas O. volvulus is transmitted by blackflies (Simulium species) (Blacklock, 1926; Mullen and Durden, 2009). Adult worms can live for 10 years or more and the microfilaria released into the blood are picked up by the insect vector during a blood meal, undergo several molts and then are delivered to the human host in a subsequent insect bite wound. The infective larvae undergo several molts and develop into male or female adults, mate and give rise to the microfilaria to continue life cycle. There are several challenges associated with attempts to eliminate filariasis: (1.) there are no macrofiliaricidal (adulticide) drugs available. Control programs rely on sustained delivery of antiparasitic drugs, such as DEC (diethylcarbamazine), albendazole, and ivermectin, which have been the mainline drugs of choice for filariasis control. However, these drugs are not effective adulticides and repeated community- wide doses (as part of MDA, mass drug administration) are required to suppress microfilarial production and reduce transmission. Likewise, Over time insects have become both more numerous and more destructive to plants, both agriculturally and domestically. A host of small insects attack grasses and forage crops, many of them being so small that they are unnoticed though their aggregate injury is enormous. Larger pests, such as worms, grubs, grasshoppers, flies, boll weevils, bollworms, and ticks are equally dangerous to plant life. In total, the damage to crops and other plants from insect attack represents losses of billions of dollars annually.
Photosensitizers (PS) are light-sensitive compounds which undergo a photochemical reaction after the absorption of light quantum. Such photodynamic compounds have been successfully used for antibacterial photodynamic therapies acting throughout the body. A strength of such photodynamic therapy (PDT) is the broad range of targets hit by the reactive molecular species it produces. Targeting the photoreactivity of PSs through catalysis by parasite-specific enzymes maintains this advantage. Still, the current state of PDT has focused on the targeting of parasite-specific enzymes within the human body.
As such, photodynamic compounds having improved specificity for athropod, nematode, insect and parasite- specific enzymes capable of targeting and killing an insect (or other unwanted organism that produces an enzyme capable of hydrolyzing the construct) such as mosquitoes, biting flies, fruit flies, sand flies, barnacles, Crustacea, and cockroaches, outside of the human body, would be desirable.
SUMMARY OF THE INVENTION
The invention provides, inter alia, novel methods to control and/or kill arthropods, nematodes, insects and parasites in plant and animal (e.g., human) hosts via the targeted release of free photosensitizer from a quenched to an unquenched and active state by β-lactamases that are produced by the insect. The invention is based, at least in part, on the discovery that when a pest, e.g., an insect, ingests an enzyme-cleavable β-lactamase specific construct, the construct is cleaved by β- lactamases that are produced by the insect, resulting in the release of free photosensitizer within the insect. When the insect is then exposed to light, the free photosensitizer is converted to a phototoxic species that kills the insect. In certain advantageous embodiments, the insect also fluoresces as a result of the cleavage allowing for insect detection via fluorescence emission.
Thus, in one aspect, the invention provides a pesticidal composition comprising a pesticidally effective amount of one or more photosensitizers that are linked by one or more moieties cleavable by β-lactamase, wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light-activation..
In yet another aspect, the invention provides a pesticidal composition comprising pesticidally effective amount of one or more photosensitizers and one or more binders effective to quench photoactivation, wherein the photosensitizers are connected to the binder through one or more moieties cleavable by a β-lactamase expressed by a pest and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light-activation.. In a further embodiment, the binder is a fluorophore.
In yet another aspect, the invention provides a pesticidal composition comprising a backbone coupled to one or more photosensitizers and one or more binders effective to quench photoactivation, wherein the binders are connected to the backbone through one or more moieties cleavable by a β-lactamase expressed by a pest and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light- activation..
In yet another aspect, the invention provides a pesticidal composition comprising a backbone coupled to a plurality of photosensitizers and one or more binders effective to quench photoactivation, wherein the photosensitizers are connected to the backbone through one or more moieties cleavable by β-lactamase.
In accordance with the invention, the pest is an animal that expresses β- lactamase. In particular embodiments, the pest is an animal that expresses a β - lactamase comrpising the protein domain sequence:
ILTEKRKILVDCGDPWNGTQIIQALSKYSLNCDDITDLIITHGHSDHCGNLSLF QQAKIYMGDDMAKDGIYEGIWTLDDFVKIRPTPGHTDRSIIVLDTEYGTVAI VGDIFEEENDDDSWKENSKYPEEQQKSRKIILKEADWIIPGH (SEQ ID NO: 1) (GenBANK protein sequence XP_001891895) or a fragment thereof.
In certain embodiments, the pest expresses a β -lactamase comprising a protein domain sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO:l or a fragment thereof.
In still other embodiments, the pest is an animal that expresses a β -lactamase comrpising the protein domain sequence:
TNTYIIGTGKRRILLDAGDENVPEYIGHLKKVISDERILINDIIVSHWHHDHIG GVDEVLDIIENKDSCKVWKFPRADAPDGTIRNANINHLKHGQKFNIEGATLE VLHTPGHTTDHVVLVLHEDNSLFSADCILGEGSTVFEDLYEYTKSLQAIQDA KPSVIYPG (SEQ ID NO: 2) (GenBANK protein sequence XP_001656361) or a fragment thereof.
In certain embodiments, the pest expresses a β -lactamase comprising a protein domain sequence having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO:2 or a fragment thereof.
In certain embodiments, the host is an animal, e.g., human.
In other embodiments the host is a plant. Plants in accordance with the invention include, but are not limited to corn, maize, wheat, tobacco, cotton, rice, soybean, peanut, sugarcane, hay, sorghum, lettuces, kales, cabbages, fruit trees, or horitcultural flowers.
In embodiment embodiments, the pests targeted in plants include, but are not limited to, nematodes, grubs, weevils, borers, aphids, moths, mosquitoes, flies, ticks, termites, beetles, caterpillar, cutworms, earworms, armyworms, or budworms.
In certain embodiments, the photosensitizer is a porphyrin. The porphyrin can be, but is not limited to, a porfimer sodium, hematoporphyrin IX,
hematoporphyrin ester, dihematoporphyrin ester, synthetic diporphyrin, O- substituted tetraphenyl porphyrin, 3,1-meso tetrakis porphyrin, hydroporphyrin, benzoporphyrin derivative, benzoporphyrin monoacid derivative, monoacid ring derivative, tetracyanoethylene adduct of benzoporphyrin, dimethyl
acetylenedicarboxylate adduct of benzoporphyrin, δ-aminolevulinic acid, benzonaphthoporphyrazine, naturally occurring porphyrin, ALA-induced protoporphyrin IX, synthetic dichlorin, bacteriochlorin tetra(hydroxyphenyl) porphyrin, purpurin, octaethylpurpurin derivative, etiopurpurin, tin-etio-purpurin, porphycene, chlorin, chlorin e6, mono-l-aspartyl derivative of chlorin e6, di-1- aspartyl derivative of chlorin e6, tin(IV) chlorin e6, meta-tetrahydroxyphenylchlorin, chlorin e6 monoethylendiamine monamide, verdin, zinc methyl pyroverdin, copro II verdin trimethyl ester, deuteroverdin methyl ester, pheophorbide derivative, pyropheophorbide, texaphyrin, lutetium (III) texaphyrin, or gadolinium(III) texaphyrin.
In other embodiments, the photosensitizer is a photoactive dye. The photoactive dye includes, but is not limited to, a merocyanine, phthalocyanine, chloroaluminum phthalocyanine, sulfonated aluminum PC, ring-substituted cationic PC, sulfonated AlPc, disulfonated or tetrasulfonated derivative, sulfonated aluminum naphthalocyanine, naphthalocyanine, tetracyanoethylene adduct, crystal violet, azure β chloride, benzophenothiazinium, benzophenothiazinium chloride (EtNBS), phenothiazine derivative, phenothiaziniums such as rose Bengal, toluidine blue derivatives, toluidine blue O (TBO), methylene blue (MB), new methylene blue N (NMMB), new methylene blue BB, new methylene blue FR, 1,9- dimethylmethylene blue chloride (DMMB), methylene blue derivatives, methylene green, methylene violet Bernthsen, methylene violet 3RAX, Nile blue, Nile blue derivatives, malachite green, Azure blue A, Azure blue B, Azure blue C, safranine O, neutral red, 5-ethylamino-9-diethylaminobenzo[a]phenothiazinium chloride, 5- ethylamino-9-diethylaminobenzo[a]phenoselenazinium chloride, thiopyronine, or thionine.
In still other embodiments, the photosensitizer includes, but is not limited to, a Diels-Alder adduct, dimethyl acetylene dicarboxylate adduct, anthracenedione, anthrapyrazole, aminoanthraquinone, phenoxazine dye, chalcogenapyrylium dye, cationic selena, tellurapyrylium derivative, cationic imminium salt, or tetracycline.
In yet another embodiment, the photosensitizer composition comprises a plurality of the same photosensitizer. In one embodiment, the moiety cleavable by β-lactamase of the
photosensitizer composition comprises a cephalosporin, a penicillin, a penem, a carbapenem, a monocyclic monobactem, or a fragment thereof. In a further embodiment, the moiety cleavable by β-lactamase of the photosensitizer composition comprises a cephalosporin, a penicillin, or a fragment thereof. The cephalosporin or penicillin fragment can comprise a beta- lactam ring, and the enzyme cleavage site can be cleaved by a lactamase. In another embodiment, the moiety cleavable by β-lactamase is a cephalosporin. At least one photosensitizer can be bound at the 3' position of the cephalosporin.
In yet another embodiment, a binder is present and connected to the photosensitizer by one or more moieties cleavable by β-lactamase. In specific embodiments, binder can be a fluorophore or an other photosensitizer.
In yet another aspect, the invention provides a pharmaceutical composition comprising a pesticidally effective amount of a photosensitizer composition of the invention and a pharmaceutically acceptable excipient or carrier.
In yet another aspect, the invention provides a method of eliminating a pest from a host, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more
photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein the one or more moieties cleavable by the β- lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby eliminating the pest from the host.
In certain embodiments, phototoxic species is also flourescent.
In other embodiments, the pest is an arthropod, a nematode or an insect and the host is a plant. In some embodiments, the pest is selected from the group consisting of nematodes, grubs, weevils, borers, aphids, moths, mosquitoes, flies, ticks, termites, beetles, caterpillar, cutworms, earworms, armyworms, and budworms. In other embodiments, the plant is selected from the group consisting of corn, maize, wheat, tobacco, cotton, rice, soybean, peanut, sugarcane, hay, sorghum, lettuces, kales, cabbages, fruit trees, and horitcultural flowers.
In still other embodiments, the pest is a parasite and the host is an animal or human. In some embodiments, the parasite is selected from the group consisting of ticks, lice, mites, ascarids, filarias, hookworms, pinworms, whipworms, strongyles, Trichinella spiralis, Dirofilaria immitis, Haemonchus contortus, Brugia malayi and Myrmeconema neotropicum.
In another aspect, the invention provides a method for eliminating a pest from an industrial material, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein the one or more moieties cleavable by the β- lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby eliminating the pest from said host.
In certain embodiments, the pest is selected from the group consisting of beetles, termites, and hymenopterons.
In other embodiments, the industrial material is selected from the group consisting of plastics, adhesives, sizes, paper and card, leather, wood and processed wood products.
In another aspect, the invention provides a method for eliminating a pest from an enclosed space, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more
photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein the one or more moieties cleavable by the β- lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby eliminating the pest from said space.
In some embodiments, the pest is selected from the group consisting of scorpions, spiders, woodlice, pillbugs, bedbugs, millipedes, centipedes, caterpillars, moths, silverfish, cockroaches, grasshoppers, locusts, flies and mosquitoes.
In another aspect, the invention providesa method for detecting a pest, said method comprising the steps of: contacting the pest with a quenched photosensitizer composition comprising a plurality of photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein said linked photosensitizers are present in an amount sufficient to quench photoactivation of said photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition; and light- activating the composition to produce a fluorescent species, and detecting the pest by observing the fluorescence, thereby detecting the presence of the pest.
In some embodiments, the florescent species is also phototoxic.
In another aspect, the invention providesa method for controlling an insect pest, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein the one or more moieties cleavable by the β-lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light- activating the composition to produce a phototoxic species, thereby controlling said insect pest.
In certain embodiments, the insect is Aedes albopictus.
In another aspect, the invention providesa method for controlling a filarial nematode, the method comprising the steps of: contacting the worm with an effective amount of a pesticidal composition comprising one or more
photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein the one or more moieties cleavable by the β- lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light-activating the composition to produce a phototoxic species, thereby controlling said worm.
In certain embodiments, the filarial nematode is Wuchereria bancrofti, Brugia malayi, or B. timori.
In another aspect, the invention providesa method for ameliorating filariasis in a subject, the method comprising the steps of: administering to the subject an effective amount of a composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein the one or more moieties cleavable by the β-lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light- activating the composition to produce a phototoxic species, thereby ameliorating filariasis.
In some embodiments, the filariasis is associated with Wuchereria bancrofti,
Brugia malayi, and/or B. timori.
In certain embodiments, the method reduces the filarial load in the subject by at least about 10-25% or more.
In another aspect, the invention provides a method for controlling a fouling pest on an object in contact with saltwater or brackish water, the method comprising the steps of: contacting the pest with an effective amount of a pesticidal composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein the one or more moieties cleavable by the β-lactamase comprises an enzyme cleavage site for an enzyme of a pathogen, and optionally one or more binders, and wherein the linked
photosensitizers are present in an amount sufficient to quench photoactivation of the photosensitizers; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light- activating the composition to produce a phototoxic species, thereby controlling the pest.
In certain embodiments, the fouling pest is a goose barnacle, an acorn barnacle or a sessile Oligochaeta.
Methods of the invention may further comprise the step of obtaining the photosensitizer composition, linker or binder.
The light- activation in the methods of the invention may be from exposure to sunlight, administration of LED lighting, or administration of laser lighting.
In yet another aspect, the invention provides a kit for eliminating a pest the comprising a pesticidal composition of the invention and instructions for using the pesticidal composition to eliminate the pest in accordance with the methods of the invention.
In yet another aspect, the invention provides a kit for detecting a pest the a photosensitizer composition comprising one or more photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein said linked moieties are present in an amount sufficient to quench photoactivation of said photosensitizers and wherein said one or more photosenitizers are capable of generating a fluorescent species upon dequenching and light-activation, and instructions for using the photosensitizer composition to detect the pest.
Other aspects of the invention are described in the following disclosure, and are within the ambit of the invention.
BRIEF DESCRIPTION OF THE FIGURES
Various advantageous features and embodiments of the present invention are described below with reference to the accompanying drawings in which:
Figure 1 schematically depicts the development of a carbamate-linked photosensitizer (PS) that is inactive (with or without light) while linked and is light- activatable only when released by the β-lactamase enzyme-mediated cleavage.
Figure 2a shows 'Ft NMR spectra obtained for 7-[(2-phenylacetyl)amino] cephalosporanic acid in CDC13 as a solvent. Figure 2b shows 'Ft NMR spectrum obtained for 7-[(2-phenylacetyl)amino] 3 -hydrodxymethy cephalosporanic acid in DMSO-d6 as a solvent. Major proton peaks are marked on the spectra.
Figure 3 shows MS spectra obtained for (a) 7-[(2-phenylacetyl)amino] 3- hydrodxymethy cephalosporanic acid; and (b) cephalosporanic acid-toluidine blue O prodrug.
Figure 4 shows UV- visible spectra obtained for the photosensitizer (TBO) (black line) vs. the Cephalosporanic acid-photosensitizer prodrug (red line) in ethanol at a concentration of 2.0 xl0-5 M.
Figure 5 shows fluorescence emission spectra obtained for the
photosensitizer (TBO) (black line) vs. the Cephalosporanic acid-photosensitizer prodrug (red line) in ethanol at 635 nm excitation.
Figure 6 shows plots of (a) fluorescence emission vs. wavelength and (b) flurorescence emission vs. time for the Cephalosporanic acid-photosensitizer prodrug, depicting the enzyme-mediated cleavage of the prodrug.
Figure 7 shows the synthesis of β-LEAP
