WO2013187724A1 - Novel antibody specific for clec14a and uses thereof - Google Patents

Novel antibody specific for clec14a and uses thereof Download PDF

Info

Publication number
WO2013187724A1
WO2013187724A1 PCT/KR2013/005272 KR2013005272W WO2013187724A1 WO 2013187724 A1 WO2013187724 A1 WO 2013187724A1 KR 2013005272 W KR2013005272 W KR 2013005272W WO 2013187724 A1 WO2013187724 A1 WO 2013187724A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
clec14a
amino acid
chain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2013/005272
Other languages
French (fr)
Inventor
Suk Mook Lee
Min Kyoung KI
Mee Hyun JEOUNG
Jong Rip Choi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Scripps Korea Antibody Institute
Original Assignee
Scripps Korea Antibody Institute
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Scripps Korea Antibody Institute filed Critical Scripps Korea Antibody Institute
Priority to US14/407,756 priority Critical patent/US9751933B2/en
Priority to KR1020157000309A priority patent/KR101760465B1/en
Priority to EP13805033.1A priority patent/EP2861623A4/en
Priority to CN201380043426.9A priority patent/CN104903350B/en
Priority to JP2015517188A priority patent/JP6129305B2/en
Publication of WO2013187724A1 publication Critical patent/WO2013187724A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6843—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a material from animals or humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00—Drugs for disorders of the urinary system
    • A61P13/12—Drugs for disorders of the urinary system of the kidneys
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/02—Drugs for dermatological disorders for treating wounds, ulcers, burns, scars, keloids, or the like
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P27/00—Drugs for disorders of the senses
    • A61P27/02—Ophthalmic agents
    • A61P27/06—Antiglaucoma agents or miotics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/02—Antineoplastic agents specific for leukemia
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A61P35/04—Antineoplastic agents specific for metastasis
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/7056—Lectin superfamily, e.g. CD23, CD72
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
    • C07K7/04—Linear peptides containing only normal peptide links
    • C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/7056—Selectin superfamily, e.g. LAM-1, GlyCAM, ELAM-1, PADGEM

Definitions

  • the present invention relates to a novel antibody specifically binding to the C-type lectin domain family 14, member A (clec14a) and uses thereof. More particularly, the present invention relates to an antibody specifically binding to the C-type lectin like domain (CTLD) of clec14a, a method for preparing the antibody, a composition for the suppression of angiogenesis comprising the antibody, a method for suppressing angiogenesis by administering the antibody or the composition, a composition for preventing or treating cancer comprising the antibody, a method for treating cancer by administering the antibody or the composition, a composition for diagnosing cancer comprising the antibody, a kit for diagnosing cancer comprising the composition, a method for diagnosing cancer using the composition, a composition for the suppression of angiogenesis comprising a material for inhibiting expression of clec14a, a kit for angiogenesis comprising the composition, a method for suppressing angiogenesis or treating cancer using the composition, and the use of the CTLD of clec14a as an epitope for an antibody suppressive of an
  • Tumor angiogenesis plays an important role in tumor progression.
  • vascular endothelial growth factor (VEGF) and epidermal growth factor receptor (EGFR) are key factors in angiogenesis, and targeting angiogenesis has become a promising strategy for cancer treatment.
  • the anti-VEGF antibody bevacizumab has been used to treat patients with metastatic colorectal cancer, renal cell carcinoma, non-small-cell lung cancer, and malignant brain glioma.
  • Cetuximab an anti-EGFR antibody, may inhibit endothelial cell to cell contact and expression of angiogenic factors such as VEGF, interleukin-8, and basic fibroblast growth factor.
  • tumor-secreted angiogenic factors including placental growth factor, angiopoietin, basic fibroblast growth factor, and hepatocyte growth factor
  • these drugs generate a resistant phenotype in tumors (Kopetz S, et al., Phase II trial of infusional fluorouracil, irinotecan, and bevacizumab for metastatic colorectal cancer: efficacy and circulating angiogenic biomarkers associated with therapeutic resistance. Journal of Clinical Oncology.28(3):453-9; Lucio-Eterovic AK, et al., Mediators of glioblastoma resistance and invasion during antivascular endothelial growth factor therapy. Clinical Cancer Research. 2009;15(14):4589-99).
  • VEGF receptor VEGFR
  • angiopoietin-2 angiopoietin-2
  • bevacizumab and cetuximab are therapeutic antibodies that suppress angiogenesis by inhibiting interaction of soluble angiogenic growth factors and their receptors.
  • long-term use of these drugs generates a resistant tumor phenotype due to redundancy of tumor cell-secreted pro-angiogenic growth factors. This may pose the greatest challenge to use of antibodies against soluble growth factors in patients requiring long-term therapy.
  • Clec14a is a type I transmembrane protein, the extracellular domain of which consists of a C-type lectin-like domain (CTLD), a series of epidermal growth factorlike domains, and a sushi-like domain.
  • CTL C-type lectin-like domain
  • clec14a is endothelial cell-specific and may play a key role in cell to cell contact in angiogenesis (Rho SS, et al., Clec14a is specifically expressed in endothelial cells and mediates cell to cell adhesion. Biochemical & Biophysical Research Communications.404(1):103-8).
  • clec14a is critical for regulating pro-angiogenic phenotypes associated with filopodium formation, cell migration, and endothelial tube formation; this group also identified clec14a as a tumor endothelial cell marker not expressed on the endothelium of normal tissues (Mura M, et al., Identification and angiogenic role of the novel tumor endothelial marker CLEC14A. Oncogene.31(3):293-305).
  • clec14a Despite increasing interest in clec14a in recent years, its molecular mechanism has not been clearly identified. Studies on the functional portion or domain of cle14a which accounts for the angiogenesis must be conducted so as to excavate and develop clinically applicable antibodies. In this context, there is a pressing demand for a monoclonal antibody that specifically binds mouse and human clec14a and that is convertible into a humanized antibody or human antibody for preclinical and clinical study. Preferably, an antibody which is clinically applicable to the inhibition of tumor angiogenesis and thus to the treatment of cancer is needed. In addition, a novel part which suppresses tumor angiogenesis is needed to identify and thus further the suppression of angiogenesis and treatment of cancer.