Figure 8 shows the increasing relative fluorescence resulting from activation of β-LEAP by enzymatic cleavage in Brugia malayi adults and 1st stage larvae (microfilariae).
Figure 9 shows a confocal laser scanning micrograph of Brugia malayi adults and 1st stage larvae following exposure to β -LEAP and 650 nm light.
Figure 10 shows a confocal laser scanning microscopy of an adult Brugia malayi female following exposure to β -LEAP and 650 nm light.
Figure 11 shows the effects of photodynamic therapy with the
photosensitizer EtNBS to kill adult Brugia malayi.
Figure 12 shows the increasing relative fluorescence resulting from activation of β-LEAP by enzymatic cleavage in Aedes albopictus cells.
DETAILED DESCRIPTION OF THE INVENTION
The following Detailed Description, given by way of example, but not intended to limit the invention to specific embodiments described, may be understood in conjunction with the foregoing drawings and the following non- limiting definitions that are given by way of example to facilitate understanding of the invention.
I. Definitions
The term "photosensitizer" refers to a photoactivatable compound, or a biological precursor thereof, that produces a reactive species (e.g., oxygen) having a photochemical (e.g., cross linking) or phototoxic effect on a cell, cellular component or biomolecule. As used herein, a photosensitizer refers to a substance which, upon irradiation with electromagnetic energy of the appropriate wavelength (e.g., light), produces a cytotoxic effect.
As used herein, the term "fluorescent dye" refers to dyes that are fluorescent when illuminated with light but do not produce reactive species that are phototoxic or otherwise capable of reacting with biomolecules. A photosensitizer will fluoresce when illuminated with a certain wavelength and power of light and also produce reactive species that is phototoxic under the same or different wavelength and power of light. The term "photoactive dye," as used herein, means that the illuminated photosensitizer produces a fluorescent species, but not necessarily a reactive species in phototoxic amounts (i.e., a phototoxic species). Depending on the wavelength and power of light administered, a photosensitizer can be activated to fluoresce and, therefore, act as a photoactive dye, but not produce a phototoxic species. The wavelength and power of light can be adapted by methods known to those skilled in the art to bring about a phototoxic effect where desired.
As used herein, the term "backbone" refers to an agent that functions to couple one or more components of a photosensitizer composition of the invention, such as, for example, a polyamino acid or like agent that is linked to one or more photosensitizers and/or one or more binders and/or one or more targeting moieties The backbone itself additionally can be a targeting moiety, e.g. polylysine. A "backbone" as used herein is as a moiety higher in molecular weight and capable of loading more photoactive molecules than a "linker". Backbone can be a polymeric structure which provides a base to add multiple units (more than three). Examples of backbones that can be used according to the invention, include, but are not limited to polyethylene glycol and polyproline. As used herein, the term "linker" or "moiety cleavable by β-lactamase" refers to an agent capable of linking two components of the photosensitizer composition together (e.g., a photosensitizer to another photosensitizer, a photosensitizer to a binder, a photosensitizer to a backbone, or a binder to a backbone).
As used herein, the term "binder" refers to an agent that absorbs energy from an adjacent, activated photosensitizer or otherwise inactivates the photosensitizer, and, thus, quenches the photosensitizer.
The term "nucleic acid" is intended to include nucleic acid molecules, e.g. , polynucleotides which include an open reading frame encoding a polypeptide, and can further include non-coding regulatory sequences, and introns. In addition, the terms are intended to include one or more genes that map to a functional locus. In addition, the terms are intended to include a specific gene for a selected purpose.
Accordingly, the term is intended to include any gene encoding a β-lactamase.
As used herein, the terms "peptide", "polypeptide", and "protein" are, unless specified otherwise, used interchangeably. Peptides, polypeptides, and proteins used in methods and compositions described herein can be recombinant, purified from natural sources, or chemically synthesized. For example, reference to the use of a bacterial protein or a protein from bacteria, includes the use of recombinantly produced molecules, molecules purified from natural sources, or chemically synthesized molecules.
The term "plurality" refers to at least two, preferably at least about 10 and even more preferably, at least about 20 or more photosensitizer or binder molecules present in a composition of the invention.
The term "host" is used herein to include both living hosts and non- living/inanimate hosts. Examples of living hosts include plants and animals, e.g., humans. Non-living/inanimate hosts include industrial sites, public areas, and man- made surfaces including household surfaces (kitchen surfaces, floors, walls, ceilings, etc.), patios and the like.
The term "animal" is used herein to refer to a living animal, including a human, that carries an unwanted organism, the unwanted organism being the target of the methods described herein.
The term "plant" is used herein to refer to any plant including, but not limited to agricultural crops, fruit trees, nut trees, domestic crops, and flowers. Such plants and crops include, but are not limited to, corn, maize, wheat, tobacco, cotton, rice, soybean, peanut, sugarcane, hay, sorghum, lettuces, kales, cabbages, apples, oranges, pears, pumpkins, tomatoes, fruit trees, or horitcultural flowers.
As used herein, "pest" or "target organism" means an animal, e.g., insect, parasite or otherwise, that expresses a β -lactamase capable of cleaving the moieties which bind the photosensitizers in the compositions of the inventions. Such pests include any pest that adversely impacts on the health and productivity of plants or other animals, or compromises the integrity of an industrial material or dwelling. Specific pests include, but are not limited to, nematodes, grubs, weevils, borers, aphids, moths, mosquitoes, flies, ticks, termites, beetles, caterpillar, cutworms, earworms, armyworms, or budworms. In one embodiment, the mosquito is Ades albopictus.
As used herein, the term "parasite" includes an animal organism that lives in or on another and takes its nourishment from that other organism. Parasites in accordance with the invention include, e.g., protozoa, nematodes, helminths and arthropods. Parasites in accordance with the invention further include symbiotic animal organisms. In one embodiment, the parasite is Brugia malayi. Methods of the invention include controlling or eliminating Brugia malayi from a human or insect host (e.g., Aedes albopictus).
As used herein, the term "pesticidally effective amount" refers to that amount of a photosensitizer composition that, when administered to or ingested by a pest, is sufficient to eliminate, terminate or otherwise control the pest. Thus, e.g., a pesticidally effective amount of a photosensitizer composition as described herein is a quantity sufficient to result in the death of a pest so that the adverse effects of the pest are reduced or alleviated. In one embodiment, a composition of the invention comprises an effective amount of a prodrug construct with a photosensitizer and a quencher linked by a beta-lactam ring, resulting in a diminished phototoxicity. This construct is refered to as beta-lactamase enzyme-activated-photosexisitizer CP- LEAP). The synthesis of β-LEAP is provided at Figure 7.
As used herein, the term "control" is meant reducing the survival, proliferation, or reproduction of a pest. Such reduction may be by at least about 10%, 25%, 50%, 75% or more. In one embodimen, a composition of the invention ameliorates or controls a parasite infestation (for example, as in filariasis) by reducing the parasitic load in a subject by at least about 5, 10, 50, 75 or 100%.
As used herein, a "peptide antibiotic" is a linear or cyclic oligopeptide, or an active fragment, or analog thereof, which possesses antibiotic activity against bacterial or fungal species, and which is synthesized enzymatic ally on a multi- protein complex to which it is attached by a thioether bond. A peptide antibiotic may include non-ribosomal amino acids such as D amino acids, and may include non-amino acid residues such as esters of lactic acid or valeric acid.
The term "obtaining" as in "obtaining" the "photosensitizer composition," "linker" or "binder," is intended to include purchasing, synthesizing or otherwise acquiring the elements of the invention.
In this disclosure, "comprises," "comprising," "containing" and "having" and the like can have the meaning ascribed to them in U.S. Patent law and can mean " includes," "including," and the like; "consisting essentially of" or "consists essentially" likewise has the meaning ascribed in U.S. Patent law and the term is open-ended, allowing for the presence of more than that which is recited so long as basic or novel characteristics of that which is recited is not changed by the presence of more than that which is recited, but excludes prior art embodiments.
Other definitions appear in context throughout this disclosure.
II. Compositions of the Invention
A. Photosensitizers
Photosensitizers known in the art are typically selected for use according to: 1) efficacy in delivery, 2) proper localization in target tissues, 3) wavelengths of absorbance, 4) proper excitatory wavelength, 5) purity, and 6) in vivo effects on pharmacokinetics, metabolism, and reduced toxicity.
A photosensitizer for clinical use is optimally amphiphilic, meaning that it shares the opposing properties of being water-soluble, yet hydrophobic. The photosensitizer should be water-soluble in order to pass through the bloodstream systemically, however it should also be hydrophobic enough to pass across cell membranes. Modifications, such as attaching polar residues (amino acids, sugars, and nucleosides) to the hydrophobic porphyrin ring, can alter polarity and partition coefficients to desired levels. Such methods of modification are well known in the art.
In specific embodiments, photosensitizers of the present invention absorb light at a relatively long wavelength, thereby absorbing at low energy. Low-energy light can travel further through tissue than high-energy light, which becomes scattered. Optimal tissue penetration by light occurs between about 650 and about 800 nm. Porphyrins found in red blood cells typically absorb at about 630 nm, and new, modified porphyrins have optical spectra that have been "red-shifted", in other words, absorbs lower energy light. Other naturally occurring compounds have optical spectra that is red-shifted with respect to porphyrin, such as chlorins found in chlorophyll (about 640 to about 670 nm) or bacteriochlorins found in photosynthetic bacteria (about 750 to about 820 nm).
Photosensitizers of the invention can be any known in the art, and optionally coupled to molecular carriers.
i) Porphyrins and Hydroporphyrins
Porphyrins and hydroporphyrins can include, but are not limited to,
Photofrin® RTM (porfimer sodium), hematoporphyrin IX, hematoporphyrin esters, dihematoporphyrin ester, synthetic diporphyrins, O-substituted tetraphenyl porphyrins (picket fence porphyrins), 3,1-meso tetrakis (o-propionamido phenyl) porphyrin, hydroporphyrins, benzoporphyrin derivatives, benzoporphyrin monoacid derivatives (BPD-MA), monoacid ring "a" derivatives, tetracyanoethylene adducts of benzoporphyrin, dimethyl acetylenedicarboxylate adducts of benzoporphyrin, endogenous metabolic precursors, δ-aminolevulinic acid,
benzonaphthoporphyrazines, naturally occurring porphyrins, ALA-induced protoporphyrin IX, synthetic dichlorins, bacteriochlorins of the tetra(hydroxyphenyl) porphyrin series, purpurins, tin and zinc derivatives of octaethylpurpurin, etiopurpurin, tin-etio-purpurin, porphycenes, chlorins, chlorin e6, mono-l-aspartyl derivative of chlorin e6, di-l-aspartyl derivative of chlorin e6, tin(IV) chlorin e6, meta-tetrahydroxyphenylchlorin, chlorin e6 monoethylendiamine monamide, verdins such as, but not limited to zinc methyl pyroverdin (ZNMPV), copro II verdin trimethyl ester (CVTME) and deuteroverdin methyl ester (DVME), pheophorbide derivatives, and pyropheophorbide compounds, texaphyrins with or without substituted lanthanides or metals, lutetium (III) texaphyrin, and gadolinium(III) texaphyrin.
Porphyrins, hydroporphyrins, benzoporphyrins, and derivatives are all related in structure to hematoporphyrin, a molecule that is a biosynthetic precursor of heme, which is the primary constituent of hemoglobin, found in erythrocytes. First-generation and naturally occurring porphyrins are excited at about 630 nm and have an overall low fluorescent quantum yield and low efficiency in generating reactive oxygen species. Light at about 630 nm can only penetrate tissues to a depth of about 3 mm, however there are derivatives that have been 'red-shifted' to absorb at longer wavelengths, such as the benzoporphyrins BPD-MA (Verteporfin). Thus, these 'red-shifted' derivatives show less collateral toxicity compared to first- generation porphyrins.
Chlorins and bacteriochlorins are also porphyrin derivatives, however these have the unique property of hydrogenated exo-pyrrole double bonds on the porphyrin ring backbone, allowing for absorption at wavelengths greater than about 650 nm. Chlorins are derived from chlorophyll, and modified chlorins such as meta- tetra hydroxyphenylchlorin (mTHPC) have functional groups to increase solubility. Bacteriochlorins are derived from photosynthetic bacteria and are further red-shifted to about 740 nm. A specific embodiment of the invention uses chlorine6.
Purpurins, porphycenes, and verdins are also porphyrin derivatives that have efficacies similar to or exceeding hematoporphyrin. Purpurins contain the basic porphyrin macrocycle, but are red-shifted to about 715 nm. Porphycenes have similar activation wavelengths to hematoporphyrin (about 635nm), but have higher fluorescence quantum yields. Verdins contain a cyclohexanone ring fused to one of the pyrroles of the porphyrin ring. Phorbides and pheophorbides are derived from chlorophylls and have 20 times the effectiveness of hematoporphyrin. Texaphyrins are new metal-coordinating expanded porphyrins. The unique feature of texaphyrins is the presence of five, instead of four, coordinating nitrogens within the pyrrole rings. This allows for coordination of larger metal cations, such as trivalent lanthanides. Gadolinium and lutetium are used as the coordinating metals. In a specific embodiment, the photosensitizer can be Antrin®, otherwise known as motexafin lutetium. 5 -aminolevulinic acid (ALA) is a precursor in the heme biosynthetic pathway, and exogenous administration of this compound causes a shift in equilibrium of downstream reactions in the pathway. In other words, the formation of the immediate precursor to heme, protoporphyrin IX, is dependent on the rate of 5 -aminolevulinic acid synthesis, governed in a negative-feedback manner by concentration of free heme. Conversion of protoporphyrin IX is slow, and where desired, administration of exogenous ALA can bypass the negative-feedback mechanism and result in accumulation of phototoxic levels of ALA-induced protoporphyrin IX. ALA is rapidly cleared from the body, but like
hematoporphyrin, has an absorption wavelength of about 630 nm.
First-generation photosensitizers are exemplified by the porphyrin derivative Photofrin®, also known as porfimer sodium. Photofrin® is derived from
hematoporphyrin-IX by acid treatment and has been approved by the Food and Drug Administration for use in PDT. Photofrin® is characterized as a complex and inseparable mixture of monomers, dimers, and higher oligomers. There has been substantial effort in the field to develop pure substances that can be used as successful photosensitizers. Thus, in a specific embodiment, the photosensitizer is a
benzoporphyrin derivative ("BPD"), such as BPD-MA, also commercially known as Verteporfin. U.S. Patent No. 4,883,790 describes BPDs. Verteporfin has been thoroughly characterized (Richter et al., 1987; Aveline et al., 1994; Levy, 1994) and it has been found to be a highly potent photosensitizer for PDT. Verteporfin has been used in PDT treatment of certain types of macular degeneration, and is thought to specifically target sites of new blood vessel growth, or angiogenesis, such as those observed in "wet" macular degeneration. Verteporfin is typically administered intravenously, with an optimal incubation time range from 1.5 to 6 hours. Verteporfin absorbs at 690 nm, and is activated with commonly available light sources. One tetrapyrrole-based photosensitizer having recent success in the clinic is MV0633 (Miravant).
In specific embodiments, the photosensitizer has a chemical structure that includes multiple conjugated rings that allow for light absorption and
photoactivation. Such specific embodiments include motexafin lutetium (Antrin®) and chlorine6. ii) Cyanine and other Photoactive Dyes
Cyanine and other dyes include but are not limited to a merocyanine, phthalocyanine, chloroaluminum phthalocyanine, sulfonated aluminum PC, ring- substituted cationic PC, sulfonated AlPc, disulfonated or tetrasulfonated derivative, sulfonated aluminum naphthalocyanine, naphthalocyanine, tetracyanoethylene adduct, crystal violet, azure β chloride, benzophenothiazinium,
benzophenothiazinium chloride (EtNBS), phenothiazine derivative,
phenothiaziniums such as rose Bengal, toluidine blue derivatives, toluidine blue O (TBO), methylene blue (MB), new methylene blue N (NMMB), new methylene blue BB, new methylene blue FR, 1,9-dimethylmethylene blue chloride (DMMB), methylene blue derivatives, methylene green, methylene violet Bernthsen, methylene violet 3RAX, Nile blue, Nile blue derivatives, malachite green, Azure blue A, Azure blue B, Azure blue C, safranine O, neutral red, 5-ethylamino-9- diethylaminobenzo[a]phenothiazinium chloride, 5-ethylamino-9- diethylaminobenzo[a]phenoselenazinium chloride, thiopyronine, or thionine.
Cyanines are deep blue or purple compounds that are similar in structure to porphyrins. However, these dyes are much more stable to heat, light, and strong acids and bases than porphyrin molecules. Cyanines, phthalocyanines, and naphthalocyanines are chemically pure compounds that absorb light of longer wavelengths than hematoporphyrin derivatives with absorption maxima at about 680 nm. Phthalocyanines, belonging to a new generation of substances for PDT are chelated with a variety of diamagnetic metals, chiefly aluminum and zinc, which enhance their phototoxicity. A ring substitution of the phthalocyanines with sulfonated groups will increase solubility and affect the cellular uptake. Less sulfonated compounds, which are more lipophilic, show the best membrane- penetrating properties and highest biological activity. The kinetics are much more rapid than those of HPD, where, for example, high tumor to tissue ratios (8:1) were observed after 1-3 hours. The cyanines are eliminated rapidly and almost no fluorescence can be seen in the tissue of interest after 24 hours.
Other photoactive dyes such as methylene blue and rose bengal, are also used for photodynamic therapy. Methylene blue is a phenothiazine cationic dye that is exemplified by its ability to specifically target mitochondrial membrane potential. Rose-bengal and fluorescein are xanthene dyes that are well documented in the art for use in photodynamic therapy. Rose bengal diacetate is an efficient, cell- permeant generator of singlet oxygen. It is an iodinated xanthene derivative that has been chemically modified by the introduction of acetate groups. These
modifications inactivate both its fluorescence and photosensitization properties, while increasing its ability to cross cell membranes. Once inside the cell, esterases remove the acetate groups and restore rose bengal to its native structure. This intracellular localization allows rose bengal diacetate to be a very effective photosensitizer.
iii) Other Photosensitizers
Diels-Alder adducts, dimethyl acetylene dicarboxylate adducts,
anthracenediones, anthrapyrazoles, aminoanthraquinone, phenoxazine dyes, chalcogenapyrylium dyes such as cationic selena and tellurapyrylium derivatives, cationic imminium salts, and tetracyclines are other compounds that also exhibit photoactive properties and can be used advantageously in photodynamic therapy. Other photosensitizers that do not fall in either of the aforementioned categories have other uses besides photodynamic therapy, but are also photoactive. For example, anthracenediones, anthrapyrazoles, aminoanthraquinone compounds are often used as anticancer therapies (i.e. mitoxantrone, doxorubicin).
Chalcogenapyrylium dyes such as cationic selena- and tellurapyrylium derivatives have also been found to exhibit photoactive properties in the range of about 600 to about 900 nm range, more preferably from about 775 to about 850 nm. In addition, antibiotics such as tetracyclines and fluoroquinolone compounds have demonstrated photoactive properties.
B. Linkers/Moieties cleavable by β-lactamase
Linkers of the invention are capable of linking two components of the photosensitizer composition together (e.g., a photosensitizer to another
photosensitizer, a photosensitizer to a binder, a photosensitizer to a backbone, or a binder to a backbone). Any bond which is capable of linking the components such that they are stable under physiological conditions for the time needed for administration, ingestion by the pest and activation within the pest is suitable, but covalent linkages are preferred. The link between two components may be direct, e.g., where a photosensitizer is linked directly to another photosensitizer, or indirect, e.g., where a photosensitizer is linked to an intermediate, e.g., linked to a backbone, and that intermediate is linked to another photosensitizer. A linker should function under conditions of temperature, pH, salt, solvent system, and other reactants that substantially retain the chemical stability of the photosensitizer and the backbone (if present).
Linkers according to the invention comprise moieties cleavable by a β- lactamase enzyme. In one aspect of the invention, linker cleavage by a β-lactamase causes reduction of the quenching that results from the conformation adopted by the multiple photosensitizers linked to one another. In another aspect, linker cleavage by β-lactamase causes reduction of the quenching that results from inclusion of a binder.
A linker can link components without the addition to the linked components of elements of the linker. Other linkers result in the addition of elements of the linker to the linked components. For example, linkers can be cross-linking agents that are homo- or hetero-bifunctional, and wherein one or more atomic components of the agent can be retained in the composition.
Many linkers react with an amine and a carboxylate, to form an amide, or an alcohol and a carboxylate to form an ester. Linkers are known in the art, see, e.g., M. Bodansky, "Principles of Peptide Synthesis", 2nd ed., referenced herein, and T. Greene and P. Wuts, "Protective Groups in Organic Synthesis," 2nd Ed, 1991, John Wiley, NY. Linkers should link component moieties stably, but such that there is only minimal or no denaturation or deactivation of the photosensitizer or other linked component.
The pesticidal compositions of the invention can be prepared by linking the photosensitizers to one another or to other components using methods known in the art. A variety of linkers, including cross-linking agents, can be used for covalent conjugation. Examples of cross-linking agents include Ν,Ν'- dicyclohexylcarbodiimide (DCC), N-succinimidyl-S-acetyl-thioacetate (SATA), N- succinimidyl-3-(2-pyridyldithio)propionate (SPDP), ortho-phenylenedimaleimide (o-PDM), and sulfosuccinimidyl 4-(N-maleimidomethyl) cyclohexane-l-carboxylate (sulfo-SMCC) (Karpovsky et al. (1984) J. Exp. Med. 160: 1686; Liu, MA et al. (1985) Proc. Natl. Acad. Sci. USA 82:8648). Other methods include those described by Paulus and Behring (1985) Ins. Mitt, 78: 118-132; Brennan et al. (1985) Science 229:81-83 and Glennie et al., (1987) J. Immunol,139:2367-2375. A large number of linkers for peptides and proteins, along with buffers, solvents, and methods of use, are described in the Pierce Chemical Co. catalog, pages T-155 to T- 200, 1994 (3747 N. Meridian Rd., Rockford IL, 61105, U.S.A. ; Pierce Europe B.V., P.O. Box 1512, 3260 BA Oud Beijerland, The Netherlands), the contents of which are hereby incorporated by reference.
DCC is a useful linker (Pierce #20320; Rockland, IL). DCC (Ν,Ν'- dicyclohexylcarbodiimide) is a carboxy-reactive cross-linker commonly used as a linker in peptide synthesis. Another useful cross-linking agent is SPDP (Pierce #21557), a heterobifunctional cross-linker for use with primary amines and sulfhydryl groups. SPDP produces cleavable cross-linking such that, upon further reaction, the agent is eliminated, so the photosensitizer can be linked directly to a backbone or molecular carrier. Other useful linking agents are SATA (Pierce #26102) for introduction of blocked SH groups for two-step cross-linking (Pierce #26103), and sulfo-SMCC (Pierce #22322), reactive towards amines and sulfhydryls. Other cross-linking and coupling agents are also available from Pierce Chemical Co. (Rockford, IL).
Additional useful linking agents are hydrazines or hydrazine derivatives, compounds that are very soluble in water and soluble in alcohol. Hydrazines are corrosive and strong reducing agents, though they constitute weaker bases than ammonia. Hydrazines are dibasic and form many salts, e.g., mono- and di- hydrochlorides, mono- and di-nitrates, and two sulfates. The hydrazine resin has been found to be a novel and highly useful platform for polyamide synthesis. The hydrazine resin is stable to elevated coupling temperatures, yet is cleaved rapidly at moderate temperatures by a wide range of nucleophiles following a mild and selective oxidation protocol.
Additional compounds and processes, particularly those involving a Schiff base as an intermediate, for conjugation of proteins to other proteins or to other compositions, for example, to reporter groups or to chelators for metal ion labeling of a protein, are disclosed in EP 243,929 A2 (published Nov. 4, 1987).
Photosensitizers which contain carboxyl groups can be joined to lysine s- amino groups in target polypeptides either by preformed reactive esters (such as N- hydroxy succinimide ester) or esters conjugated in situ by a carbodiimide-mediated reaction. The same applies to photosensitizers that contain sulfonic acid groups, which can be transformed to sulfonyl chlorides, which react with amino groups. Photosensitizers that have carboxyl groups can be joined to amino groups on the polypeptide by an in situ carbodiimide method or by hydrazine or hydrazine derivatives. Photosensitizers can also be attached to hydroxyl groups, of serine or threonine residues or to sulfhydryl groups, of serine or threonine residues or to sulfhydryl groups of cysteine residues.
Methods of joining components of a composition can use heterobifunctional cross linking reagents. These agents bind a functional group in one chain and a different functional group in a second chain. These functional groups typically are amino, carboxyl, sulfhydryl, and aldehyde. There are many permutations of appropriate moieties that will react with these groups and with differently formulated structures, to join them together (described in the Pierce Catalog and Merrifield et al. (1994) Ciba Found Symp. 186:5-20).
Generally, the photosensitizer compositions of the invention can be prepared by linking the photosensitizer to another photosensitizer, a binder and/or a backbone using methods described in the following Examples or by methods known in the art. A variety of linkers can be used for covalent conjugation.
Yield from linking reactions can be assessed by spectroscopy of product eluting from a chromatographic fractionation in the final step of purification. The presence of unlinked photosensitizer and reaction products containing the photosensitizer can be followed by the physical property that the photosensitizer absorbs light at a characteristic wavelength and extinction coefficient, so incorporation into products can be monitored by absorbance at that wavelength or a similar wavelength. Linking of one or more photosensitizer molecules to another or to a binder or to a backbone shifts the peak of absorbance in the elution profile in fractions eluted using sizing gel chromatography, e.g., with the appropriate choice of Sephadex G50, G100, or G200 or other such matrices (Pharmacia-Biotech, Piscataway N.J.)- Choice of appropriate sizing gel, for example Sephadex gel, can be determined by that gel in which the photosensitizer elutes in a fraction beyond the excluded volume of material too large to interact with the bead, i.e., the uncoupled starting photosensitizer composition interacts to some extent with the fractionation bead and is concomitantly retarded to some extent.
The correct useful gel can be predicted from the molecular weight of the uncoupled photosensitizer. The successful reaction products of photosensitizer compositions coupled to additional moieties generally have characteristic higher molecular weights, causing them to interact with the chromatographic bead to a lesser extent, and thus appear in fractions eluting earlier than fractions containing the uncoupled photosensitizer substrate. Unreacted photosensitizer substrate generally appears in fractions characteristic of the starting material, and the yield from each reaction can thus be assessed both from size of the peak of larger molecular weight material, and the decrease in the peak of characteristic starting material. The area under the peak of the product fractions is converted to the size of the yield using the molar extinction coefficient.
The product can be analyzed using NMR, integrating areas of appropriate product peaks, to determine relative yields with different linkers. A red shift in absorption of a photosensitizer of several nm has often been observed following coupling to a polyamino acid. Linking to a larger moiety such as a protein might produces a comparable shift, as linking to an antibody resulted in a shift of about 3-5 nm in that direction compared to absorption of the free photosensitizer. Relevant absorption maxima and extinction coefficients in 0.1M NaOH/1% SDS are, for chlorin e6, 400 nm and 150,000 M"1, cm"1, and for benzoporphyrin derivative, 430 nm and 61,000 M"1, cm"1.
C. Binders
The binder may, without limitation, be a peptide, a cyclic peptide, a polypeptide, a peptidomimetic, a protein, a fusion protein, a hybrid molecule or a dimer, multimer, or a conjugate of the above that binds or quenches, and, thus, may inhibit, suppress, neutralize, or decrease activity of, the photosensitizer. The binder may include, without limitation, a naturally occurring inhibitor, a receptor, a soluble receptor, an antibody, a polyclonal antibody, a monoclonal antibody, a bispecific antibody, an antibody fragment, a single chain antibody, anti-idiotype antibodies, a peptabody, a peptide, an oligopeptides, an oligonucleotide, a cyclic peptide (i.e., a peptide that is circular in nature), a peptide-lipid conjugate, a hormone, an antigen, an epitope, a receptor, a chemokine, a nucleic acid, a ligand or a dimer, multimer, or a conjugate of the above. Naturally occurring binders are binders that quench the photosensitizer and are found in nature.
In one aspect, the binder is a fluorophore. The property that renders a fluorophore (or any other binder) a suitable quencher is the capability of absorbing energy from the activated photosensitizer.
Fluorophores of the present invention can be any known in the art, including photosensitizers, fluorescent dyes, and photoactive dyes.
Photosensitizers can be any known in the art, as previously described. For example, hematoporphyrin derivatives have been used as fluorescent probes to investigate the development of human atherosclerotic plaques (Spokojny (1986) J. Am. Coll. Cardiol. 8:1387-1392). Ideally, the photosensitizer acting as a binder has a different excitation wavelength than the photosensitizer acting to produce a cytotoxic effect on the pathogen or host cell infected with the pathogen.
Fluorescent dyes of the present invention can be any known in the art, including, but not limited to 6-carboxy-4',5'-dichloro-2', 7'-dimethoxyfluorescein succinimidyl ester; 5-(and-6)-carboxyeosin; 5-carboxyfluorescein; 6- carboxyfluorescein; 5-(and-6)-carboxyfluorescein; 5-carboxyfluorescein-bis-(5- carboxymethoxy-2-nitrobenzyl) ether, -alanine-carboxamide, or succinimidyl ester; 5- carboxyfluorescein succinimidyl ester; 6-carboxyfluorescein succinimidyl ester; 5- (and-6)-carboxyfluorescein succinimidyl ester; 5-(4,6-dichlorotriazinyl)
aminofluorescein; 2',7'-difluorofluorescein; eosin-5-isothiocyanate; erythrosin-5- isothiocyanate; 6-(fluorescein-5-carboxamido) hexanoic acid or succinimidyl ester; 6- (fluorescein-5-(and-6)-carboxamido) hexanoic acid or succinimidyl ester; fluorescein- 5-EX succinimidyl ester; fluorescein-5-isothiocyanate; fluorescein-6-isothiocyanate; Oregon Green® 488 carboxylic acid, or succinimidyl ester; Oregon Green® 488 isothiocyanate; Oregon Green® 488-X succinimidyl ester; Oregon Green® 500 carboxylic acid; Oregon Green® 500 carboxylic acid, succinimidyl ester or triethylammonium salt; Oregon Green® 514 carboxylic acid; Oregon Green® 514 carboxylic acid or succinimidyl ester; Rhodamine Green™ carboxylic acid, succinimidyl ester or hydrochloride; Rhodamine Green™ carboxylic acid, trifluoroacetamide or succinimidyl ester; Rhodamine Green™-X succinimidyl ester or hydrochloride; Rhodol Green™ carboxylic acid, N,0-bis-(trifluoroacetyl) or succinimidyl ester; bis-(4-carboxypiperidinyl) sulfonerhodamine or di(succinimidyl ester); 5-(and-6)-carboxynaphthofluorescein, 5-(and-6)-carboxynaphthofluorescein succinimidyl ester; 5-carboxyrhodamine 6G hydrochloride; 6-carboxyrhodamine 6G hydrochloride, 5-carboxyrhodamine 6G succinimidyl ester; 6-carboxyrhodamine 6G succinimidyl ester; 5-(and-6)-carboxyrhodamine 6G succinimidyl ester; 5-carboxy- 2',4',5',7'- tetrabromosulfonefluorescein succinimidyl ester or bis- (diisopropylethylammonium) salt; 5-carboxytetramethylrhodamine; 6- c arboxy tetramethylrhodamine ; 5 - (and- 6) -carboxy tetramethylrhodamine ; 5 - carboxy tetramethylrhodamine succinimidyl ester; 6-carboxytetramethylrhodamine succinimidyl ester; 5-(and-6)-carboxytetramethylrhodamine succinimidyl ester; 6- carboxy-X-rhodamine; 5-carboxy-X-rhodamine succinimidyl ester; 6-carboxy-X- rhodamine succinimidyl ester; 5-(and-6)-carboxy-X-rhodamine succinimidyl ester; 5- carboxy-X-rhodamine triethylammonium salt; Lissamine™ rhodamine B sulfonyl chloride; malachite green isothiocyanate; NANOGOLD® mono(sulfosuccinimidyl ester); QSY® 21 carboxylic acid or succinimidyl ester; QSY® 7 carboxylic acid or succinimidyl ester; Rhodamine Red™-X succinimidyl ester; 6-(tetramethylrhodamine- 5- (and-6)-carboxamido)hexanoic acid succinimidyl ester; tetramethylrhodamine- 5- isothiocyanate; tetramethylrhodamine-6-isothiocyanate; tetramethylrhodamine- 5- (and- 6)-isothiocyanate; Texas Red® sulfonyl; Texas Red® sulfonyl chloride; Texas Red®- X STP ester or sodium salt; Texas Red®-X succinimidyl ester; Texas Red®-X succinimidyl ester; and X-rhodamine-5-(and-6)-isothiocyanate.
Fluorescent dyes of the present invention can also be, for example, bodipy dyes commercially available from Molecular Probes, including, but not limited to BODIPY® FL; BODIPY® TMR STP ester; BODIPY® TR-X STP ester;
BODIPY® 630/650-X STP ester; BODIPY® 650/665-X STP ester; 6-dibromo-4,4- difluoro-5, 7-dimethyl-4-bora-3a,4a-diaza- s-indacene- 3 -propionic acid succinimidyl ester; 4,4-difluoro-4-bora-3a,4a- diaza-s-indacene-3,5-dipropionic acid; 4,4- difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3-pentanoic acid; 4,4- difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3-pentanoic acid
succinimidyl ester; 4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3- propionic acid; 4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene- 3- propionic acid succinimidyl ester; 4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s- indacene- 3-propionic acid sulfosuccinimidyl ester or sodium salt; 6-((4,4-difluoro- 5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene-3-propionyl)amino)hexanoic acid; 6- ((4,4-difluoro-5,7-dimethyl- 4-bora-3a,4a-diaza-s-indacene-3- propionyl)amino)hexanoic acid or succinimidyl ester; N-(4,4-difluoro-5,7-dimethyl-