  • the present inventors first identified CTLD functions in cell migration and filopodium formation, which are key events of angiogenesis. Using phage display technology the present inventors developed recombinant human antibodies against human and mouse clec14a CTLDs. Functional assays showed that the antibodies specifically inhibited endothelial cell migration and tube formation without affecting viability or activation. Finally, the present inventors propose a mechanism of action, whereby the antibodies may inhibit angiogenesis by modulating CTLD-mediated cell to cell interaction and down-regulating clec14a expression on the surface of endothelial cells. These results demonstrate the functional significance of CTLD in angiogenesis and the potential of CTLD-specific human antibodies to block clec14a-mediated tumor angiogenesis.
  • the present invention provides an antibody which binds specifically to clec14a (C-type lectin domain family 14, member A).
  • the present invention also provides a nucleic acid encoding said antibody.
  • the present invention also provides a vector comprising said nucleic acid.
  • the present invention also provides a host cell comprising said vector or said nucleic acid.
  • the present invention also provides a method of producing said antibody, comprising culturing said host cell such that the nucleic acid is expressed to produce the antibody.
  • the present invention also provides an antibody-drug conjugate comprising said antibody attached to a drug.
  • the present invention also provides a pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising said antibody.
  • the present invention also provides a use of said antibody for preparation of a pharmaceutical composition for preventing or treating angiogenesis-related disease.
  • the present invention also provides said antibody for use in preventing or treating angiogenesis-related disease.
  • the present invention also provides a method for treating angiogenesis-related disease, comprising administering said antibody or said pharmaceutical composition to a subject in need thereof.
  • the present invention also provides a composition for the suppression of angiogenesis, comprising said antibody.
  • the present invention also provides a use of said antibody for preparation of a composition for suppression of angiogenesis.
  • the present invention also provides said antibody for use in suppression of angiogenesis.
  • the present invention also provides a method for suppressing angiogenesis, comprising administering said antibody or said pharmaceutical composition to a subject in need thereof.
  • the present invention also provides a diagnostic composition for angiogenesis-related disease, comprising said antibody.
  • the present invention also provides a use of said antibody for preparation of a diagnostic composition for angiogenesis-related disease.
  • the present invention also provides said antibody for use in in-vitro diagnosis of angiogenesis-related disease.
  • the present invention also provides a diagnostic kit for angiogenesis-related disease, comprising said diagnostic composition.
  • the present invention also provides a method for diagnosing angiogenesis-related disease, comprising detecting clec14a through antigen-antibody complexes in an isolated biological sample from a subject with suspected angiogenesis-related disease.
  • the present invention also provides a polypeptide, comprising isolated CTLD of clec14a, serving as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
  • the present invention also provides a polypeptide, comprising isolated N-terminal or C-terminal of CTLD of clec14a as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
  • the present invention also provides a polypeptide, comprising an amino acid fragment from 1st amino acid to 42nd amino acid in CTLD of clec14a or a amino acid fragment from 122nd amino acid to 142nd amino acid in CTLD of clec14a as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
  • the present invention also provides a method for preparing an antibody binding specifically to clec14a (C-type lectin domain family 14, member A), comprising: biopanning using said polypeptide as an epitope.
  • the present invention also provides a composition for suppressing angiogenesis, comprising a material for inhibiting the expression of clec14a.
  • the present invention also provides a kit for suppressing angiogenesis, comprising said composition.
  • the present invention also provides a method for suppressing angiogenesis, comprising administering said composition to a subject in need thereof.
  • the present invention also provides a method for treating angiogenesis-related disease, comprising administering said composition to a subject in need thereof.
  • the present invention also provides a use of said material for inhibiting the expression of clec14a for preparation of a composition for suppressing of angiogenesis.
  • the present invention also provides said material for inhibiting the expression of clec14a for use in suppression of angiogenesis.
  • the present invention also provides a pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising fusion protein of CTLD of clec14a and Fc.
  • the present invention also provides a use of said fusion protein of CTLD of clec14a and Fc for preparation of a pharmaceutical composition for preventing or treating angiogenesis-related disease.
  • the present invention also provides said fusion protein of CTLD of clec14a and Fc for use in preventing or treating angiogenesis-related disease.
  • the present invention also provides a method for treating angiogenesis-related disease, comprising administering said fusion protein of CTLD of clec14a and Fc or said pharmaceutical composition to a subject in need thereof.
  • Figure 1 shows the effect of clec14a CTLD in cell migration.
  • a Migration of COS-7 cells transfected with GFP, clec14a-GFP, or clec14a ⁇ CTLD-GFP in the wound healing assay was monitored under a light microscope. Images were captured at 0 hr (top) and 20 hr (bottom).
  • b Distance migrated is expressed as percent of control migration. Values represent mean ⁇ SD of triplicate measurements from one of three independent experiments.
  • Figure 2 shows the effect of clec14a CTLD on filopodium formation.
  • COS-7 cells (a) and HUVECs (b) transfected with GFP, clec14a-GFP, and clec14a ⁇ CTLD-GFP were fixed, stained with rhodamine-phalloidin and Hoechst, and examined by fluorescence microscopy (1000 ⁇ ). Arrows indicate regions of filopodium formation. Results are representative of three independent experiments.
  • Figure 3 shows isolation of scFv clones specific to human and mouse CTLDs.
  • a human synthetic scFv antibody library was precleared of Fc binders and screened by alternative biopanning with recombinant hCTLD-Fc or mCTLD-Fc.
  • b-d Ninety-six phage clones (1-96) displaying scFv were randomly selected and the supernatants were analyzed by phage ELISA. Reactivity of the selected scFv clones to human and mouse CTLDs was assayed by measuring absorbance at 450 nm. Arrows indicate scFv clones reactive to hCTLD-Fc ( ⁇ , black) and mCTLD-Fc ( ⁇ , grey), and not reactiv to Fc ( ⁇ ). BSA ( ⁇ ) served as a background control.