4- bora-3a,4a-diaza-s-indacene- 3-propionyl)cysteic acid, succinimidyl ester or triethylammonium salt; 6-4,4-difluoro-l,3-dimethyl- 5-(4-methoxyphenyl)-4-bora- 3a,4a 4,4-difluoro-5,7-diphenyl- 4-bora-3a,4a-diaza-s-indacene- 3-propionic acid; 4,4-difluoro-5,7-diphenyl- 4-bora-3a,4a-diaza-s-indacene- 3-propionic acid succinimidyl ester; 4,4-difluoro-5-phenyl-4-bora- 3a,4a-diaza-s-indacene-3- propionic acid succinimidyl ester; 6-((4,4-difluoro-5-phenyl- 4-bora-3a,4a-diaza-s- indacene- 3-propionyl)amino)hexanoic acid or succinimidyl ester; 4,4-difluoro-5-(4- phenyl-1, 3-butadienyl)-4-bora-3a,4a- diaza-s-indacene-3-propionic acid succinimidyl ester; 4,4-difluoro-5-(2-pyrrolyl) -4-bora-3a,4a-diaza-s-indacene- 3- propionic acid succinimidyl ester; 6-(((4,4-difluoro-5-(2-pyrrolyl) -4-bora-3a,4a- diaza-s-indacene- 3-yl)styryloxy)acetyl)aminohexanoic acid or succinimidyl ester; 4,4-difluoro-5-styryl-4-bora- 3a,4a-diaza-s-indacene-3-propionic acid; 4,4-difluoro-
5- styryl-4-bora- 3a,4a-diaza-s-indacene-3-propionic acid succinimidyl ester; 4,4- difluoro-l,3,5,7-tetramethyl- 4-bora-3a,4a-diaza-s-indacene- 8-propionic acid; 4,4- difluoro-l,3,5,7-tetramethyl- 4-bora-3a,4a-diaza-s-indacene- 8-propionic acid succinimidyl ester; 4,4-difluoro-5-(2-thienyl) -4-bora-3a,4a-diaza-s-indacene- 3- propionic acid succinimidyl ester; 6-(((4-(4,4-difluoro-5-(2- thienyl)-4-bora-3a,4a- diaza s-indacene-3-yl)phenoxy)acetyl) amino)hexanoic acid or succinimidyl ester; and 6-(((4,4-difluoro-5-(2-thienyl) -4-bora-3a,4a-diaza-s-indacene-3- yl)styryloxy)acetyl)aminohexanoic acid or succinimidyl ester.
Fluorescent dyes the present invention can also be, for example, alexa fluor dyes commercially available from Molecular Probes, including but not limited to Alexa Fluor® 350 carboxylic acid; Alexa Fluor® 430 carboxylic acid; Alexa Fluor® 488 carboxylic acid; Alexa Fluor® 532 carboxylic acid; Alexa Fluor® 546 carboxylic acid; Alexa Fluor® 555 carboxylic acid; Alexa Fluor® 568 carboxylic acid; Alexa Fluor® 594 carboxylic acid; Alexa Fluor® 633 carboxylic acid; Alexa Fluor® 647 carboxylic acid; Alexa Fluor® 660 carboxylic acid; and Alexa Fluor® 680 carboxylic acid.
Fluorescent dyes the present invention can also be, for example, cy dyes commercially available from Amersham-Pharmacia Biotech, including, but not limited to Cy3 NHS ester; Cy 5 NHS ester; Cy5.5 NHS ester; and Cy 7 NHS ester.
Photoactive dyes of the present invention can be any photosensitizer known in the art which will fluoresce but not necessarily produce a reactive species in phototoxic amounts when illuminated. Depending on the wavelength and power of light administered, a photosensitizer can be activated to fluoresce and, therefore, act as a photoactive dye, but not produce a phototoxic effect unless, in some cases, the wavelength and power of light is suitably adapted to induce a phototoxic effect.
Throughout this specification, any reference to a binder should be construed to refer to each of the binders identified and contemplated herein and to each biologically equivalent molecule. "Biologically equivalent" means compositions of the present invention which are capable of preventing action of the photosensitizer in a similar fashion, but not necessarily to the same degree.
D. Backbones
Pesticidal compositions according to the invention include those in which a "backbone" moiety, such as a polyamino acid, is linked to a photosensitizer and/or to a binder.
Inclusion of a backbone in a composition with a photosensitizer and/or binder can provide a number of advantages, including the provision of greater stoichiometric ranges of photosensitizers and/or binders and/or targeting moieties coupled per backbone. If the backbone possesses intrinsic affinity for a target pest, the affinity of the composition can be enhanced by coupling to the backbone. Peptides useful in the methods and compounds of the invention for design and characterization of backbone moieties include poly-amino acids which can be homo- and hetero-polymers of L-, D-, racemic DL- or mixed L- and D-amino acid composition, and which can be of defined or random mixed composition and sequence. Examples of naturally-occurring peptides with mixed D and L amino acid residues include bacitracin and tyrocidin. These peptides may be modeled after particular natural peptides, and optimized by the technique of phage display and selection for enhanced binding to a chosen target, so that the selected peptide of highest affinity is characterized and then produced synthetically.
Further modifications of functional groups can be introduced for purposes, for example, of increased solubility, decreased aggregation, and altered extent of hydrophobicity. Examples of non-peptide backbones include nucleic acids and derivatives of nucleic acids such as DNA, RNA and peptide nucleic acids;
polysaccharides and derivatives such as starch, pectin, chitins, celluloses and hemi- methylated celluloses; lipids such as triglyceride derivatives and cerebrosides; synthetic polymers such as polyethylene glycols (PEGs) and PEG star polymers; dextran derivatives, polyvinyl alcohols, N-(2-hydroxypropyl)-methacrylamide copolymers, poly (DL-glycolic acid-lactic acid); and compositions containing elements of any of these classes of compounds.
III. Pests and Administration of the Pesticidal compositions of the Invention A) Plant and Plant Organs
The pesticidal compositions are suitable for protecting plants and plant organs, for increasing the harvest yields, for improving the quality of the harvested goods and for controlling animal pests, in particular insects, arachnids and nematodes, which are encountered in agriculture, in forests, in gardens and leisure facilities, in the protection of stored products and of materials, and in the hygiene sector, and have good plant tolerance, favorable toxicity to warm-blooded animals and good environmental compatibility. They may preferably be employed as crop protection agents. In certain embodiments, the pesticidal compositions according to the invention can be used, for example, and without limitation, to treat propagation material such as tubers or rhizomes, but also seeds, seedlings or seedlings pricking out and plants or plants pricking out. These methods of treatment can also be useful to treat roots. The methods of treatment according to the invention can also be useful to treat the overground parts of the plant such as trunks, stems or stalks, leaves, flowers and fruit of the concerned plant.
Plants in accordance with the invention include, but are not limited to corn; tobacco; cotton; soybean; sugarcane; hay; sorghum; kales; cabbages; flax; vine; fruit or vegetable crops such as Rosaceae sp. (for instance pip fruit such as apples and pears, but also stone fruit such as apricots, almonds and peaches), Ribesioidae sp., Juglandaceae sp., Betulaceae sp., Anacardiaceae sp., Fagaceae sp., Moraceae sp., Oleaceae sp., Actimidaceae sp., Lauraceae sp., Musaceae sp. (for instance banana trees and plantains), Rubiaceae sp., Theaceae sp., Sterculiceae sp., Rutaceae sp. (for instance lemons, oranges and grapefruit); Solanaceae sp. (for instance tomatoes), Liliaceae sp., Asteraceae sp. (for instance lettuces), Umbelliferae sp., Cruciferae sp., Chenopodiaceae sp., Cucurbitaceae sp., Papilionaceae sp. (for instance peas), Rosaceae sp. (for instance strawberries); major crops such as Graminae sp. (for instance maize, lawn or cereals such as wheat, rice, barley and triticale), Asteraceae sp. (for instance sunflower), Cruciferae sp. (for instance colza), Fabacae sp. (for instance peanuts), Papilionaceae sp. (for instance soybean), Solanaceae sp. (for instance potatoes), Chenopodiaceae sp. (for instance beetroots); horticultural and forest crops, including flowers; as well as genetically modified homologues of these crops.
In certain embodiments, the pesticidal compositions according to the invention can be also used, for example, and without limitation, in connection with the following plants:
Dicotyledonous weeds of the genera; Abutilon, Amaranthus,
Ambrosia, Anoda, Anthemis, Aphanes, Atriplex, Bellis, Bidens, Capsella, Carduus, Cassia, Centaurea, Chenopodium, Cirsium, Convolvulus, Datura,
Desmodium, Emex, Erysimum, Euphorbia, Galeopsis, Galinsoga, Galium, Hibiscus, Ipomoea, Kochia, Lamium, Lepidium, Lindernia, Matricaria, Mentha, Mercurialis, Mullugo, Myosotis, Papaver, Pharbitis, Plantago, Polygonum, Portulaca, Ranunculus, Raphanus, Rorippa, Rotala, Rumex, Salsola, Senecio, Sesbania, Sida, Sinapis, Solanum, Sonchus, Sphenoclea, Stellaria, Taraxacum, Thlaspi, Trifolium, Urtica, Veronica, Viola, Xanthium. Dicotyledonous crops of the genera: Arachis, Beta, Brassica, Cucumis, Cucurbita, Helianthus, Daucus, Glycine, Gossypium, Ipomoea, Lactuca, Linum, Lycopersicon, Nicotiana, Phaseolus, Pisum, Solanum, Vicia.
Monocotyledonous weeds of the genera; Aegilops, Agropyron, Agrostis, Alopecurus, Apera, Avena, Brachiaria, Bromus, Cenchrus, Commelina, Cynodon, Cyperus, Dactyloctenium, Digitaria, Echinochloa, Eleocharis, Eleusine, Eragrostis, Eriochloa, Festuca, Fimbristylis,
Heteranthera, Imperata, Ischaemum, Leptochloa, Lolium, Monochoria, Panicum, Paspalum, Phalaris, Phleum, Poa, Rottboellia, Sagittaria, Scirpus, Setaria, Sorghum.
Monocotyledonous crops of the genera; Allium, Ananas, Asparagus, Avena, Hordeum, Oryza, Panicum, Saccharum, Secale, Sorghum, Triticale, Triticum, Zea.
B) Formulation
i) For Use in Plants
The pesticidal compositions of the invention can be used as such, in the form of their formulations or in the use forms prepared therefrom by further dilution, such as ready-to-use solutions, suspensions, emulsions, powders, pastes and granules. They are used in a customary manner, for example by watering, spraying, atomizing or broadcasting.
The pesticidal compositions of the invention can be applied both before and after emergence of the plants. They can also be incorporated into the soil before sowing.
All plants and plant parts can be treated in accordance with the invention.
Plants are to be understood as meaning in the present context all plants and plant populations such as desired and undesired wild plants or crop plants (including naturally occurring crop plants). Crop plants can be plants which can be obtained by conventional plant breeding and optimization methods or by biotechnological and recombinant methods or by combinations of these methods, including the transgenic plants and inclusive of the plant cultivars protectable or not protectable by plant breeders' rights. Plant parts are to be understood as meaning all parts and organs of plants above and below the ground, such as shoot, leaf, flower and root, examples which may be mentioned being leaves, needles, stalks, stems, flowers, fruit bodies, fruits, seeds, roots, tubers and rhizomes. The plant parts also include harvested material, and vegetative and generative propagation material, for example cuttings, tubers, rhizomes, offsets and seeds.
Treatment according to the invention of the plants and plant parts with the pesticidal compositions is carried out directly or by allowing the compounds to act on their surroundings, environment or storage space by the customary treatment methods, for example by immersion, spraying, evaporation, fogging, scattering, painting on and, in the case of propagation material, in particular in the case of seeds, also by applying one or more coats.
The pesticidal compositions can be converted to the customary formulations, such as solutions, emulsions, wettable powders, suspensions, powders, dusts, pastes, soluble powders, granules, suspension-emulsion concentrates, natural and synthetic materials impregnated with active compound and microencapsulations in polymeric substances.
These formulations are produced in a known manner, for example by mixing the pesticidal compositions with extenders, that is, liquid solvents, and/or solid carriers, optionally with the use of surfactants, that is emulsifiers and/or dispersants, and/or foam-formers.
If the extender used is water, it is also possible to employ for example organic solvents as auxiliary solvents. Essentially, suitable liquid solvents are: aromatics such as xylene, toluene or alkylnaphthalenes, chlorinated aromatics or chlorinated aliphatic hydrocarbons such as chlorobenzenes, chloroethylenes or methylene chloride, aliphatic hydrocarbons such as cyclohexane or paraffins, for example petroleum fractions, mineral and vegetable oils, alcohols such as butanol or glycol and also their ethers and esters, ketones such as acetone, methyl ethyl ketone, methyl isobutyl ketone or cyclohexanone, strongly polar solvents such as dimethylformamide and dimethyl sulphoxide, and also water.
Suitable Solid Carriers are: for example ammonium salts and ground natural minerals such as kaolins, clays, talc, chalk, quartz, attapulgite, montmorillonite or diatomaceous earth, and ground synthetic minerals, such as highly disperse silica, alumina and silicates; suitable solid carriers for granules are: for example crushed and fractionated natural rocks such as calcite, marble, pumice, sepiolite and dolomite, and also synthetic granules of inorganic and organic meals, and granules of organic material such as sawdust, coconut shells, maize cobs and tobacco stalks; suitable emulsifiers and/or foam-formers are: for example nonionic and anionic emulsifiers, such as polyoxyethylene fatty acid esters, polyoxyethylene fatty alcohol ethers, for example alkylaryl polyglycol ethers, alkylsulphonates, alkyl sulphates, arylsulphonates and also protein hydrolysates; suitable dispersants are: for example lignin- sulphite waste liquors and methylcellulose.
Tackifiers such as carboxymethylcellulose and natural and synthetic polymers in the form of powders, granules or latices, such as gum arabic, polyvinyl alcohol and polyvinyl acetate, as well as natural phospholipids such as cephalins and lecithins, and synthetic phospholipids, can be used in the formulations. Other possible additives are mineral and vegetable oils.
It is possible to use colorants such as inorganic pigments, for example iron oxide, titanium oxide and Prussian Blue, and organic dyestuffs, such as alizarin dyestuffs, azo dyestuffs and metal phthalocyanine dyestuffs, and trace nutrients such as salts of iron, manganese, boron, copper, cobalt, molybdenum and zinc.
The pesticidal compositions of the invention can be used in the form of concentrates or generally customary formulations, such as powders, granules, solutions, suspensions, emulsions or pastes.
The formulations mentioned can be prepared in a manner known per se, for example by mixing the active compounds with at least one solvent or diluent, emulsifier, dispersing agent and/or binder or fixing agent, a water repellent, if appropriate siccatives and UV stabilizers and if appropriate dyestuffs and pigments, and also other processing auxiliaries.
ii.) For household or industrial use In the field of household or industrial use, the pesticidal compositions of the invention are used alone or in combination with other suitable active compounds, such as phosphoric acid esters, carbamates, pyrethroids, neonicotinoides, growth regulators or active compounds from other known classes of pesticides.
The pesticidal compositions of the invention can be used in aerosols, pressure-free spray products, for example pump and atomizer sprays, automatic fogging systems, foggers, foams, gels, evaporator products with evaporator tablets made of cellulose or polymer, liquid evaporators, gel and membrane evaporators, propeller-driven evaporators, energy-free or passive evaporation systems, moth papers, moth bags and moth gels, as granules or dusts, in baits for spreading or in bait stations.
iii.) For Antifouling use
Using the compounds according to the invention as an antifouling agent, alone or in combination with other active compounds, allows the use of heavy metals such as, for example, in bis-(trialkyltin) sulphides, tri-n-butyltin laurate, tri-n- butyltin chloride, copper(I) oxide, triethyltin chloride, tri-n-butyl(2-phenyl-4- chlorophenoxy)tin, tributyltin oxide, molybdenum disulphide, antimony oxide, polymeric butyl titanate, phenyl-(bispyndine)-bismuth chloride, tri-n-butyltin fluoride, manganese ethylenebisthio-carbamate, zinc dimethyldithiocarbamate, zinc ethylenebisthiocarbamate, zinc salts and copper salts of 2-pyridinethiol 1 -oxide, bisdimethyldithiocarbamoylzinc ethylene-bisthiocarbamate, zinc oxide, copper(I) ethylene-bisdithiocarbamate, copper thiocyanate, copper naphthenate and tributyltin halides to be dispensed with, or the concentration of these compounds substantially reduced.
The pesticidal compositions can be used to control fouling by mixing the compositions into ready-to-use antifouling paints If appropriate, the ready-to-use antifouling paints can additionally comprise other active compounds, preferably algicides, fungicides, herbicides, molluscicides, or other antifouling active compounds.
The antifouling compositions used comprise the active compound according to the invention of the compounds according to the invention in a concentration of 0.001 to 50% by weight, in particular 0.01 to 20% by weight. Moreover, the antifouling compositions according to the invention comprise the customary components such as, for example, those described in Ungerer, Chem. Ind. 1985, 37, 730-732 and Williams, Antifouling Marine Coatings, Noyes, Park Ridge, 1973.
Antifouling paints can further comprise, in particular, binders. Examples of recognized binders are polyvinyl chloride in a solvent system, chlorinated rubber in a solvent system, acrylic resins in a solvent system, in particular in an aqueous system, vinyl chloride/vinyl acetate copolymer systems in the form of aqueous dispersions or in the form of organic solvent systems, butadiene/styrene/acrylonitrile rubbers, drying oils such as linseed oil, resin esters or modified hardened resins in combination with tar or bitumens, asphalt and epoxy compounds, small amounts of chlorine rubber, chlorinated polypropylene and vinyl resins.
iv. ) For veterinary use
In the field of veterinary uses, the pesticidal compositions of the invention can be used in a known manner by enteral administration in the form of, for example, tablets, capsules, potions, drenches, granules, pastes, boluses, the feed- through process and suppositories, by parenteral administration, such as, for example, by injection (intramuscular, subcutaneous, intravenous, intraperitoneal and the like), implants, by nasal administration, by dermal use in the form, for example, of dipping or bathing, spraying, pouring on and spotting on, washing and powdering, and also with the aid of moulded articles containing the active compound, such as collars, ear marks, tail marks, limb bands, halters, marking devices and the like.
v. ) For use in humans
In humans, a therapeutically effective amount of a composition of the invention can be administered in one or more doses. An effective amount is an amount that is sufficient to palliate, ameliorate, reduce, stabilize, reverse or slow the progression of a pest infestation, such as a parasite infestation, or tick infestation. A therapeutically effective amount can be provided in one or a series of
administrations. The effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art.
As a rule, the dosage for in vivo therapeutics or diagnostics will vary.
Several factors are typically taken into account when determining an appropriate dosage. These factors include age, sex and weight of the patient, the condition being treated, the severity of the condition and the form of the nanoparticle being administered.
Compositions of the present invention may be administered by a mode appropriate for the form of composition. Available routes of administration include subcutaneous, intramuscular, intraperitoneal, intradermal, oral, intranasal, intrapulmonary (i.e., by aerosol), intravenously, intramuscularly, subcutaneously, intracavity, intrathecally or transdermally, alone or in combination with nanoparticle compositions. Therapeutic nanoparticle compositions (e.g., a nanoparticle containing a photosensitizer core, a polymer shell, and a targeting aptamer fixed to the surface of the shell in an appropriate excipient) are often administered by injection or by gradual perfusion.
Compositions for oral, intranasal, or topical administration can be supplied in solid, semi-solid or liquid forms, including tablets, capsules, powders, liquids, and suspensions. Compositions for injection can be supplied as liquid solutions or suspensions, as emulsions, or as solid forms suitable for dissolution or suspension in liquid prior to injection. For administration via the respiratory tract, a preferred composition is one that provides a solid, powder, or liquid aerosol when used with an appropriate aerosolizer device. Although not required, compositions are preferably supplied in unit dosage form suitable for administration of a precise amount. Also contemplated by this invention are slow release or sustained release forms, whereby a relatively consistent level of the active compound are provided over an extended period.
Another method of administration is intralesionally, for instance by direct injection directly into the site of pest infestation. Intralesional administration of various forms are useful in that they do not cause the toxicity seen with systemic administration of immunologic agents (Fletcher and Goldstein, 1987), (Rabinowich et al., 1987), (Rosenberg et al., 1986), (Pizza et al., 1984).
C) Pests
i. Plant Pests
The pesticidal compositions are active against normally sensitive and resistant species and against all or some stages of development. The
abovementioned pests include, but are not limited to: From the order of the Isopoda, for example, Oniscus asellus, Armadillidium vulgare and Porcellio scaber.
From the order of the Diplopoda, for example, Blaniulus guttulatus. From the order of the Chilopoda, for example, Geophilus carpophagus and Scutigera spp.
From the order of the Symphyla, for example, Scutigerella immaculata.
From the order of the Thysanura, for example, Lepisma saccharina.
From the order of the Collembola, for example, Onychiurus armatus. From the order of the Orthoptera, for example, Acheta domesticus,
Gryllotalpa spp., Locusta migratoria migratorioides, Melanoplus spp. and Schistocerca gregaria.
From the order of the Blattaria, for example, Blatta orientalis, Periplaneta americana, Leucophaea maderae, Blattella germanica.
From the order of the Dermaptera, for example, Forficula auricularia.
From the order of the Isoptera, for example, Reticulitermes spp.
From the order of the Phthiraptera, for example, Pediculus humanus corporis, Haematopinus spp., Linognathus spp., Trichodectes spp. and Damalinia spp.
From the order of the Thysanoptera, for example, Hercinothrips femoralis, Thrips tabaci, Thrips palmi and Frankliniella accidentalis.
From the order of the Heteroptera, for example, Eurygaster spp., Dysdercus intermedius, Piesma quadrata, Cimex lectularius, Rhodnius prolixus and Triatoma spp.
From the order of the Homoptera, for example, Aleurodes brassicae, Bemisia tabaci, Trialeurodes vaporariorum, Aphis gossypii, Brevicoryne brassicae, Cryptomyzus ribis, Aphis fabae, Aphis pomi, Eriosoma lanigerum, Hyalopterus arundinis, Phylloxera vastatrix, Pemphigus spp., Macrosiphum avenae, Myzus spp., Phorodon humuli, Rhopalosiphum padi, Empoasca spp.,
Euscelis bilobatus, Nephotettix cincticeps, Lecanium corni, Saissetia oleae, Laodelphax striatellus, Nilaparvata lugens, Aonidiella aurantii, Aspidiotus hederae, Pseudococcus spp. and Psylla spp.
From the order of the Lepidoptera, for example, Pectinophora gossypiella, Bupalus piniarius, Chematobia brumata, Lithocolletis blancardella, Hyponomeuta padella, Plutella xylostella, Malacosoma neustria, Euproctis chrysorrhoea, Lymantria spp., Bucculatrix thurberiella, Phyllocnistis citrella, Agrotis spp., Euxoa spp., Feltia spp., Earias insulana, Heliothis spp., Mamestra brassicae, Panolis flammea, Spodoptera spp., Trichoplusia ni, Carpocapsa pomonella, Pieris spp., Chilo spp., Pyrausta nubilalis, Ephestia kuehniella, Galleria mellonella, Tineola bisselliella, Tinea pellionella, Hofmannophila pseudospretella, Cacoecia podana, Capua reticulana, Choristoneura fumiferana, Clysia ambiguella, Homona magnanima, Tortrix viridana, Cnaphalocerus spp., Oulema oryzae.
From the order of the Coleoptera, for example, Anobium punctatum, Rhizopertha dominica, Bruchidius obtectus, Acanthoscelides obtectus, Hylotrupes bajulus, Agelastica alni, Leptinotarsa decemlineata, Phaedon cochleariae, Diabrotica spp., Psylliodes chrysocephala, Epilachna varivestis, Atomaria spp., Oryzaephilus surinamensis, Anthonomus spp., Sitophilus spp., Otiorrhynchus sulcatus, Cosmopolites sordidus,
Ceuthorrhynchus assimilis, Hypera postica, Dermestes spp., Trogoderma spp., Anthrenus spp., Attagenus spp., Lyctus spp., Meligethes aeneus, Ptinus spp., Niptus hololeucus, Gibbium psylloides, Tribolium spp., Tenebrio molitor, Agriotes spp., Conoderus spp., Melolontha melolontha,
Amphimallon solstitialis, Costelytra zealandica and Lissorhoptrus oryzophilus.
From the order of the Hymenoptera, for example, Diprion spp., Hoplocampa spp., Lasius spp., Monomorium pharaonis and Vespa spp.
From the order of the Diptera, for example, Aedes spp., Anopheles spp., Culex spp., Drosophila melanogaster, Musca spp., Fannia spp., Calliphora erythrocephala, Lucilia spp., Chrysomyia spp., Cuterebra spp., Gastrophilus spp., Hyppobosca spp., Stomoxys spp., Oestrus spp.,
Hypoderma spp., Tabanus spp., Tannia spp., Bibio hortulanus, Oscinellafrit, Phorbia spp., Pegomyia hyoscyami, Ceratitis capitata, Dacus oleae, Tipula paludosa, Hylemyia spp. and Liriomyza spp.
From the order of the Siphonaptera, for example, Xenopsylla cheopis and Ceratophyllus spp.
From the class of the Arachnida, for example, Scorpio maurus, Latrodectus mactans, Acarus siro, Argas spp., Ornithodoros spp.,
Dermanyssus gallinae, Eriophyes ribis, Phyllocoptruta oleivora, Boophilus spp., Rhipicephalus spp., Amblyomma spp., Hyalomma spp., Ixodes spp., Psoroptes spp., Chorioptes spp., Sarcoptes spp., Tarsonemus spp., Bryobia praetiosa, Panonychus spp., Tetranychus spp., Hemitarsonemus spp., Brevipalpus spp. ii. phvtoparasitic nematodes
The pesticidal compositions of the invention are active act against phytoparasitic nematodes including, but are not limited to:
Pratylenchus spp., Radopholus similis, Ditylenchus dipsaci, Tylenchulus semipenetrans, Heterodera spp., Globodera spp., Meloidogyne spp., Aphelenchoides spp., Longidorus spp., Xiphinema spp., Trichodorus spp., Bursaphelenchus spp. iii. Veterinary and livestock pests
The pesticidal compositions of the invention are also useful in the veterinary medicine sector against animal parasites (ectoparasites), such as hard ticks, soft ticks, mange mites, harvest mites, flies (biting and licking), parasitic fly larvae, lice, hair lice, feather lice and fleas. These parasites include, but are not limited to:
From the order of the Anoplurida, for example, Haematopinus spp., Linognathus spp., Pediculus spp., Phtirus spp. and Solenopotes spp.
From the order of the Mallophagida and the suborders Amblycerina and Ischnocerina, for example, Trimenopon spp., Menopon spp., Trinoton spp., Bovicola spp., Werneckiella spp., Lepikentron spp., Damalina spp., Trichodectes spp. and Felicola spp.
From the order of the Diptera and the suborders Nematocerina and Brachycerina, for example, Aedes spp., Anopheles spp., Culex spp., Simulium spp., Eusimulium spp., Phlebotomus spp., Lutzomyia spp., Culicoides spp., Chrysops spp., Hybomitra spp., Atylotus spp., Tabanus spp., Haematopota spp., Philipomyia spp., Braula spp., Musca spp., Hydrotaea spp., Stomoxys spp., Haematobia spp., Morellia spp., Fannia spp., Glossina spp., Calliphora spp., Lucilia spp., Chrysomyia spp., Wohlfahrtia spp., Sarcophaga spp., Oestrus spp., Hypoderma spp., Gasterophilus spp., Hippobosca spp., Lipoptena spp. and Melophagus spp.
From the order of the Siphonapterida, for example Pulex spp., Ctenocephalides spp., Xenopsylla spp. and Ceratophyllus spp.
From the order of the Heteropterida, for example, Cimex spp., Triatoma spp., Rhodnius spp. and Panstrongylus spp.
From the order of the Blattarida, for example Blatta orientalis, Periplaneta americana, Blattela germanica and Supella spp.
From the subclass of the Acaria (Acarina) and the orders of the Meta- and Mesostigmata, for example, Argas spp., Ornithodorus spp., Otobius spp., Ixodes spp., Amblyomma spp., Boophilus spp., Dermacentor spp., Haemophysalis spp., Hyalomma spp., Rhipicephalus spp., Dermanyssus spp., Raillietia spp., Pneumonyssus spp., Sternostoma spp. and Varroa spp.
From the order of the Actinedida (Prostigmata) and Acaridida (Astigmata), for example, Acarapis spp., Cheyletiella spp., Ornithocheyletia spp., Myobia spp., Psorergates spp., Demodex spp., Trombicula spp., Listrophorus spp., Acarus spp., Tyrophagus spp., Caloglyphus spp., Hypodectes spp., Pterolichus spp., Psoroptes spp., Chorioptes spp.,
Otodectes spp., Sarcoptes spp., Notoedres spp., Knemidocoptes spp., Cytodites spp. and Laminosioptes spp.
The compositions of the invention are also suitable for controlling arthropods which infest agricultural productive livestock, such as, for example, cattle, sheep, goats, horses, pigs, donkeys, camels, buffalo, rabbits, chickens, turkeys, ducks, geese and bees, other pets, such as, for example, dogs, cats, caged birds and aquarium fish, and also so-called test animals, such as, for example, hamsters, guinea pigs, rats and mice. By controlling these arthropods, cases of death and reduction in productivity (for meat, milk, wool, hides, eggs, honey etc.) should be diminished, so that more economic and easier animal husbandry is possible by use of the active compounds according to the invention. iv. Industrial Pests
The pesticidal compositions of the invention are also useful against insects which destroy industrial materials.
These pests include, but are not limited to:
Beetles, such as Hylotrupes bajulus, Chlorophorus pilosis, Anobium punctatum, Xestobium rufovillosum, Ptilinus pecticornis, Dendrobium pertinex, Ernobius mollis, Priobium carpini, Lyctus brunneus, Lyctus africanus, Lyctus planicollis, Lyctus linearis, Lyctus pubescens, Trogoxylon aequale, Minifies rugicollis, Xyleborus spec. Tryptodendron spec. Apate monachus, Bostrychus capucins, Heterobostrychus brunneus, Sinoxylon spec. Dinoderus minutus.
Hymenopterons, such as Sirex juvencus, Urocerus gigas, Urocerus gigas taignus, Urocerus augur.
Termites, such as Kalotermes flavicollis, Cryptotermes brevis, Heterotermes indicola, Reticulitermes flavipes, Reticulitermes santonensis, Reticulitermes lucifugus, Mastotermes darwiniensis, Zootermopsis nevadensis, Coptotermes formosanus. Bristletails, such as Lepisma saccharina.
Industrial materials in the present connection are to be understood as meaning non-living materials, such as, preferably, plastics, adhesives, sizes, paper and card, leather, wood and processed wood products and coating compositions.
Wood and processed wood products are materials to be protected, especially preferably, from insect infestation.
Wood and processed wood products which can be protected by the agents according to the invention or mixtures comprising these are to be understood as meaning, for example: building timber, wooden beams, railway sleepers, bridge components, boat jetties, wooden vehicles, boxes, pallets, containers, telegraph poles, wood paneling, wooden windows and doors, plywood, chipboard, joinery or wooden products which are used quite generally in house-building or in building joinery. v. Enclosed Spaces / Household Pests
The pesticidal compositions of the invention are also suitable for controlling animal pests, in particular insects, arachnids and mites, which are found in enclosed spaces such as, for example, dwellings, factory halls, offices, vehicle cabins and the like. They can be employed alone or in combination with other active compounds and auxiliaries in domestic pesiticide products for controlling these pests. They are active against sensitive and resistant species and against all developmental stages. These pests include, but are not limited to:
From the order of the Scorpionidea, for example, Buthus occitanus. From the order of the Acarina, for example, Argas persicus, Argas reflexus, Bryobia ssp., Dermanyssus gallinae, Glyciphagus domesticus, Ornithodorus moubat, Rhipicephalus sanguineus, Trombicula alfreddugesi,
Neutrombicula autumnalis, Dermatophagoides pteronissimus,
Dermatophagoides forinae.
From the order of the Araneae, for example, Aviculariidae, Araneidae.
From the order of the Opiliones, for example, Pseudoscorpiones chelifer, Pseudoscorpiones cheiridium, Opiliones phalangium.
From the order of the Isopoda, for example, Oniscus asellus, Porcellio scaber.
From the order of the Diplopoda, for example, Blaniulus guttulatus, Polydesmus spp.
From the order of the Chilopoda, for example, Geophilus spp. From the order of the Zygentoma, for example, Ctenolepisma spp., Lepisma saccharina, Lepismodes inquilinus.
From the order of the Blattaria, for example, Blatta orientalies, Blattella germanica, Blattella asahinai, Leucophaea maderae, Panchlora spp., Parcoblatta spp., Periplaneta australasiae, Periplaneta americana, Periplaneta brunnea, Periplaneta fuliginosa, Supella longipalpa. From the order of the Saltatoria, for example, Acheta domesticus. From the order of the Dermaptera, for example, Forficula auricularia.
From the order of the Isoptera, for example, Kalotermes spp., Reticulitermes spp.
From the order of the Psocoptera, for example, Lepinatus spp., Liposcelis spp.
From the order of the Coleptera, for example, Anthrenus spp., Attagenus spp., Dermestes spp., Latheticus oryzae, Necrobia spp., Ptinus spp., Rhizopertha dominica, Sitophilus granarius, Sitophilus oryzae,
Sitophilus zeamais, Stegobium paniceum.
From the order of the Diptera, for example, Aedes aegypti, Aedes albopictus, Aedes taeniorhynchus, Anopheles spp., Calliphora
erythrocephala, Chrysozona pluvialis, Culex quinquefasciatus, Culex pipiens, Culex tarsalis, Drosophila spp., Fannia canicularis, Musca domestica, Phlebotomus spp., Sarcophaga carnaria, Simulium spp., Stomoxys calcitrans, Tipula paludosa.
From the order of the Lepidoptera, for example, Achroia grisella, Galleria mellonella, Plodia interpunctella, Tinea cloacella, Tinea pellionella, Tineola bisselliella.
From the order of the Siphonaptera, for example, Ctenocephalides canis, Ctenocephalides felis, Pulex irritans, Tunga penetrans, Xenopsylla cheopis.
From the order of the Hymenoptera, for example, Camponotus herculeanus, Lasius fuliginosus, Lasius niger, Lasius umbratus,
Monomorium pharaonis, Paravespula spp., Tetramorium caespitum.
From the order of the Anoplura, for example, Pediculus humanus capitis, Pediculus humanus corporis, Phthirus pubis.
From the order of the Heteroptera, for example, Cimex hemipterus, Cimex lectularius, Rhodinus prolixus, Triatoma infestans. vi. Parasites of animal and human.
The pesticidal compositions of the invention are also suitable for controlling parasites which can infest animals and humans . They can be employed alone or in combination with other active compounds for controlling these pests and symptoms related to the infestation of such pests. They are active against sensitive and resistant species and against all developmental stages. These pests include, but are not limited to ticks, lice, mites, strongyles, nematode parasites, such as ascarids (Ascaris) (including Ascaris lumbricoides (Large Roundworm of Man)), filarias, hookworms, pinworms (including Enter obius vermicularis - (The Human Pinworm)) whipworms (Trichuris trichiura), Trichinella spiralis, Dirofilaria immitis
(heartworms ), Haemonchus contortus, and Myrmeconema neotropicum. vii. Fouling pests
The pesticidal compositions of the invention are also suitable for controlling pests which cause fouling of ships and other objects which come into contact with saltwater or brackish water, such as hulls, screens, nets, buildings, moorings and signalling systems, against fouling.
Such fouling includes, but is not limited to, fouling by sessile Oligochaeta, such as Serpulidae, and by shells and species from the Ledamorpha group (goose barnacles), such as various Lepas and Scalpellum species, or by species from the
Balanomorpha group (acorn barnacles), such as Balanus or Pollicipes species, increases the frictional drag of ships and, as a consequence, leads to a marked increase in operation costs owing to higher energy consumption and additionally frequent residence in the dry dock. viii. Pests expressing β-Lacatamase
The invention is based, at least in part, on the discovery that when a pest, e.g., an arthopod, a nematode, an insect, or a parasite, ingests an enzyme-cleavable β-lactamase specific construct, the construct is cleaved by β-lactamases that are produced by the pest, resulting in the release of free photosensitizer within the insect. The pest then dies when exposed to light. In accordance with the invention, the pest is an animal that expresses β -lactamase. In particular embodiments, In accordance with the invention, the pest is an animal that expresses a β -lactamase comprising the protein domain sequence:
ILTEKRKILVDCGDPWNGTQIIQALSKYSLNCDDITDLIITHGHSDHCGNLSLF QQAKIYMGDDMAKDGIYEGIWTLDDFVKIRPTPGHTDRSIIVLDTEYGTVAI VGDIFEEENDDDSWKENSKYPEEQQKSRKIILKEADWIIPGH (SEQ ID NO: 1) (GenBANK protein sequence XP_001891895) or a fragment thereof.
In certain embodiments, the pest expresses a β -lactamase comprising a protein domain of at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO: 1 or a fragment thereof.
In still other embodiments, the pest is an animal that expresses a β -lactamase comprising the protein domain sequence:
TNTYIIGTGKRRILLDAGDENVPEYIGHLKKVISDERILINDIIVSHWHHDHIG GVDEVLDIIENKDSCKVWKFPRADAPDGTIRNANINHLKHGQKFNIEGATLE VLHTPGHTTDHVVLVLHEDNSLFSADCILGEGSTVFEDLYEYTKSLQAIQDA KPSVIYPG (SEQ ID NO: 2) (GenBANK protein sequence XP_001656361) or a fragment thereof.
In certain embodiments, the pest expresses a β -lactamase comprising a protein domain of at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity (e.g. , when compared to the overall length of the protein sequence) to SEQ ID NO: 2 or a fragment thereof.
To determine the percent identity or similarity of two protein domain sequences, the sequences are aligned for optimal comparison purposes (e.g. , gaps can be introduced in the sequence of a first protein sequence for optimal alignment with a second protein sequence). As used herein, the terms "percent identity" and "percent similarity" are used interchangeably.
When a position in the first sequence is occupied by the same amino acid residue as the corresponding position in the second sequence, then the molecules are similar at that position. The percent similarity between the two sequences is a function of the number of similar positions shared by the sequences (i. e. , % identity = # of identical positions/total # of positions x 100), advantageously taking into account the number of gaps and size of said gaps necessary to produce an optimal alignment.
The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. A particular, non- limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Karlin and Altschul (1990) Proc. Natl. Acad. Sci. USA 87:2264-68, modified as in Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-77. Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul et al. (1990) /. Mol. Biol. 215:403-10. BLAST nucleotide searches can be performed with the NBLAST program, score = 100, wordlength = 12 to obtain nucleotide sequences homologous to nucleic acid molecules of the invention. BLAST polypeptide searches can be performed with the XBLAST program, score = 50, wordlength = 3 to obtain amino acid sequences homologous to polypeptide molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al. (1997) Nucleic Acids Research 25(17):3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g. , XBLAST and NBLAST) can be used. See
http://www.ncbi.nlm.nih.gov. Another particular, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller (1988) Comput Appl Biosci. 4: 11-17. Such an algorithm is incorporated into the ALIGN program available, for example, at the
GENESTREAM network server, IGH Montpellier, FRANCE or at the ISREC server. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used.
Alternatively, the percent identity between two protein sequences can be determined using the GAP program in the GCG software package, using either a Blossom 62 matrix or a PAM250 matrix, and a gap weight of 12, 10, 8, 6, or 4 and a length weight of 2, 3, or 4. In other embodiments, percent identity is determined at the polynucleotide level. A β -lactamase polynucleotide is one that encodes a B -lactamase polypeptide. In particular embodiments, a polynucleotide encoding a β -lactamase polypeptide are identified by hybridizing the polynucleotide sequence with a β -lactamase probe. Hybridization conditions are known to those skilled in the art and can be found in Current Protocols in Molecular Biology, Ausubel et ah , eds., John Wiley & Sons, Inc. (1995), sections 2, 4 and 6. Additional stringent conditions can be found in Molecular Cloning: A Laboratory Manual, Sambrook et ah , Cold Spring Harbor Press, Cold Spring Harbor, NY (1989), chapters 7, 9 and 11. A particular, non- limiting example of stringent hybridization conditions includes hybridization in 4X sodium chloride/sodium citrate (SSC), at about 65-70°C (or hybridization in 4X SSC plus 50% formamide at about 42-50°C) followed by one or more washes in IX SSC, at about 65-70°C. A particular, non-limiting example of highly stringent hybridization conditions includes hybridization in IX SSC, at about 65-70°C (or hybridization in IX SSC plus 50% formamide at about 42-50°C) followed by one or more washes in 0.3X SSC, at about 65-70°C. A particular, non-limiting example of reduced stringency hybridization conditions includes hybridization in 4X SSC, at about 50-60°C (or alternatively hybridization in 6X SSC plus 50% formamide at about 40-45°C) followed by one or more washes in 2X SSC, at about 50-60°C. Ranges intermediate to the above-recited values, e.g. , at 65-70°C or at 42-50°C are also intended to be encompassed by the present invention. SSPE (IX SSPE is 0.15 M NaCl, lOmM NaH2P04, and 1.25 mM EDTA, pH 7.4) can be substituted for SSC (IX SSC is 0.15 M NaCl and 15 mM sodium citrate) in the hybridization and wash buffers; washes are performed for 15 minutes each after hybridization is complete. The hybridization temperature for hybrids anticipated to be less than 50 base pairs in length should be 5-10°C less than the melting temperature (Tm) of the hybrid, where Tm is determined according to the following equations. For hybrids less than 18 base pairs in length, Tm(°C) = 2(# of A + T bases) + 4(# of G + C bases). For hybrids between 18 and 49 base pairs in length, Tm(°C) = 81.5 + 16.6(logi0[Na+]) + 0.41(%G+C) - (600/N), where N is the number of bases in the hybrid, and [Na+] is the concentration of sodium ions in the hybridization buffer ([Na+] for IX SSC = 0.165 M). It will also be recognized by the skilled practitioner that additional reagents can be added to hybridization and/or wash buffers to decrease non-specific hybridization to membranes, for example, nitrocellulose or nylon membranes, including but not limited to blocking agents (e.g. , BSA or salmon or herring sperm carrier DNA), detergents (e.g. , SDS), chelating agents (e.g. , EDTA), Ficoll, PVP and the like. When using nylon membranes, in particular, an additional, non- limiting example of stringent hybridization conditions is hybridization in 0.25-0.5M NaH2P04, 7% SDS at about 65°C, followed by one or more washes at 0.02M NaH2P04, 1% SDS at 65°C, see e.g. , Church and Gilbert (1984) Proc. Natl. Acad. Sci. USA 81: 1991-1995, (or, alternatively, 0.2X SSC, 1% SDS). vii. Combinations
The pesticidal compositions of the invention can be used as a mixture with other known active compounds, such as additional pesticide materials, fungicides, insecticides, acaricides, nematicides, bird repellents, plant nutrients and agents which improve soil structure, is also possible. The pesticidal composition of the present invention may include attractants such as cockroach pheromones (e.g., sex attractants, aggregation pheromones) or food-based attractants (e.g.,
methylcyclopentenalone, maltol, fenugreek and other flavorings).
For example, and without limitation, the pesticidal compositions of the invention can be used as a mixture with known acaricides, nematicides or insecticides.
Suitable Insecticides/ Acaricides/Nematicides include, but are not limited to, the following compounds:
abamectin, acephate, acetamiprid, acrinathrin, alanycarb, aldicarb, aldoxycarb, alpha-cypermethrin, alphamethrin, amitraz, avermectin, AZ 60541, azadirachtin, azamethiphos, azinphos A, azinphos M, azocyclotin, Bacillus popilliae, Bacillus sphaericus, Bacillus subtilis, Bacillus thuringiensis, baculoviruses, Beauveria bassiana, Beauveria tenella, bendiocarb, benfuracarb, bensultap, benzoximate, betacyfluthrin, bifenazate, bifenthrin, bioethanomethrin, biopermethrin, bistrifluoron, BPMC, bromophos A, bufencarb, buprofezin, butathiofos, butocarboxim, butylpyridaben, cadusafos, carbaryl, carbofuran, carbophenothion, carbosulfan, cartap, chloethocarb, chlorethoxyfos, chlorfenapyr,
chlorfenvinphos, chlorfluazuron, chlormephos, chlorpyrifos, chlorpyrifos M, chlovaporthrin, chromafenozide, cis-resmethrin, cispermethrin, clocythrin, cloethocarb, clofentezine, clothianidine, cyanophos, cycloprene,
cycloprothrin, cyfluthrin, cyhalothrin, cyhexatin, cypermethrin, cyromazine, deltamethrin, demeton M, demeton S, demeton-S-methyl, diafenthiuron, diazinon, dichlorvos, dicofol, diflubenzuron, dimethoate, dimethylvinphos, dinetofuran, diofenolan, disulfoton, docusat-sodium, dofenapyn, eflusilanate, emamectin, empenthrin, endosulfan, Entomopfthora spp., esfenvalerate, ethiofencarb, ethion, ethiprole, ethoprophos, etofenprox, etoxazole, etrimfos, fenamiphos, fenazaquin, fenbutatin oxide, fenitrothion, fenothiocarb, fenoxacrim, fenoxycarb, fenpropathrin, fenpyrad, fenpyrithrin,
fenpyroximate, fenthion, fenvalerate, fipronil, fluazinam, fluazuron, flubrocythrinate, flucycloxuron, flucythrinate, flufenoxuron, flumethrin, flupyrazofos, flutenzine, fluvalinate, fonophos, fosmethilan, fosthiazate, fubfenprox, furathiocarb, granulosis viruses, halofenozide, HCH, heptenophos, hexaflumuron, hexythiazox, hydroprene, imidacloprid, indoxacarb, isazofos, isofenphos, isoxathion, ivermectin, nuclear
polyhedrosis viruses, lambda-cyhalothrin, lufenuron, malathion, mecarbam, metaldehyde, methamidophos, Metharhizium anisopliae, metharhizium flavoviride, methidathion, methiocarb, methoprene, methomyl,
methoxyfenozide, metolcarb, metoxadiazone, mevinphos, milbemectin, milbemycin, monocrotophos, naled, nitenpyram, nithiazine, novaluron, omethoate, oxamyl, oxydemethon M, Paecilomyces fumosoroseus, parathion A, parathion M, permethrin, phenthoate, phorate, phosalone, phosmet, phosphamidon, phoxim, pirimicarb, pirimiphos A, pirimiphos M, profenofos, promecarb, propargite, propoxur, prothiofos, prothoate, pymetrozine, pyraclofos, pyresmethrin, pyrethrum, pyridaben, pyridathion, pyrimidifen, pyriproxyfen, quinalphos, ribavirin, salithion, sebufos, silafluofen, spinosad, spirodiclofen, sulfotep, sulprofos, tau-fluvalinate, tebufenozide,
tebufenpyrad, tebupirimiphos, teflubenzuron, tefluthrin, temephos, temivinphos, terbufos, tetrachlorvinphos, tetradifon, theta-cypermethrin, thiacloprid, thiamethoxam, thiapronil, thiatriphos, thiocyclam hydrogen oxalate, thiodicarb, thiofanox, thuringiensin, tralocythrin, tralomethrin, triarathene, triazamate, triazophos, triazuron, trichlophenidine, trichlorfon, triflumuron, trimethacarb, vamidothion, vaniliprole, VerticiUium lecanii, YI 5302, zeta-cypermethrin, zolaprofos, (lR-cis)-[5-(phenylmethyl)-3-furanyl]- methyl-3-Rdihydro-2-oxo-3(2H)-furan- ylidene)-methyl]-2,2- dimethylcyclopropanecarboxylate, (3 -phenoxyphenyl) -methyl-2 ,2 , 3,3- tetramethylcyclopropanecarboxylate, l-[(2-chloro-5- thiazolyl)methyl]tetrahydro-3,5-dimethyl-N-nitro-l,- 3,5-triazine-2(lH)- imine, 2-(2-chloro-6-fluorophenyl)-4-[4-(l,l-dimethylethyl)phenyl]-4,5- dihydro-o- xazole, 2-(acetyloxy)-3-dodecyl-l,4-naphthalenedione, 2-chloro- N- [ [ [4- ( 1 -phenylethoxy) -phenyl] - amino] -carbonyl] -benzamide, 2-chloro-N- [ [[4-(2,2-dichloro- 1 , 1 -difluoroethoxy)-phenyl] -amino] -c- arbonyl] - benzamide, 3-methylphenyl propylcarbamate, 4-[4-(4-ethoxyphenyl)-4- methylpentyl]-l-fluoro-2-phenoxybenzene, 4-chloro-2-(l,l-dimethylethyl)- 5-[[2-(2,6-dimethyl-4-phenoxyphenoxy)ethyl- ]thio]-3(2H)-pyridazinone, 4- chloro-2-(2-chloro-2-methylpropyl)-5-[(6-iodo-3-pyridinyl)methoxy]-3(2H- )-pyridazinone, 4-chloro-5 - [(6-chloro-3 -pyridinyl)methoxy] -2-(3 ,4- dichlorophenyl)-3(2H)-p- yridazinone, Bacillus thuringiensis strain EG- 2348, [2-benzoyl-l-(l,l-dimethylethyl)-hydrazinobenzoic acid, 2,2- dimethyl-3-(2,4-dichlorophenyl)-2-oxo-l-oxaspiro[4.5]dec-3-en-4-yl butanoate, [3 - [(6-chloro-3-pyridinyl)methyl] -2-thiazolidinylidene] - cyanamide, dihydro-2-(nitromethylene)-2H-l,3-thiazine-3(4H)- carboxaldehyde, ethyl[2- [[ 1 ,6-dihydro-6-oxo- 1 -(phenylmethyl)-4- pyridazinyl]oxy]ethyl]-car- bamate, N-(3,4,4-trifluoro-l-oxo-3-butenyl)- glycine, N-(4-chlorophenyl)-3 - [4-(difluoromethoxy)phenyl] -4, 5-dihydro-4- phenyl- 1 H- pyrazole- 1 -carboxamide, N- [(2-chloro-5 -thiazolyl)methyl] -N'- methyl-N"-nitro-guanidine, N-methyl-N'-(l-methyl-2-propenyl)-l,2- hydrazinedicarbothioamide, [0295] N-methyl-N'-2-propenyl-l,2- hydrazinedicarbothioamide, 0,0-diethyl-[2-(dipropylamino)-2-oxoethyl]- ethylphosphoramidothioate, N-cyanomethyl-4-trifluoromethyl-nicotinamide, 3,5-dichloro-l-(3,3-dichloro-2-propenyloxy)-4-[3-(5-trifluoromethylpyridi- n-2-yloxy)-propoxy]-benzene.
It is also possible to admix the pesticidal compositions of the invention with other known active compounds, such as herbicides, fertilizers and growth regulators, or safeners or semiochemicals.
IV. Photoactivation
Typically, administration of a pesticidal composition according to the invention is followed by a sufficient period of time to allow accumulation thereof in the pest. The β-lactamase cleavage site of the linker is cleaved by β-lactamase produced by the pest. As a result, the photosensitizers are no longer quenched. The photosensitizers can, subsequently, be activated by irradiation. This is accomplished by applying light of a suitable wavelength and intensity, for an effective length of time, so as to kill the pest. As used herein, "irradiation" refers to the use of light to induced a chemical reaction of a photosensitizer.
Photoactivating dosages depend on various factors, including the amount of the pesticide administered, the wavelength of the photoactivating light, the intensity of the photoactivating light, and the duration of illumination by the photoactivating light. Thus, the dose can be adjusted to a therapeutically effective dose by adjusting one or more of these factors. Such adjustments are within the level of ordinary skill in the art.
Irradiation of the appropriate wavelength for a given compound may be administered by a variety of methods. Methods for irradiation include, but are not limited to, the administration of laser, nonlaser, or broad band light. Irradiation can be produced by extracorporeal or intraarticular generation of light of the appropriate wavelength. Light used in the invention may be administered using any device capable of delivering the requisite power of light including, but not limited to, fiber optic instruments, arthroscopic instruments, or instruments that provide
transillumination. Delivery of the light to a recessed, or otherwise inaccessible physiological location can be facilitated by flexible fiber optics (implicit in this statement is the idea that one can irradiate either a broad field, such as the lung or a lobe of the lung, or a narrow field where bacterial cells may have localized). The source of the light needed to inactivate the pest can be an inexpensive diode laser or a non-coherent light source.
The photosensitizer compositions of the invention should be stable during the course of at least a single round of treatment by continued or pulsed irradiation, during which the photosensitizer within the composition would, preferably, be repeatedly excited to the energized state, undergoing multiple rounds of generation of singlet oxygen.
The suitable wavelength, or range of wavelengths, will depend on the particular photosensitizer(s) used, and can range from about 350 nm to about 550 nm, from about 550 nm to about 650 nm, from about 650 nm to about 750 nm, from about 750 nm to about 850 nm and from about 850 nm to about 950 nm.
In specific embodiments, pests are illuminated with red light. Given that red and/or near infrared light best penetrates animal tissues, photosensitizers with strong absorbances in the range of about 600 nm to about 900 nm are optimal for PDT. For photoactivation, the wavelength of light is matched to the electronic absorption spectrum of the photosensitizer so that the photosensitizer absorbs photons and the desired photochemistry can occur. Wavelength specificity for photoactivation generally depends on the molecular structure of the photosensitizer. Photoactivation can also occur with sub-ablative light doses. Determination of suitable wavelength, light intensity, and duration of illumination is within ordinary skill in the art.
In a particular embodiment, the pest are illuminated with sunlight (i.e. solar radiation). Such exposure can be direct, indirect, focussed or diffused.
The effective penetration depth, 5eff, of a given wavelength of light is a function of the optical properties of the tissue, such as absorption and scatter. The fluence (light dose) in a tissue is related to the depth, d, as: e"d/5eff. Typically, the effective penetration depth is about 2 to 3 mm at 630 nm and increases to about 5 to 6 nm at longer wavelengths (about 700 to about 800 nm) (Svaasand and Ellingsen, (1983) Photochem Photobiol. 38:293-299). Altering the biologic interactions and physical characteristics of the photosensitizer can alter these values. In general, photosensitizers with longer absorbing wavelengths and higher molar absorption coefficients at these wavelengths are more effective photodynamic agents. The light for photoactivation can be produced and delivered to the site of infestation by any suitable means known in the art. Photoactivating light can be delivered to the site of infestation from a light source, such as a laser or optical fiber. Preferably, optical fiber devices that directly illuminate the site of infestation deliver the photoactivating light. For example, the light can be delivered by optical fibers threaded through small gauge hypodermic needles. Light can be delivered by an appropriate intravascular catheter, such as those described in U.S. Patent Nos.
6,246,901 and 6,096,289, which can contain an optical fiber. Optical fibers can also be passed through arthroscopes. In addition, light can be transmitted by
percutaneous instrumentation using optical fibers or cannulated waveguides. For open surgical sites, suitable light sources include broadband conventional light sources, broad arrays of light-emitting diodes (LEDs), and defocused laser beams.
Delivery can be by all methods known in the art, including transillumination. Some photosensitizers can be activated by near infrared light, which penetrates more deeply into biological tissue than other wavelengths. Thus, near infrared light is advantageous for transillumination. Transillumination can be performed using a variety of devices. The devices can utilize laser or non-laser sources, (e.g., lightboxes or convergent light beams).