  • Figure 4 shows cross-species reactivity of clec14a-CTLD IgGs to human and mouse CTLDs.
  • ELISA was performed with purified, selected IgG scFv clones (clones 1-4) on 96-well microtiter plates coated with hCTLD-Fc ( ⁇ , black), mCTLD-Fc ( ⁇ , grey), and Fc ( ⁇ ).
  • BSA ( ⁇ ) served as a background control. Values represent mean ⁇ SD of triplicate measurements from one of two independent experiments.
  • Figure 5. shows the effect of clec14a-CTLD IgGs on endothelial cell migration and tube formation.
  • b. Distance migrated is expressed as percent of control (MOCK) migration. Values represent mean ⁇ SD of triplicate measurements from one of three independent experiments.
  • Figure 6. shows the effect of clec14a-CTLD IgGs on endothelial cell proliferation and activation.
  • HUVECs were incubated in the absence (MOCK) or presence of clec14a-CTLD IgGs, cetuximab, or 5-FU (positive control) for 2 days. Cell viability was assessed by measuring absorbance at 450 nm. Values represent mean ⁇ SD of triplicate measurements from one of two independent experiments.
  • HUVECs were cultured in the absence (dashed line) or presence (solid line) of hTNF ⁇ , clec14a-CTLD IgGs, or cetuximab; stained with anti-VCAM-1 (upper) or ICAM-1 (lower) polyclonal antibody; and analyzed by flow cytometry.
  • hTNF ⁇ served as a positive control for endothelial cell activation. Results are representative of three independent experiments.
  • Figure 7 shows the effect of clec14a-CTLD IgGs on clec14a-mediated cell-cell contact.
  • a HEK293F cells transfected with GFP and clec14a-GFP were incubated in the absence (MOCK) or presence of clec14a-CTLD IgGs or cetuximab for 8 hr.
  • Cell aggregates (mass >4 cells; arrowheads) were counted under a optical microscope. The number of aggregates per field is shown in b. Values represent mean ⁇ SD of triplicate measurements from one of three independent experiments.
  • Figure 8. shows the effect of clec14a-CTLD IgG on CTLD-CTLD interaction.
  • a Lysates of COS-7 cells transfected with GFP, clec14a-GFP, or clec14a ⁇ CTLD-GFP were analyzed by immunoblotting with anti-GFP or anti- ⁇ -actin antibody.
  • b COS-7 cells expressing GFP (white), clec14a-GFP (black), or clec14a ⁇ CTLD-GFP (light gray) were incubated with 0.15 ⁇ g hCTLD-Fc or Fc and CTLD-CTLD interaction was measured by ELISA.
  • c c.
  • Lysates of COS-7 cells transfected with GFP or clec14a-GFP were incubated with hCTLD-Fc that had been pre-incubated with increasing concentrations of clec14a-CTLD IgG (clone 1). Values represent mean ⁇ SD of triplicate measurements from one of three independent experiments.
  • Figure 9. shows the effect of clec14a-CTLD IgG on the down-regulation of clec14a on the surface of endothelial cells.
  • a Fixed and unfixed HUVECs were incubated in the presence (dotted line) or absence (solid line) of a clec14a-CTLD IgG (clone 1) and analyzed by flow cytometry.
  • b Clec14a on the surface of HUVECs incubated with clec14a-CTLD IgG (white) or Fc (black) for the indicated time was was assayed by cell ELISA. Values represent mean ⁇ SD of triplicate measurements from one of three independent experiments.
  • Figure 10 shows the specificity of clec14a-CTLD IgGs to partial fragment of CTLD of clec14a.
  • a fusion proteins of Fc and partial fragment of CTLD of clec14a.
  • b the graph showing specificity of clec14a-CTLD IgGs of both clone 1 (upper graph) and clone 2 (lower graph) to the fusion proteins of Fc and partial fragment of CTLD of clec14a, wtCTLD-Fc and Fc, respectivity.
  • Figure 11 is a graph showing the inhibitory effect of hCTLD-Fc on tube formation.
  • the present invention provides an antibody binding specifically to clec14a (C-type lectin domain family 14, member A).
  • the antibody may be an antibody binding specifically to CTLD (C-type lectin like domain) of clec14a (C-type lectin domain family 14, member A).
  • antibody means a protein molecule which comprises an immunoglobulin molecule immunologically reactive to a certain antigen, serving as a receptor specifically recognizing the antigen, and is intended to encompass polyclonal antibodies, monoclonal antibodies, whole antibodies and antibody fragments.
  • chimeric antibodies e.g., humanized murine antibodies
  • bivalent or bispecific molecules e.g., bispecific antibodies
  • diabodies, triabodies, and tetrabodies fall within the scope of the antibody useful in the present invention.
  • a whole antibody consists of two full-length light chains and two full-length heavy chains, with disulfide bonds between the light and heavy chains.
  • antibody fragment refers to a fragment which retains at least the antigen-binding function, and may include Fab, F(ab'), F(ab')2, and Fv.
  • Fab is composed of one variable region of each of the heavy and the light chain, the constant domain of the light chain, and the first constant domain (CH1) of the heavy chain, with an antigen binding site.
  • Fab' is different from Fab in that it further comprises at least one cysteine residue at the C-terminus of the CH1 domain of the heavy chain.
  • F(ab')2 consists of two molecules of Fab' with a disulfide bond between the cysteine residues of the hinge region.
  • Fv (variable fragment) composed of one variable region of each of the heavy and the light chain, is the smallest antibody fragment containing the original specificity of the parent immunoglobulin.
  • Disulfide-stabilized Fv (dsFv) is formed by linking the variable region of the heavy chain to the variable region of the light chain via a disulfide bond.
  • Single chain Fv is an Fv in which the respective variable regions of the heavy and the light chain are covalently connected by a peptide linker.