Where pesticidal activity is desired, the dosage of pesticidal composition, and light activating the photosensitizer composition, is administered in an amount sufficient to produce a phototoxic species effective to kill the pest
Irradiation of the appropriate wavelength for a given compound may be administered by a variety of wavelengths. Methods for irradiation include, but are not limited to, the administration of laser, nonlaser, or broad band light. Irradiation can be produced by extracorporeal or intraarticular generation of light of the appropriate wavelength. Light used in the invention may be administered using any device capable of delivering the requisite power of light including, but not limited to, fiber optic instruments, arthroscopic instruments, or instruments that provide transillumination.
The wavelength and power of light can be adjusted according to standard methods known in the art to control the production of phototoxic species. Thus, under certain conditions (e.g., low power, low fluence rate, shorter wavelength of light or some combination thereof), a fluorescent species is primarily produced from the photosensitizer and any reactive species produced has a negligible effect. These conditions are easily adapted to bring about the production of a phototoxic species. For example, where the photosensitizer is chlorine6, the light dose administered to produce a fluorescent species and an insubstantial reactive species is less than about 10 J/cm, preferably less than about 5 J/cm and more preferably less than about 1 J/cm. Determination of suitable wavelength, light intensity, and duration of illumination for any photosensitizer is within the level of ordinary skill in the art. V. Detection of pests
In certain embodiments, the administration of the compositions of the invention, followed by photoactivation, does not kill the pest but instead results in the pest fluorescing. As such, in certain embodiments, the invention provides a method for detecting the presence of pests, the method comprising the steps of: contacting the pest with a photosensitizer composition of the invention; cleaving one or more moieties cleavable by a6-lactamase expressed by the pest to dequench the photosensitizer composition, light- activating the composition to produce a fluorescent species, thereby causing the pest to fluoresce and observing the fluorescence thereby detecting the presence of pests .
In still other embodiments, the administration of the pesticidal compositions of the invention, followed by photoactivation, results in both the termination of the pest and the pest fluorescing. As such, in certain embodiments, the invention provides a method of eliminating and detecting a pest, the method comprising the steps of: contacting the pest with a photosensitizer composition of the invention; cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition and light- activating the composition to produce a fluorescent, phototoxic species, thereby eliminating the pest and causing the pest to fluoresce and observing the fluorescence thereby also detecting the presence of the pest. The invention is additionally described by way of the following illustrative, non- limiting Examples that provide a better understanding of the present invention and of its many advantages. EXAMPLES
Example 1.
Preparation of Conjugates Comprising Polymer, β-lactam Moiety and
Photosensitizer
In one approach, the synthesis of the conjugates is based on cephalosporin, the most often used β-lactam. It is conceivable to develop penem or carbapenem derivatives subsequently.
In the following, the photosensitizer (a porphyrin molecule with at least one propionic side chain) is represented by PS-CH2-CH2-COOH. The polymer used in the synthetic routes shown below is a linear or branched poly(ethylene glycol) with propionic acid groups (PEG-CH2-CH2-COOH) (Senter, P.D., et al. (1995) Bioconjug. Chem. 6:389-394). However, the chemistry is applicable to similar polymeric materials containing available carboxylic side chains. In order to be released upon enzymatic hydrolysis, the porphyrin molecule is preferably linked at the 3'-position of the cephalosporin. The cephalosporin-porphyrin moiety obtained can then be conjugated to the polymer using the amino group on the β-lactam ring.
The preparation of three different conjugates is proposed, where the porphyrin and cephalosporin are linked via an ester:
Figure imgf000058_0001
or via a carbamate group:
Figure imgf000058_0002
Figure imgf000059_0001
The preparation of a cephalosporin-prophyrin ester comprises the following steps:
A. Protection of the amino-group in the β-lactam ring
There are several ways to protect the amino group. One is represented below
(Hanessian, S., et al. (1993) Can. J. Chem. 71 :896-906):
Figure imgf000059_0002
Protected cephalosporin derivatives are commercially available. Other protecting groups include (Albrecht, H.A., et al, (1990) J. Med. Chem. 33:77-86; Albrecht, H.A., et al. (1991) J. Med. Chem. 34:2857-2864; Alexander, R.P., et al. (1991) Tetrahedron Lett. 32:3269-3272):
Figure imgf000059_0003
For example, the following molecule (which comes with a protected amino group) is called cephalothin.
Figure imgf000059_0004
B. Binding of the porphyrin at the 3 '-position of the cephalosporin via an ester function
i. Through a diazomethyl intermediate (Mobashery, S., et al. (1986) J. Biol. Chem. 261 :7879-7887)
Figure imgf000060_0001
ethyl acetate
Figure imgf000060_0002
C02pNBz Tosyl N2, THF C02pNBz
Figure imgf000060_0003
In this scheme, pNBz = para-nitro-benzyl. ii. Through a halogenated intermediate (Mobashery, S., et al. (1986)
J. Biol. Chem. 261:7879-7887)
Figure imgf000060_0004
iii. Through a hydroxymethyl intermediate (Hanessian, S., et al.
(1993) Can. J. Chem. 71:896-906) RCON
Figure imgf000061_0001
C. Deprotection of the amino-group in the B-lactam ring (Albrecht, H.A., et al. (1991) J. Med. Chem. 34:669-675)
Figure imgf000061_0002
Deprotection of the amino group is also very often carried out using Penicillin-G amidase (PGA) (Vrudhula, V.M., et al. (1995) J. Med. Chem. 38: 1380-1385).
D. Conjugation of the cephalosporin-porphyrin moiety to a polymer (Senter,
P.D., et al. (1995) Bioconjug. Chem. 6:389-394)
Figure imgf000061_0003
The preparation of a cephalosporin-porphyrin carbamate comprises the following steps:
A. Protection of the amino-group in the β-lactam ring (see above)
B. Binding of the porphyrin at the 3 '-position of the cephalosporin via a carbamate i. Direct coupling between the porphyrin and cephalosporin (Alexander, R.P., et al. (1991) Tetrahedron Lett. 32:3269-3272; Rodrigues, M.L., et al. (1995) Chem. & Biol. 2:223-227; Smith, K.M., et al. (1987) Heterocycles 26: 1947-1963)
Figure imgf000062_0001
ii. Coupling through a linker (Alexander, R.P., et al. (1991) Tetrahedron Lett. 32:3269-3272; Rodrigues, M.L., et al. (1995) Chem. & Biol. 2:223-227; Boutorine, A.S., et al. (1996) J. Am. Chem. Soc. 118:9469- 9476)
Figure imgf000063_0001
C. Deprotection of the amino-group in the β-lacatam ring (see above)
D. Conjugation of the cephalosporin-porphyrin moiety to a polymer (Senter, P.D., et al. (1995) Bioconjug. Chem. 6:389-394) (see above)
Of additional note, if, after these chemical modifications, the cephalosporin derivatives described above retain their properties as substrates for β-lactamases, one can expect to observe the enzyme-dependent release of three different porphyrin moieties:
PS-Ch2-CH3:
Figure imgf000063_0002
+ C02 + CH3-CH2-PS
Figure imgf000063_0003
β-lactamase
1b CO, NH2-CH2-CH2-PS and PS-CH2-CH2-CO-NH-(CH2)4-NH2:
β-lactamase
1b + C02 + NH2-(CH2)4-NH-CO-CH2-CH2-PS
Example 2.
Development of Carbamate-linked Photosensitizer,
Inactive (with or without light) While Linked and Light-activatable Only When Released by the β-lactamase Enzyme-mediated Cleavage
The lactam ring opening of the prodrugs releases the photosensitizer and make it light-activatable for photokilling (Figure 1).
Synthesis
Figure imgf000065_0001
7-Aminocephalosporanic acid 7-[(2-Phenylacetyl)amino]
cephalosporanic acid
TBAH / TEA /
water /-20 °C
Toluidine Blue O
Figure imgf000065_0002
Cephaiosporanic acid-Photoserisitt2er
Prodrug
Commercially available 7-aminochephalosporanic acid was reacted with phenylacetyl chloride under Shotten-Baumann reaction conditions to achieve an amino protected chephalosporin molecule. This was further de-esterified using tetrabutylammonium hydroxide as a base to yield easily functionalizable hydroxy end group on cephalosporin. The last step of the synthesis was achieved in a one- pot reaction sequence. Toluidine Blue O (TBO) was converted into its isocynate derivative in the presence of diphosgene. The carbamate-linked prodrug was obtained by adding Cephalosporin derivative to the same reaction mixture.
Synthesis of 7-[(2-phenylacetyl)amino] cephalosporanic acid
To a stirred mixture of sodium bicarbonate (2.1 g, 25 mmol) in water (40ml) and acetone (30ml), added 7-(phenylacetyl)amino cephalosporanic acid. Stirred this solution for nearly 15 min in ice bath and slowly added phenylacetyl chloride (2.5 ml, 20mmol) over the period of 30 min. This reaction mixture was stirred overnight and acidified to pH 2.0 with IN hydrochloric acid. Precipitates obtained were extracted with dichloromethane and washed with water. Dried over magnesium sulphate and solvent evaporated to give off-white solid. The solid sample was stirred overnight in diethyl ether and filters to obtain crude product in 80% yield. Synthesis of 7-[(2-phenylacetyl)amino] 3-hydrodxymethy cephalosporanic acid
To a suspension of 7-[(2-phenylacetyl)amino] cephalosporanic acid (0.5 g, 1.28 mmol) in a a mixture of methane (4ml) and water (2.5 ml), triethylamine (0.21 ml, 1.54 mmol) was added in 15 min at 0-5°C. To this solution,
tetrabutylammonium hydroxide (30% solution in water, 1.53 g, 1.92 mmol) was added at -18°C in 30 minutes. The reaction mixture was maintained at -18°C for nearly 7.0 h and acidified to pH 5.0 using glacial acetic acid. Purification was done using C-18 reverse phase column and pure product was obtained as white solid in 67% yield.
Synthesis of cephalosporanic acid-toluidine blueO Prodrug
To a magnetically stirred suspension of toludine blue O (0.1 g, 0.33 mmol) in anhydrous THF (3ml) under nitrogen was added a solution of tricholoromethyl chloroformate (19.7 μΐ, 0.164 mmol) over activated charcoal as a catalyst. The reaction mixture was stirred at 55 °C for 30 min. Progress of reaction was monitored using mass spectroscopy for formation of isocynate derivative of toludine blue O. Cooled the flask to room temperature and added a solution of 7-[(2- phenylacetyl)amino] 3-hydrodxymethy cephalosporanic acid (0.15 g, 0.33 mmol) in anhydrous dichloromethane (1ml). The reaction flask was cooled to 0°C and slowly added diisopropylethylamine (57.0 μΐ, 0.33 mmol). Stirred for 3.0 h and purified using C18 column with acetonirile and water as eluting solvents. Pure product obtained as a blue solid in 25% yield. NMR spectra were obtained for 7-[(2-phenylacetyl)amino]
cephalosporanic acid in CDCI3 as a solvent, as well as for 7-[(2- phenylacetyl)amino] 3-hydrodxymethy cephalosporanic acid in DMSO-d6 as a solvent (Figure 2). MS spectra were obtained for 7-[(2-phenylacetyl)amino] 3- hydrodxymethy cephalosporanic acid and cephalosporanic acid-toluidine blue O prodrug (Figure 3).
UV- visible spectra revealed blue shift in the absorption spectra of the prodrug, indicating extended conjugation, as well as quenching, of carbamate linked TBO photosensitizer (Figure 4). Fluorescence spectra revealed nearly an 8-fold reduction in fluorescence emission maxima at 635 nm excitation, indicating quantitative quenching of the photosensitizer upon conjugation with the cephalosporin moiety (Figure 5).
Enzyme-mediated cleavage of the prodrugThe, prodrug obtained was further studied for release of photosensitizer in presence of β -lactamase from Enterobacter cloacae. For the fluorescence emission study of the prodrug, the solvent employed was water, and the excitation wavelength 635nm in the presence of beta-lactamase enzyme (from Enterobacter cloacae). Time-dependent fluorescence emission was also measured for photosensitizer release from the prodrug in the presence of enzyme. The results indicate an easy release and nearly 5-fold increase in excited stated properties within minutes of incubation of prodrug with enzyme (Figure 6). Thus, the prodrug was ynthesized and characterized. Furthermore, the prodrug showed quantitative quenching of the photosensitizer in the conjugated form.
Additionally, the product demonstrated lactamase-specific activity.
Example 3.
Cleavage of Carbamate-linked Photosensitizer In microfilaria! B. malayi
Brugia malayi adults and 1st stage larvae (microfilariae) activate the β-LEAP photosensitizer-containing construct by cleavage of the cephalosporin moiety.
(Figure 8)
Groups of 3 adult males, 3 adult females and 10,000 microfilariae were incubated with 10 μΜ β-LEAP in triplicate in the wells of 96 well microtiter plates. Positive control was commercially available Bacillus cereus β-lactamase (0.25
U/ml). Negative controls included reactions lacking worms and reactions lacking β- LEAP. Data was collected by a SpectraMax fluorimeter every minute over a 3 hour period with excitation set at 650 nm and emission at 700 nm. Increasing relative fluorescence resulting from activation of β-LEAP by enzymatic cleavage over the first hour of data collection is shown.
Confocal laser scanning microscopy of Brugia malayi adults and 1st stage larvae following exposure to β-LEAP and 650 nm light. (Figure 9)
Worms recovered from the assay described above were fixed, incubated with RNase and then their nucleic acids stained with propidium iodide. Samples were mounted on glass slides in mounting medium containing DAPI (also stains DNA). Images were acquired using an Olympus FV1000 confocal laser scanning microscope. Images of adult worms are at the region of the reproductive tissue. All images are at 100X magnification and a 50 μιη scale bar is provided for reference. The widespread red coloration indicates fluorescence released from β-LEAP, Blue is fluorescence from DAPI and green is fluorescence from propidium iodide.
Confocal laser scanning microscopy of an adult Brugia malayi female following exposure to β-LEAP and 650 nm light. (Figure 10)
A female worm recovered from the assay described above was fixed, incubated with RNase and then it' s nucleic acids stained with propidium iodide. The worm was mounted on a glass slide in mounting medium containing DAPI (also stains DNA). The images were acquired using an Olympus FV1000 confocal laser scanning microscope. Images are at the region of the reproductive tissue and reveal the intestine. Panel A 20X magnification; Panel B 100X magnification. The widespread red coloration indicates fluorescence released from β-LEAP, Blue is fluorescence from DAPI and green is fluorescence from propidium iodide.
Photodynamic therapy with the photosensitizer EtNBS kills adult Brugia malayi. (Figure 11)
Adult female worms were incubated in 10-fold serial dilutions of EtNBS (the photosensitizer that is released from β-LEAP upon enzymatic cleavage) for 16 hr at 37°C. Worms were pooled into groups of 4 and irradiated with light (600 nm at 33 mW/cm2) for different time periods so as to deliver different light doses. Irradiated worms were then returned to standard culture conditions for 24 hrs and the viability of the 4 individual worms from each condition was assessed by use of the MTT assay. The viability of worms from each group is expressed as absorbance units (510 nm) and standard errors are presented. A dose dependent decrease in viability of worms exposed to 1 μΜ EtNBS is apparent as light dose increases.
Example 4.
Cleavage of Carbamate-linked Photosensitizer In Aedes albopictus
Aedes albopictus cells activate the β-LEAP photosensitizer-containing construct by cleavage of the cephalosporin moiety. (Figure 11) The Aedes albopictus cell line C6/36 was grown to high density in tissue culture flasks and then 1,000,000 cells were transferred to each of 3 wells of a 96 well microtiter plate and incubated with 10 μΜ β-LEAP. Positive control was commercially available Bacillus cereus β-lactamase (0.25 U/ml). Negative controls included reactions lacking cells and reactions lacking β-LEAP. Data was collected by a SpectraMax fluorimeter every minutre over a 3 hour period with excitation set at 650 nm and emission at 700 nm. Increasing relative fluorescence units (RFU) resulting from activation of β-LEAP by enzymatic cleavage over the first hour of data collection is shown. Example 5.
Use of β-LEAP in industrial crops enzymatic cleavage
Exemplary Formulations:
Pellet Formulation
75 parts by mass of sawdust is impregnated with 20 parts by mass of β-LEAP and 5 parts by mass of cornstarch is added thereto and the mixture is molded into bars to obtain a pellet formulation (cylindrical form 5 to 10 mm long having a diameter of about 2 mm).
Flow able (Emulsion) Formulation
5 parts by mass of polyvinyl alcohol, 3 parts by mass of DEMOL N (trade name; manufactured by Kao Corporation), 0.5 parts by mass of ANTIFOAM E-20 (trade name; manufactured by Kao Corporation) and 41.5 parts by mass of water are stirred and mixed. 50 parts by mass of β-LEAP is added thereto by dropwise to obtain a flowable (emulsion) formulation.
Field Trials:
Field trials are run in accordance with pertinent protocols and in conformance with USDA notification requirements.
Field soil is packed in 350 cm2 plastic pots and seedlings of corn, wheat, sorghum, soybean, and tobacco are sown and covered with soil of about 1 cm thickness. After water absorption and at 11 days after seeding, β-LEAP pellets are spread or a β- LEAP flowable formulation is diluted with a stock solution or water were sprayed uniformly in a spray volume of 200 ml per m2. The test is performed in a glass greenhouse box at a temperature of from 18 to 30°C, and the soil is appropriately moistened from the bottom side.
Pests common to each type of plant are introduced into the respective greenhouse box and allowed to ingest the β-LEAP. After 1 hour, the greenhouse boxes are exposed to sunlight or red LED lighting.
The elimination of the pests is observed. Incorporation by Reference
The contents of all references (including literature references, issued patents, published patent applications, and co-pending patent applications) cited throughout this application are hereby expressly incorporated herein in their entireties by reference.
Equivalents
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents of the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.