  • These antibody fragments can be obtained using proteases (for example, digestion of a whole antibody with papain or pepsin affords Fab or F(ab')2, respectively), and preferably may be constructed by genetic recombination technology.
  • monoclonal antibody refers to an antibody molecule with a uniform molecular composition, obtained from a substantially identical population of antibodies, which shows binding specificity and affinity for a single epitope.
  • an immunoglobulin has a basic structural unit composed two heavy and two light chains.
  • Each heavy chain comprises one variable region (also known as “region") and three constant domains while each light chain is composed of one variable region and one constant domain.
  • the variable region of each of the light and the heavy chain comprises three complementarity-determining regions (hereinafter referred to as "CDRs") and four framework regions.
  • CDRs function to bind to an epitope of an antibody.
  • CDRs on each chain start from the N terminus and are arranged sequentially as CDR1, CDR2, and CDR3. They are discriminated by the chain on which they are positioned.
  • human antibody is a molecule which consists entirely of the amino acid sequence of all components of human immunoglobulin, including CDRs, framework regions, and the like.
  • human antibodies In the therapy of human diseases, human antibodies have at least three potential advantages.
  • human antibodies more preferably interact with the human immune system to more effectively destroy target cells by, for example, complement-dependent cytotoxicity (CDC) or antibodydependent cell-mediated cytotoxicity (ADCC).
  • CDC complement-dependent cytotoxicity
  • ADCC antibodydependent cell-mediated cytotoxicity
  • Another advantage is that the human immune system does not recognize human antibodies as foreign molecules.
  • the half-lives of human antibodies are similar to those of naturally occurring antibodies in the human circulatory system even when they are administered in smaller doses or with less frequency.
  • the antibody according to the present invention may be preferably a human monoclonal antibody that can be useful for the therapy of angiogenesis-related diseases or cancer not only because it has potent affinity for clec14a, preferably clec14a-CTLD expressed on human endothelial cells which effectively inhibits clec14a-mediated angiogenesis, but also because it shows low immunogenicity because both of its heavy and light chains are derived from a human.
  • clec14a C-type lectin domain family 14, member A
  • CTL/CTLD C-type lectin-like domain
  • Clec14a is a type I transmembrane protein, the extracellular domain of which consists of a C-type lectin-like domain (CTLD), a series of epidermal growth factor-like domains, and a sushi-like domain.
  • Information about clec14a may be obtained from a public database such as NCBI GenBank.
  • human clec14a may have Gene ID No 161198, but is not limited thereto.
  • Clec14a is known to be involved in cell to cell adhesion and angiogenesis, but its concrete mechanism and substantial domains responsible for angiogenesis have remained unidentified. It is the present inventors that first found that CTLD, a domain stretching from amino acids 31st to amino acids 172nd on the amino acid sequence of cle14a, plays a key role in angiogenesis.
  • C-type lectin-like domain (CTLD) of clec14a (C-type lectin domain family 14, member A), is interchangeable with the term “clec14a-CTLD” or "clec14a CTLD”.
  • the present invention provides an isolated polypeptide of clec14a (C-type lectin domain family 14, member A)-CTLD (C-type lectin like domain) as an epitope available for the suppression of angiogenesis.
  • clec14a may be derived from human, chimpanzee or mouse.
  • epitope refers to the part of an antigen that determines antigen specificity, and may be interchangeably used with an antigenic determinant or an antigen determining site.
  • the epitope refers to CTLD having an amino acid sequence stretching from amino acids 31st to amino acids 172nd on the amino acid sequence of clec14a, which is available for the suppression of angiogenesis, or may refer to a polypeptide having the same function with the CTLD.
  • CTLD having an amino acid sequence stretching from amino acids 31st to amino acids 172nd on the amino acid sequence of clec14a, which is available for the suppression of angiogenesis, or may refer to a polypeptide having the same function with the CTLD.
  • the extra region of CTLD may be included.
  • any polypeptide for example, having an identity of 80%, 85%, 90%, 95%, 98% or 99% or higher with the amino acid sequence, may be used as the epitope.
  • Amino acid sequences of human, mouse and chimpanzee CTLDs, stretching from amino acids 31st to amino acids 172nd, are given in Table 1, and named SEQ ID NOS: 9, 10, and 133, respectively.
  • the present inventors first found that the amino acid sequences of SEQ ID NOS: 9, 10 and 133 can serve as epitopes which can be used to produce antibodies suppressive of angiogenesis.
  • the N-terminal or C-terminal region of CTLD can serve as epitopes which can be used to produce antibodies suppressive of angiogenesis (Fig. 10b).
  • the N-terminal region of CTLD may be a region comprising an amino acid fragment from 1st amino acid to 42nd amino acid in CTLD or an amino acid fragment from 1st amino acid to 62nd amino acid in CTLD.
  • the C-terminal region of CTLD may be a region comprising an amino acid fragment from 82nd amino acid to 142nd amino acid in CTLD, an amino acid fragment from 62nd amino acid to 142nd amino acid in CTLD, or an amino acid fragment from 122nd amino acid to 142nd amino acid in CTLD.
  • the antibodies may bind specifically to clec14a-CTLD or its effective fragments to inhibit angiogenesis
  • clec14a-CTLD is a unique domain that regulates angiogenesis in a CTLD-CTLD interaction-dependent manner.
  • clec14a-CTLD particularly amino acids 31-172
  • clec14a-CTLD IgG specifically suppresses clec14a-mediated cell-cell contacts.
  • clec14a modulation by clec14a-CTLD IgG specifically inhibited HUVEC migration and tube formation.
  • formation of clec14a CTLD-CTLD complexes was specifically inhibited by clec14a-CTLD IgG.
  • clec14a-CTLD IgGs specifically inhibited endothelial cell migration and tube formation without affecting cell viability and activation.
  • clec14a is expressed exclusively on endothelial cells and may be a specific, tumor endothelial cell marker. It is reasonable to speculate that the clec14a-CTLD antibodies might have fewer adverse effects in normal endothelium, target clec14a expressed exclusively on tumor endothelium, and suppress angiogenesis during clec14a-mediated tumor progression.
  • bevacizumab and cetuximab are therapeutic antibodies that suppress angiogenesis by inhibiting interaction of soluble angiogenic growth factors and their receptors.
  • Clec14a is a type I transmembrane protein critical for endothelial cell to cell contact.
  • the clec14a-CTLD IgG developed here specifically blocked CTLD-CTLD interaction in a concentration-dependent manner and clec14a cross-linking by IgG induced clec14a down-regulation on endothelial cell membranes.
  • clec14a-CTLD IgG appeared in a dot-like pattern inside HUVECs, suggesting antibody-induced endocytosis.
  • clec14a-CTLD IgG may have a dual mechanism of action in suppressing angiogenesis.
  • the antibody can suppress angiogenesis preferably by inhibiting cell migration, tube formation, or cell-cell contact, more preferably by inhibiting clec14a-mediated cell migration, tube formation, clec14a-mediated cell-cell contact, or clec14a CTLD-CTLD complex formation, or inducing the down-regulation of clec14a on the surface of vascular endothelial cells.
  • the antibody of the present invention can be used as therapeutic antibodies.
  • the clec14a-CTLD IgG of the present invention was identified as inhibiting endothelial cell migration (FIGS. 5a and 5b) and tube formation (FIGS. 5c and 5d), and to specifically suppress clec14a-mediated cell-cell contact (FIGS. 7a and 7b), indicating that the antibody can inhibit endothelial cell-cell contact during tumor angiogenesis.
  • clec14a CTLD-CTLD interaction was blocked by the clec14a-CTLD IgG (FIGS. 8a, 8b and 8c).
  • the antibody of the present invention was found to induce the down-regulation of clec14a on the surface of HUVEC (FIGS. 9a and 9b).
  • the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 14, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 16, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 18, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 42, light -chain CDR2 defined by the amino acid sequence of SEQ ID NO: 44, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 46, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 125 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 129, but is not limited thereto.
  • the nucleic acid encoding the antibody may comprise a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 70, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 72, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 74, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 77, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 79, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 81, but is not limited thereto.
  • a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 125 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 129 is designated as clone 1.
  • a nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 133 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 134 for the light-chain variable region, but is not limited thereto.
  • the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 21, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 23, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 25, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 49, light-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 51, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 53, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 126 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 130, but is not limited thereto.
  • the nucleic acid encoding the antibody may comprise a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 84, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 86, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 88, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 91, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 93, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 95, but is not limited thereto.
  • a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 126 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 130 is designated clone 2.
  • a nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 135 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 136 for the light-chain variable region, but is not limited thereto.
  • the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 28, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 30, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 32, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 56, light-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 58, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 60, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 127 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 131, but is not limited thereto.
  • the nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 98, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 100, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 102, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 105, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 107, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 109, but is not limited thereto.
  • a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 127 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 131 is designated as clone 3.
  • a nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 137 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 138 for the light-chain variable region, but is not limited thereto.
  • the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 35, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 37, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 39, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 63, light-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 65, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 67, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 128 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 132, but is not limited thereto.
  • the nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 112, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 114, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 116, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 119, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 121, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 123, but is not limited thereto.
  • a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 128 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 132 is designated as clone 4.
  • a nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 139 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 140 for the light-chain variable region, but is not limited thereto.
  • the antibody of the present invention comprises a constant domain
  • it may be derived from IgG, IgA, IgD, IgE, IgM, or combinations or hybrids thereof.
  • a dimer or multimer may be formed from two or more constant domains selected from the group consisting of constant domains of IgG, IgA, IgD, IgE and IgM.
  • hybrid means that sequences encoding two or more heavy-chain constant domains of different origins are present in a single-chain immunoglobulin heavy-chain constant domain.
  • domain hybrids may be composed of one to four domains selected from the group consisting of CH1, CH2, CH3 and CH4 of IgG, IgA, IgD, IgE and IgM.
  • a combination or a hybrid may be made from heavy-chain constant domains of the IgG subtypes IgG1, IgG2, IgG3 and IgG4. The combination and the hybrid are as defined above.
  • the antibody of the present invention further comprises a light-chain constant region, it may be derived from the lamda ( ⁇ ) or kappa ( ⁇ ) light chain.
  • the antibody may be a human monoclonal antibody that can specifically bind to murine clec14a-CTLD as well as human clec14a-CTLD thereby inhibiting angiogenesis.
  • the ability of the human antibody to function in both humans and mice, that is, the cross-reactivity, provides the advantage of rendering the human antibody applicable to a pre-clinical study in mice.
  • the present invention provides a vector comprising said nucleic acid, and a host cell comprising said vector or said nucleic acid.
  • the present invention provides a method for preparing an antibody specifically binding to clec14a (C-type lectin domain family 14, member A), prefrably human clec14a-CTLD (C-type lectin like domain) or human and murine clec14a-CTLD.
  • the antibody may be a human monoclonal antibody.
  • the method for preparing the antibody may comprise biopanning using functional domain.
  • the present invention provides a method of producing said antibody, comprising culturing said host cell such that the nucleic acid is expressed to produce the antibody.
  • the monoclonal antibody of the present invention may be easily prepared using a well-known technique.
  • the production of monoclonal antibodies may be achieved by, but is not limited to, a hybridoma constructed with B lymphocytes from immunized animals (Koeher and Milstein, 1976, Nature, 256:495), or a phage display technology.
  • the production of the monoclonal antibody of the present invention may be implemented using a phage display technology.
  • the method of the present invention may be stepwise conducted with reference to, for example, Barbas et al. (METHODS: A Companion to Methods in Enzymology 2: 119, 1991 and J. Virol. 2001 Jul;75(14):6692-9), and Winter et al. (Ann. Rev. Immunol. 12:433, 1994).
  • the phage useful for constructing an antibody library may be filamentous phage which may be exemplified by fd, M13, f1, If1, Ike, Zj/Z, Ff, Xf, Pf1 and Pf3, but is not limited thereto.