Claims

WHAT IS CLAIMED IS:
1. A pesticidal composition comprising a pesticidally effective amount of one or more photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by a pest wherein said linked moieties are present in an amount sufficient to quench photoactivation of said photosensitizers and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light-activation.
2. The pesticidal composition of claim 1, wherein the one or more moieties cleavable by the β-lactamase comprise: a cephalosporin, a penicillin, a penem, a carbapenem, a monocyclic mobactem, or a fragment thereof.
3. The photosensitizer composition of claim 2, wherein the one or more
moieties cleavable by the β-lactamase comprises a cephalosporin, a penicillin, or a fragment thereof.
4. The pesticidal composition of claim 3, wherein the cephalosporin or
penicillin fragment comprises a beta-lactam ring.
5. The pesticidal composition of claim 3, wherein the one or more moieties cleavable by β-lactamase is a cephalosporin.
6. The pesticidal composition of claim 5, wherein at least one photosensitizer is bound at the 3' position of a cephalosporin.
7. The pesticidal composition of claim 1, wherein the photosensitizer is a porphyrin.
8. The pesticidal composition of claim 7, wherein the porphyrin is selected from the group consisting of a porfimer sodium, hematoporphyrin IX, hematoporphyrin ester, dihematoporphyrin ester, synthetic diporphyrin, O- substituted tetraphenyl porphyrin, 3,1-meso tetrakis porphyrin,
hydroporphyrin, benzoporphyrin derivative, benzoporphyrin monoacid derivative, monoacid ring derivative, tetracyanoethylene adduct of benzoporphyrin, dimethyl acetylenedicarboxylate adduct of benzoporphyrin, δ- aminolevulinic acid, benzonaphthoporphyrazine, naturally occurring porphyrin, ALA-induced protoporphyrin IX, synthetic dichlorin, bacteriochlorin tetra(hydroxyphenyl) porphyrin, purpurin, octaethylpurpurin derivative, etiopurpurin, tin-etio-purpurin, porphycene, chlorin, chlorin e6, mono-l-aspartyl derivative of chlorin e6, di-l-aspartyl derivative of chlorin e6, tin(IV) chlorin e6, meta-tetrahydroxyphenylchlorin, chlorin e6
monoethylendiamine monamide, verdin, zinc methyl pyroverdin, copro II verdin trimethyl ester, deuteroverdin methyl ester, pheophorbide derivative, pyropheophorbide, texaphyrin, lutetium (III) texaphyrin, and gadolinium(III) texaphyrin.
The pesticidal composition of claim 1, wherein the photosensitizer is a photoactive dye.
The pesticidal composition of claim 9, wherein the photoactive dye is selected from the group consisting of a merocyanine, phthalocyanine, chloroaluminum phthalocyanine, sulfonated aluminum PC, ring-substituted cationic PC, sulfonated AlPc, disulfonated or tetrasulfonated derivative, sulfonated aluminum naphthalocyanine, naphthalocyanine,
tetracyanoethylene adduct, crystal violet, azure β chloride,
benzophenothiazinium, benzophenothiazinium chloride (EtNBS), phenothiazine derivative, rose Bengal, toluidine blue derviatives, toluidine blue O (TBO), methylene blue (MB), new methylene blue N (NMMB), new methylene blue BB, new methylene blue FR, 1,9-dimethylmethylene blue chloride (DMMB), methylene blue derivatives, methylene green, methylene violet Bernthsen, methylene violet 3RAX, Nile blue, Nile blue derivatives, malachite green, Azure blue A, Azure blue B, Azure blue C, safranine O, neutral red, 5-ethylamino-9-diethylaminobenzo[a]phenothiazinium chloride, 5-ethylamino-9-diethylaminobenzo[a]phenoselenazinium chloride, thiopyronine, and thionine.
The pesticidal composition of claim 1, wherein the photosensitizer is selected from the group consisting of a Diels-Alder adduct, dimethyl acetylene dicarboxylate adduct, anthracenedione, anthrapyrazole, aminoanthraquinone, phenoxazine dye, chalcogenapyrylium dye, cationic selena, tellurapyrylium derivative, cationic imminium salt and tetracycline.
12. The composition of claim 1, wherein the composition comprises a one or more of the same photosensitizer.
13. The composition of claim 1, wherein the β -lactamase comprises SEQ ID NO:l or a fragment thereof.
14. The composition of claim 1, wherein the β -lactamase comprises a protein domain having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, identity to SEQ ID NO:l.
15. The composition of claim 1, wherein the β -lactamase comprises SEQ ID NO: 2 or a fragment thereof.
16. The composition of claims 1, wherein the β -lactamase comprises a protein domain having at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, identity to SEQ ID NO:2.
17. A pesticidal composition comprising a pesticidally effective amount of a backbone coupled to one or more photosensitizers and one or more binders effective to quench photoactivation, wherein the binders are connected to the backbone through a one or more moieties cleavable by a β-lactamase expressed by a pest and wherein said one or more photosenitizers are capable of generating a phototoxic species upon dequenching and light- activation.
18. The pesticidal composition of any one of claims 1 to 17, further comprising a pesticidally acceptable carrier or excipient.
19. A method for eliminating a pest from a host, said method comprising the steps of:
contacting the pest with an effective amount of a pesticidal composition of any one of claims 1-18; cleaving one or more moieties cleavable by β-lactamase to dequench the photosensitizer composition; and
light-activating the composition to produce a phototoxic species, thereby eliminating the pest from said host.
20. The method of claim 19, wherien the phototoxic species is also fluorescent.
21. The method of claim 19, wherein the pest is an arthropod, a nematode, or an insect and the host is a plant.
22. The method of claim 21, wherein the arthropod or insect is selected from the group consisting of nematodes, grubs, weevils, borers, aphids, moths, mosquitoes, flies, ticks, termites, beetles, caterpillar, cutworms, earworms, army worms, and bud worms.
23. The method of claim 21, wherein the plant is selected from the group
consisting of corn, maize, wheat, tobacco, cotton, rice, soybean, peanut, sugarcane, hay, sorghum, lettuces, kales, cabbages, fruit trees, and horitcultural flowers.
24. The method of claim 19, wherein the pest is a parasite and the host is an animal.
25. The method of claim 24, wherein the parasite is selected from the group consisting of ticks, lice, mites, ascarids, filarias, hookworms, pinworms, whipworms, strongyles, Trichinella spiralis, Dirofilaria immitis,
Haemonchus contortus, Brugia malayi and Myrmeconema neotropicum.
26. The method of claim 24, wherein the host is a human.
27. A method for eliminating a pest from an industrial material, said method comprising the steps of:
contacting the pest with a pesticidal composition of any one of claims 1-18; cleaving one or more moieties cleavable by β-lactamase to dequench the photosensitizer composition; and
light-activating the composition to produce a phototoxic species, thereby eliminating the pest from said host.
28. The method of claim 27, wherein the pest is selected from the group consisting of beetles, termites, and hymenopterons.
29. The method of claim 27, wherein the industrial material is selected from the group consisting of plastics, adhesives, sizes, paper and card, leather, wood and processed wood products.
30. A method for eliminating a pest from an enclosed space, said method
comprising the steps of:
contacting the pest with a pesticidal composition of any one of claims 1-18; cleaving one or more moieties cleavable by β-lactamase to dequench the photosensitizer composition; and
light-activating the composition to produce a phototoxic species, thereby eliminating the pest from said space.
31. The method of claim 30, wherein the pest is selected from the group
consisting of scorpions, spiders, woodlice, pillbugs, bedbugs, millipedes, centipedes, caterpillars, moths, silverfish, cockroaches, grasshoppers, locusts, flies and mosquitoes.
32. A method for detecting a pest, said method comprising the steps of:
contacting the pest with a quenched photosensitizer composition comprising a plurality of photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein said linked photosensitizers are present in an amount sufficient to quench
photoactivation of said photosensitizers;
cleaving one or more moieties cleavable by the β-lactamase to dequench the photosensitizer composition; and light-activating the composition to produce a fluorescent species, and
detecting the pest by observing the fluorescence, thereby detecting the presence of the pest.
33. The method of claim 32, wherein the florescent species is also phototoxic.
34. A method for controlling an insect pest, the method comprising contacting the pest with an effective amount of a pesticidal composition of any one of claims 1-18;
cleaving one or more moieties cleavable by β-lactamase to dequench the photosensitizer composition; and
light-activating the composition to produce a phototoxic species, thereby controlling the insect pest.
35. The method of claim 34, wherein the insect is Aedes albopictus.
36. A method for controlling a filarial nematode, the method comprising contacting the with worm with an effective amount of a pesticidal composition of any one of claims 1-18;
cleaving one or more moieties cleavable by β-lactamase to dequench the photosensitizer composition; and
light-activating the composition to produce a phototoxic species, thereby controlling the worm.
37. The method of claim 36, wherein the filarial nematode is Wuchereria bancrofti, Brugia malayi, or B. timori.
38. A method for ameliorating filariais in a subject, the method comprising administering to the subject an effective amount of a composition of any one of claims 1-18;
cleaving one or more moieties cleavable by β-lactamase to dequench the photosensitizer composition; and
light-activating the composition to produce a phototoxic species, thereby ameliorating the filariasis.
39. The method of claim 38, wherein the method reduces the filarial load in the subject by at least about 10-25% or more.
40. The method of claim 38, wherein the filariasis is associated with Wuchereria bancrofti, Brugia malayi, and/or B. timori.
41. A method for controlling a fouling pest on an object in contact with saltwater or brackish water, the method comprising contacting the pest with an effective amount of a pesticidal composition of any one of claims 1-18;
cleaving one or more moieties cleavable by β-lactamase to dequench the photosensitizer composition; and
light-activating the composition to produce a phototoxic species, thereby controlling the pest.
42. The method of claim 41, wherein the fouling pest is a goose barnacle, an acorn barnacle or a sessile Oligochaeta.
43. The method of any one of claims 19-42 wherein the light- activation is from exposure to sunlight.
44. The method of any one of claims 19-42 wherein the light- activation is from administration of LED lighting.
45. The method of any one of claims 19-42 wherein the light- activation is from administration of laser lighting.
46. The method of any one of claims 19-42, wherein the composition comprises a beia-lactaraase enzyme-activated-photosensitizer (β-LEAP).
47. A kit for eliminating a pest comprising the pesticidal composition of any one of claims 1 to 18 and instructions for using the pesticidal composition to eliminate the pest.
48. A kit for detecting a pest comprising a photosensitizer composition
comprising one or more photosensitizers that are linked by one or more moieties cleavable by a β-lactamase expressed by the pest, wherein said linked moieties are present in an amount sufficient to quench photoactivation of said photosensitizers and wherein said one or more photosenitizers are capable of generating a fluorescent species upon dequenching and light- activation, and instructions for using the photosensitizer composition to detect the pest.
PCT/US2013/047045 2012-06-22 2013-06-21 β-LACTAMASE TARGETED PHOTOSENSITIZER FOR PESTICIDE AND PEST DETECTION Ceased WO2013192521A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
US14/410,389 US20160073634A1 (en) 2012-06-22 2013-06-21 Beta-lactamase targeted photosensitizer for pesticide and pest detection
US16/013,333 US10874107B2 (en) 2012-06-22 2018-06-20 β-lactamase targeted photosensitizer for pesticide and pest detection

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201261663410P 2012-06-22 2012-06-22
US61/663,410 2012-06-22

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US14/410,389 A-371-Of-International US20160073634A1 (en) 2012-06-22 2013-06-21 Beta-lactamase targeted photosensitizer for pesticide and pest detection
US16/013,333 Continuation US10874107B2 (en) 2012-06-22 2018-06-20 β-lactamase targeted photosensitizer for pesticide and pest detection

Publications (1)

Publication Number Publication Date
WO2013192521A1 true WO2013192521A1 (en) 2013-12-27

Family

ID=49769424

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2013/047045 Ceased WO2013192521A1 (en) 2012-06-22 2013-06-21 β-LACTAMASE TARGETED PHOTOSENSITIZER FOR PESTICIDE AND PEST DETECTION

Country Status (2)

Country Link
US (2) US20160073634A1 (en)
WO (1) WO2013192521A1 (en)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105168560A (en) * 2015-07-22 2015-12-23 贵州谷丰生态农业发展有限责任公司 Method for expelling lice from ear canal of goose
CN109497058A (en) * 2018-12-04 2019-03-22 四川赛华睿科技有限责任公司 A kind of glyphosate synergist of effects enhancing and dose reducing
CN109576233A (en) * 2018-12-03 2019-04-05 中国农业科学院兰州兽医研究所 A kind of tick source property recombinant vaccine
CN109682786A (en) * 2019-01-16 2019-04-26 四川省畜牧科学研究院 The discrimination method of nematode and its application
CN110274972A (en) * 2019-06-21 2019-09-24 海南大学 A method of series connection gel chromatography Dendrobium nobile polysaccharide molecular weight distribution
WO2020150831A1 (en) * 2019-01-25 2020-07-30 Suncor Energy Inc. Photosensitizer compounds, methods of manufacture and application to plants
WO2020163965A1 (en) * 2019-02-15 2020-08-20 Suncor Energy Inc. Photosensitizer and chelating agent combinations for use as insecticides
US11910795B2 (en) 2013-03-15 2024-02-27 Suncor Energy Inc. Natural indole auxin and aminopolycarboxylic acid herbicidal compositions
US12207655B2 (en) 2019-02-15 2025-01-28 Nutrien Ag Solutions (Canada) Inc. Protoporphyrin IX derivatives and use thereof to improve the health of plants
US12396455B2 (en) 2012-06-04 2025-08-26 Nutrien Ag Solutions (Canada) Inc. Formulations containing paraffinic oil and anti-settling agent

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ES2699376T3 (en) 2008-05-05 2019-02-11 Massachusetts Gen Hospital Methods to use enzyme substrates marked with bodipy
WO2019236586A1 (en) * 2018-06-04 2019-12-12 Parasite Id, Llc System and method for identifying the presence of insects
CN114624214B (en) * 2020-12-12 2024-12-03 中国科学院大连化学物理研究所 A paper-based fluorescence method for detecting dicofol
CN112858285B (en) * 2021-02-04 2022-04-29 中南民族大学 Method for visually detecting organochlorine pesticide
KR102561912B1 (en) * 2021-04-09 2023-07-31 차의과학대학교 산학협력단 Cephalothin derivative or pharmaceutically acceptable salt thereof, process for the preparation thereof and composition for preventing hair loss or promoting hair growth comprising the same
KR20240145688A (en) * 2023-03-28 2024-10-07 주식회사 토모큐브 Method and apparatus for detecting mycoplasma using 3d quantitative phase imaging measurement
CN116616283B (en) * 2023-05-09 2025-03-25 武汉轻工大学 An esterase-triggered photodynamic nanopesticide controlled release system and its preparation method

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5514561A (en) * 1992-01-30 1996-05-07 Becton, Dickinson And Company Fluorogenic and chromogenic β-lactamase substrates
US6462070B1 (en) * 1997-03-06 2002-10-08 The General Hospital Corporation Photosensitizer conjugates for pathogen targeting
KR20050007540A (en) * 2002-05-14 2005-01-19 애머샴 바이오사이언시즈 유케이 리미티드 Method for Assessing Biofilms
US20100016208A1 (en) * 2005-11-15 2010-01-21 The General Hospital Corporation Photoactivatable antimicrobial agents

Family Cites Families (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4740459A (en) 1984-08-06 1988-04-26 Washington Research Foundation Fluorescence assay for microbial beta-lactamase
US5408481A (en) 1992-10-26 1995-04-18 The United States Of America As Represented By The Secretary Of The Navy Intracavity sum frequency generation using a tunable laser containing an active mirror
IT1275571B (en) 1995-07-19 1997-08-07 Consiglio Nazionale Ricerche FLUOROGENIC SUBSTRATES SUSCEPTIBLE FOR PHOTOACTIVATION AFTER ENZYMATIC TRANSFORMATION SUITABLE FOR DIAGNOSIS AND PHOTODYNAMIC CANCER THERAPY
US5955604A (en) 1996-10-15 1999-09-21 The Regents Of The University Of California Substrates for β-lactamase and uses thereof
US6727356B1 (en) 1999-12-08 2004-04-27 Epoch Pharmaceuticals, Inc. Fluorescent quenching detection reagents and methods
US20040115207A1 (en) 1999-12-09 2004-06-17 Irwin Bernstein D Bioconjugates and uses thereof
US6587487B2 (en) 2000-12-19 2003-07-01 Photonics Industries International, Inc. Harmonic laser
US6940888B2 (en) 2002-11-21 2005-09-06 New Wave Research Dual head laser system with intra-cavity polarization, and particle image velocimetry system using same
WO2005071096A2 (en) 2004-01-21 2005-08-04 Molecular Probes, Inc. Derivatives of cephalosporin and clavulanic acid for detecting beta-lacamase in a sample
US7741128B2 (en) 2005-05-23 2010-06-22 University Of Hawaii Cooperative reporter systems, components, and methods for analyte detection
US7867951B2 (en) 2005-11-14 2011-01-11 Stepan Company Viscoelastic cationic carbohydrate ether compositions
CN101317310B (en) 2005-12-06 2010-12-08 伊雷克托科学工业股份有限公司 Simultaneously mode-locked Q-switched laser systems
ES2699376T3 (en) 2008-05-05 2019-02-11 Massachusetts Gen Hospital Methods to use enzyme substrates marked with bodipy
WO2011109753A1 (en) 2010-03-05 2011-09-09 TeraDiode, Inc. Wavelength beam combining based pump / pulsed lasers

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5514561A (en) * 1992-01-30 1996-05-07 Becton, Dickinson And Company Fluorogenic and chromogenic β-lactamase substrates
US6462070B1 (en) * 1997-03-06 2002-10-08 The General Hospital Corporation Photosensitizer conjugates for pathogen targeting
KR20050007540A (en) * 2002-05-14 2005-01-19 애머샴 바이오사이언시즈 유케이 리미티드 Method for Assessing Biofilms
US20100016208A1 (en) * 2005-11-15 2010-01-21 The General Hospital Corporation Photoactivatable antimicrobial agents

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12396455B2 (en) 2012-06-04 2025-08-26 Nutrien Ag Solutions (Canada) Inc. Formulations containing paraffinic oil and anti-settling agent
US11910795B2 (en) 2013-03-15 2024-02-27 Suncor Energy Inc. Natural indole auxin and aminopolycarboxylic acid herbicidal compositions
CN105168560A (en) * 2015-07-22 2015-12-23 贵州谷丰生态农业发展有限责任公司 Method for expelling lice from ear canal of goose
CN109576233A (en) * 2018-12-03 2019-04-05 中国农业科学院兰州兽医研究所 A kind of tick source property recombinant vaccine
CN109497058A (en) * 2018-12-04 2019-03-22 四川赛华睿科技有限责任公司 A kind of glyphosate synergist of effects enhancing and dose reducing
CN109682786B (en) * 2019-01-16 2021-11-12 四川省畜牧科学研究院 Method for identifying haemonchus contortus eggs and application thereof
CN109682786A (en) * 2019-01-16 2019-04-26 四川省畜牧科学研究院 The discrimination method of nematode and its application
CN113677685A (en) * 2019-01-25 2021-11-19 桑科能源股份有限公司 Photosensitizer compounds, preparation method and application in plants
EP3914598A1 (en) 2019-01-25 2021-12-01 Suncor Energy Inc. Photosensitizer compounds, methods of manufacture and application to plants
JP2022523034A (en) * 2019-01-25 2022-04-21 サンコー・エナジー・インコーポレイテッド Photosensitizer compounds, manufacturing methods and plant applications
EP3914598A4 (en) * 2019-01-25 2022-11-02 Suncor Energy Inc. PHOTOSENSITIZER COMPOUNDS, METHODS OF MAKING AND APPLICATION TO PLANTS
WO2020150831A1 (en) * 2019-01-25 2020-07-30 Suncor Energy Inc. Photosensitizer compounds, methods of manufacture and application to plants
JP7588285B2 (en) 2019-01-25 2024-11-22 ニュートリエン・エージー・ソリューションズ・(カナダ)・インコーポレイテッド Photosensitizer compounds, methods of manufacture and applications in plants
CN113677685B (en) * 2019-01-25 2025-03-04 桑科能源股份有限公司 Photosensitizer compound, preparation method and application in plants
US12583872B2 (en) 2019-01-25 2026-03-24 Nutrien Ag Solutions (Canada) Inc. Photosensitizer compounds, methods of manufacture and application to plants
WO2020163965A1 (en) * 2019-02-15 2020-08-20 Suncor Energy Inc. Photosensitizer and chelating agent combinations for use as insecticides
US12207655B2 (en) 2019-02-15 2025-01-28 Nutrien Ag Solutions (Canada) Inc. Protoporphyrin IX derivatives and use thereof to improve the health of plants
CN110274972A (en) * 2019-06-21 2019-09-24 海南大学 A method of series connection gel chromatography Dendrobium nobile polysaccharide molecular weight distribution

Also Published As

Publication number Publication date
US20200154710A1 (en) 2020-05-21
US20160073634A1 (en) 2016-03-17
US10874107B2 (en) 2020-12-29

Similar Documents

Publication Publication Date Title
US10874107B2 (en) β-lactamase targeted photosensitizer for pesticide and pest detection
CA2409206C (en) Active substance combinations having insecticidal and acaricidal properties
KR100870174B1 (en) Active substance combination having insecticidal and acaricide properties
KR100798733B1 (en) Phenyl-substituted 5,6-dihydropyrone derivatives for use as pesticides and herbicides
KR100854583B1 (en) Pyrazolyl pyrimidine
KR20060110355A (en) Cis-alkoxyspiro-substituted tetramic acid derivatives
KR20060097136A (en) 2-ethyl-4,6-dimethylphenyl-substituted tetramic acid derivatives as pest control and / or herbicides
KR100969572B1 (en) Spirocyclic 3-phenyl-3-substituted 4-ketoractams and 4-ketolactones
US6806292B2 (en) Substituted imide derivatives
KR100758624B1 (en) Phenyl substituted 4-hydroxy tetrahydropyridone
KR20030076642A (en) Pyridyl pyrimidines for use as pesticides
KR20070054700A (en) Optically active phthalamide
KR20070041545A (en) Phenyl substituted [1.2] -oxazine-3,5-dione and dihydropyron derivatives
KR20070098901A (en) Alkynyl-oxypyrimidines used in the form of pesticides
KR20040083482A (en) Delta1-pyrrolines
KR20050094858A (en) 3-phenyl substituted 3-substituted-4-ketolactams and ketolactones
KR100926514B1 (en) Halogenated nitrobutadienes for controlling animal pests
KR100821520B1 (en) Delta 1-pyrroline used as pestiside
KR20040012962A (en) Heterocyclic amide derivatives
KR100838689B1 (en) Phthalate diamide, process for its preparation and use as an insecticide
CA2422584A1 (en) Use of riboflavin and flavin derivatives as chitinase inhibitors
KR100930072B1 (en) Δ1-pyrroline
KR20040082436A (en) Substituted 4-pyrazolyl pyrazolines used for pest control
MX2007002313A (en) Optically active phthalamides

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13806890

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2015518609

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

NENP Non-entry into the national phase

Ref country code: JP

122 Ep: pct application non-entry in european phase

Ref document number: 13806890

Country of ref document: EP

Kind code of ref document: A1