  • Examples of the vector that can be used to display exogenous genes on the surface of the filamentous phage include phage vectors such as fUSE5, fAFF1, fdCAT1 and fdtetDOG, or phagemid vectors such as pHEN1, pComb3, pComb8 and pSEX, but are not limited thereto.
  • a helper phage is used to supply a wild-type version of the coat proteins that are required for the successful reinfection of recombinant phage for amplification and may be exemplified by, but is not limited to, M13K07 and VSCM13.
  • a polynucleotide encoding the hybridoma-derived monoclonal antibody or phage display clone according to the present invention may be readily isolated and sequenced using a typical process. For example, oligonucleotide primers which are designed to specifically amplify heavy- and light-chain coding regions from a hybridoma or phage template DNA may be employed. Once it is isolated, the polynucleotide may be inserted into an expression vector which may be then introduced into a host cell. The resulting host cell (i.e., transformant) thus can produce the monoclonal antibody of interest.
  • the preparation method of the antibody of the present invention may comprise amplifying an expression vector carrying a polynucleotide coding for the antibody.
  • a recombinant antibody may be prepared by pre-clearing a Fc binder from a human scFv library and conducting a biopanning technique with a functional domain to select a specific clone.
  • the present invention provides a polynucleotide coding for the epitope or the antibody, an expression vector carrying the polynucleotide, and a transformant anchoring the vector therein.
  • the antibody is as described above.
  • the expression vector carrying the epitope or the antibody according to the present invention may include, but is not limited to, a vector that allows the replication and/or expression of the polynucleotide in eukaryotic or prokaryotic cells such as mammalian cells (e.g., humans, monkeys, rabbits, rats, hamsters, mice, etc.), plant cells, yeasts, insect cells and bacterial cells (e.g., E. coli).
  • the vector has a suitable promoter operably linked to the polynucleotide so as to induce the expression of the gene of interest, and at least one selection marker.
  • the polynucleotide may be introduced into a phage, a plasmid, a cosmid, a mini-chromosome, a virus, or a retroviral vector.
  • the expression vector carrying a polynucleotide coding for the antibody may be a combination of expression vectors carrying polynucleotides coding for the heavy chain of the antibody and the light chain of the antibody, respectively, or an expression vector carrying both the polynucleotides coding for the heavy chain of the antibody and the light chain of the antibody.
  • Examples of the transformant resulting from the introduction of the expression vector according to the present invention include, but are not limited to, bacterial cells, such as E. coli, streptomyces, Salmonella typhimurium; yeasts; fungi such as Pichia pastoria; insect cells, such as drosophila, spodoptera Sf9; animal cells, such as CHO (Chinese hamster ovary cells), SP2/0 (mouse myeloma), human lymphoblastoid, COS, NSO (mouse myeloma), 293T, melanoma cells, HT-1080, BHK (baby hamster kidney cells), HEK (human embryonic kidney cells), and PERC.6 (human retina cell); and plant cells.
  • bacterial cells such as E. coli, streptomyces, Salmonella typhimurium
  • yeasts fungi such as Pichia pastoria
  • insect cells such as drosophila, spodoptera S
  • introduction is intended to mean the delivery of the polynucleotide coding for the epitope or the antibody into cells.
  • the introduction can be carried out using various methods well known in the art, including calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, Lipofectamine transfection, and protoplast fusion.
  • Transduction refers to a process whereby foreign DNA is transferred to another cell via a viral vector on the basis of infection.
  • the delivery of a vector into host cells may be achieved by gene bombardment.
  • introduction may be interchangeably used with transformation.
  • the present invention provides a composition for the suppression of angiogenesis, comprising the antibody.
  • the composition comprising the antibody as an active ingredient can be useful for suppressing angiogenesis and further for preventing or treating angiogenesis-related diseases.
  • suppression of angiogenesis means the suppression of the formation or growth of new blood vessels from pre-existing vessels.
  • the suppression of angiogenesis is achieved by inhibiting cell migration, cell to cell contacts, more preferably by inhibiting clec14a-mediated cell migration, clec14a-mediated cell-cell contacts, HUVEC migration, or tube formation, clec14a CLTD-CLTD complex formation.
  • angiogenesis-related disease means a disease that involves angiogenesis in its onset or progression. So long as it can be treated with the antibody, any disease may be within the scope of the angiogenesis-related diseases without limitation.
  • the angiogenesis-related disease include cancer, metastasis, diabetic retinopathy, retinopathy of prematurity, corneal graft rejection, macular degeneration, neovascular glaucoma, erythrosis, proliferative retinopathy, psoriasis, hemophilic arthritis, capillary formation in atherosclerotic plaques, keloid, wound granulation, vascular adhesion, rheumatoid arthritis, osteoarthritis, autoimmune diseases, Crohn’s disease, restenosis, atherosclerosis, intestinal adhesions, cat scratch disease, ulcer, liver cirrhosis, nephritis, diabetic nephropathy, diabetes mellitus, inflammatory diseases, and neuro
  • the cancer is selected from the group consisting of esophageal cancer, stomach cancer, large intestine cancer, rectal cancer, oral cancer, pharynx cancer, larynx cancer, lung cancer, colon cancer, breast cancer, uterine cervical cancer, endometrial cancer, ovarian cancer, prostate cancer, testis cancer, bladder cancer, renal cancer, liver cancer, pancreatic cancer, bone cancer, connective tissue cancer, skin cancer, brain cancer, thyroid cancer, leukemia, Hodgkin’s lymphoma, lymphoma and multiple myeloid blood cancer, but are not limited thereto.
  • prevention or “prophylaxis” is intended to refer to any action resulting in the suppression or delay of the onset of diseases of interest thanks to the administration of the antibody or composition according to the present invention.
  • treatment or “therapy” is intended to refer to any action resulting in an improvement in the symptoms of a disease of interest or the beneficial alteration of the symptoms thanks to the administration of the antibody or composition according to the present invention.
  • composition comprising the antibody of the present invention is preferably a pharmaceutical composition and may further comprise a suitable vehicle, excipient or diluent typically used in the art.
  • the pharmaceutical composition comprising a pharmaceutically acceptable vehicle may be in various oral or non-oral dosage forms, such as tablets, pills, powders, granules, capsules, suspension, internal use solutions, emulsions, syrups, sterile aqueous solutions, non-aqueous solutions, suspensions, lyophilizates, and suppositories.
  • the pharmaceutical composition of the present invention may be formulated in combination with a diluent or excipient such as a filler, a thickener, a binder, a wetting agent, a disintegrant, a surfactant, etc.
  • Solid preparations intended for oral administration may be in the form of tablets, pills, powders, granules, capsules, and the like.
  • the compound of the present invention is formulated in combination with at least one excipient such as starch, calcium carbonate, sucrose, lactose, or gelatin.
  • a lubricant such as magnesium stearate, talc, etc. may be used.
  • liquid preparations intended for oral administration are suspensions, internal use solutions, emulsion, syrups, and the like.
  • various excipients such as wetting agents, sweeteners, aromatics, preservatives, and the like may be contained in the liquid preparations.
  • the pharmaceutical composition of the present invention may be in a parenteral dosage form such as sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilizates, suppositories, and the like.
  • a parenteral dosage form such as sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilizates, suppositories, and the like.
  • injectable propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and esters such as ethyl oleate may be suitable for the non-aqueous solvents and suspensions.
  • the basic materials of suppositories include Witepsol, macrogol, Tween 61, cacao butter, laurin butter, and glycerogelatin.
  • composition of the present invention is administered in a pharmaceutically effective amount.
  • composition of the present invention may be administered alone or in combination with other therapeutics. In this case, the administration may be conducted sequentially or simultaneously together with conventional therapeutics. Also, the composition may be administered in a single dose or may be divided into multiple doses.
  • the dose of the pharmaceutical composition of the present invention is not imparted with special limitations, but varies depending on various factors including patient's health state and weight, the severity of disease, the kind of drug, the route of administration, and the time of administration.
  • the composition may be administered in a single dose or in multiple doses per day into mammals including rats, domestic animals, humans, etc. via any typically accepted route, for example, orally, rectally, intravenously, subcutaneously, intrauterinely, or intracerebrovascularly.
  • the present invention provides a method for suppressing angiogenesis, comprising administering the antibody or the composition to a subject in need thereof.
  • the antibody, the composition and the suppression of angiogenesis are as elucidated above.
  • the suppressing method of the present invention comprises administering the pharmaceutical composition at a pharmaceutically effective dose to a subject in need of the suppression of angiogenesis.
  • the subject may be a mammal, such as a dog, cow, horse, rabbit, mouse, rat, chicken, and human, but is not limited thereto.
  • the pharmaceutical composition may be administered parenterally, subcutaneously, intraperitoneally, intrapulmonarily, or intranasally, or by a suitable method including, if necessary, intralesional injection for topical treatment.
  • the preferred dose of the pharmaceutical composition of the present invention varies depending on various factors including in the subject's health state and weight, the severity of the disease, the kind of drug, the route of administration, and the time of administration, and can be readily determined by those skilled in the art.
  • the present invention provides a pharmaceutical composition for preventing or treating cancer, comprising the antibody.
  • the cancer is not subject to any limitation.
  • Preferred is a cancer in which clec14a-mediated tumor progression takes place.
  • the onset or progression of cancer is prevented by suppressing angiogenesis with the antibody of the present invention.
  • cancers examples include esophageal cancer, stomach cancer, large intestine cancer, rectal cancer, oral cancer, pharynx cancer, larynx cancer, lung cancer, colon cancer, breast cancer, uterine cervical cancer, endometrial cancer, ovarian cancer, prostate cancer, testis cancer, bladder cancer, renal cancer, liver cancer, pancreatic cancer, bone cancer, connective tissue cancer, skin cancer, brain cancer, thyroid cancer, leukemia, Hodgkin’s lymphoma, lymphoma and multiple myeloid blood cancer, but are not limited thereto.
  • the antibody of the present invention may be used in combination with other antibodies or biologically active agents or materials for various purposes.
  • the antibody of the present invention was found to suppress angiogenesis, resulting in the retardation or prevention of the onset or progression of cancer. Hence, the antibody of the present invention is effectively applicable to the prophylaxis or therapy of cancer.
  • the present invention provides a method for treating cancer, comprising administering the antibody or the pharmaceutical composition for preventing or treating cancer to a subject in need thereof.
  • the antibody, the composition and the cancer are as described above.
  • the pharmaceutical composition is administered at a pharmaceutically effective dose to a subject suspected of cancer.
  • the subject may be a mammal, such as a dog, cow, horse, rabbit, mouse, rat, chicken, and human, but is not limited thereto.
  • the pharmaceutical composition may be administered parenterally, subcutaneously, intraperitoneally, intrapulmonarily, or intranasally, or by a suitable method including, if necessary, intralesional injection for topical treatment.
  • the preferred dose of the pharmaceutical composition of the present invention varies depending on various factors including the subject's health state and weight, the severity of the disease, the kind of drug, the route of administration, and the time of administration, and can be readily determined by those skilled in the art.
  • the present invention provides a diagnostic composition for cancer,comprising the antibody.
  • the antibody and the cancer are as described above.
  • Preferred is a cancer in which clec14a is expressed specifically.
  • diagnosis refers to evaluation of the presence or properties of pathological states. With respect to the objects of the present invention, the diagnosis is to determine the incidence of cancer.
  • the present invention provides a diagnostic kit for cancer, comprising the diagnostic composition.
  • the kit of the present invention can detect the marker for cancer, clec14a, preferably CTLD of clec14a.
  • the detection kit of the present invention may comprise an antibody selectively recognizing the marker, as well as one or more kinds of a composition, a solution, or an apparatus, which are suitable for the analysis method.
  • the diagnostic kit may include a matrix, a suitable buffer solution, a coloring enzyme, or a secondary antibody labeled with a fluorescent substance, a coloring substrate or the like for the immunological detection of antibody.
  • a matrix a nitrocellulose membrane, a 96 well plate made of polyvinyl resin, a 96 well plate made of polystyrene resin, and a slide glass may be used.
  • the coloring enzyme peroxidase and alkaline phosphatase may be used.
  • FITC and RITC may be used, and as for the coloring substrate solution, ABTS (2, 2'-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid)), OPD (o-phenylenediamine), or TMB (tetramethyl benzidine) may be used.
  • ABTS 2, 2'-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid)
  • OPD o-phenylenediamine
  • TMB tetramethyl benzidine
  • the present invention provides a method for diagnosing cancer, comprising detecting clec14a, preferably clec14a-CTLD through antigen-antibody complexes in a isolated biological sample from a subject with suspected cancer.
  • the antibody, the cancer, and diagnosis are as described above.
  • the isolation of protein from a biological sample may be achieved using a known process.
  • biological sample includes samples displaying a difference in expression levels of a cancer marker clec14a, preferably clec14a-CTLD, such as tissues, cells, whole blood, serum, plasma, saliva, sputum, cerebrospinal fluid or urine, but is not limited thereto.
  • a cancer marker clec14a preferably clec14a-CTLD
  • the occurrence of cancer can be diagnosed by comparing the clec14a, preferably clec14a-CTLD, expression level in a patient with suspected cancer to that in a normal control group. That is, the expression level of the marker of the present invention in suspected cancer cell is compared to that in normal cell. If a significant increase in the expression level of the marker is observed in the suspected cancer cell, the suspected cancer can be diagnosed as cancer.
  • Analysis methods for measuring protein levels include, but are not limited to, Western blotting, ELISA, radioimmunoassay, radialimmunodiffusion, Ouchterlony immunodiffusion, rocket immunoelectrophoresis, immunohistostaining, immunoprecipitation assay, complement fixation assay, FACS, and protein chip assay.
  • a patient with suspected cancer is compared with a normal control for the amount of formed antigen-antibody complexes, and the patient's suspected cancer is diagnosed by evaluating a significant increase in expression levels of a protein from the cancer marker gene.
  • antigen-antibody complexes refers to binding products of a cancer marker protein to an antibody specific thereto.
  • the amount of formed antigen-antibody complexes may be quantitatively determined by measuring the signal intensity of a detection label.
  • Such a detection label may be selected from the group consisting of enzymes, fluorescent substances, ligands, luminescent substances, microparticles, redox molecules and radioactive isotopes, but the present invention is not limited to the examples.
  • enzymes available as detection labels include, but are not limited to, ⁇ -glucuronidase, ⁇ -D-glucosidase, ⁇ -D-galactosidase, urase, peroxidase or alkaline phosphatase, acetylcholinesterase, glucose oxidase, hexokinase and GDPase, RNase, glucose oxidase and luciferase, phosphofructokinase, phosphoenolpyruvate carboxylase, aspartate aminotransferase, phosphenolpyruvate decarboxylase, and ⁇ -latamase.
  • fluorescent substances include, but are not limited to, fluorescein, isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, ophthaldehyde and fluorescamine.
  • ligands include, but are not limited to, biotin derivatives.
  • luminescent substances include, but are not limited to, acridinium esters, luciferin and luciferase.
  • microparticles include, but are not limited to, colloidal gold and colored latex.
  • redox molecules examples include, but are not limited to, ferrocene, ruthenium complexes, viologen, quinone, Ti ions, Cs ions, diimide, 1 ,4-benzoquinone, hydroquinone, K 4 W(CN) 8 , [Os(bpy) 3 ] 2+ ,[RU(bpy) 3 ] 2+ , and [MO(CN) 8 ] 4- .
  • radioactive isotopes include, but are not limited to, 3 H, 14 C, 32 P, 35 S, 36 Cl, 51 Cr, 57 Co, 58 Co, 59 Fe, 90 Y, 125 I, 131 I, and 186 Re.
  • the protein expression levels are measured by ELISA.
  • ELISA include direct ELISA using a labeled antibody recognizing an antigen immobilized on a solid support, indirect ELISA using a labeled antibody recognizing a capture antibody forming complexes with an antigen immobilized on a solid support, direct sandwich ELISA using another labeled antibody recognizing an antigen in an antigen-antibody complex immobilized on a solid support, and indirect sandwich ELISA, in which another labeled antibody recognizing an antigen in an antigen-antibody complex immobilized on a solid support is reacted, and then a secondary labeled antibody recognizing the another labeled antibody is used.
  • the protein expression levels are detected by sandwich ELISA, where a sample reacts with an antibody immobilized on a solid support, and the resulting antigen-antibody complexes are detected by adding a labeled antibody specific for the antigen, followed by enzymatic color development, or by adding a secondary labeled antibody specific to the antibody which recognizes the antigen of the antigen-antibody complex, followed by enzymatic development.
  • the incidence of cancer may be diagnosed by measuring the degree of complex formation of a cancer marker protein and an antibody thereto.
  • the protein expression levels are preferably measured by Western blotting using one or more antibodies to the cancer markers.
  • Total proteins are isolated from a sample, electrophoresed to be separated according to size, transferred onto a nitrocellulose membrane, and reacted with an antibody.
  • the amount of proteins produced by gene expression is determined by measuring the amount of produced antigen-antibody complexes using a labeled antibody, thereby diagnosing the incidence of cancer.
  • the detection methods are composed of methods of assessing expression levels of marker genes in a control and cells in which cancer occurs.
  • mRNA or protein levels may be expressed as an absolute (e.g., ⁇ g/ml) or relative (e.g., relative intensity of signals) difference in the amount of marker proteins.
  • the protein expression levels are preferably measured by immunohistostaining using one or more antibodies against the cancer markers.
  • Normal epithelial tissues and suspected cancer tissues were collected and fixed, and then paraffin-embedded blocks were prepared according to a widely known method. The blocks were cut into small sections (several ⁇ m in thickness), and attached to glass slides to be
  • proteins are separated from a sample and hybridized with a protein chip to form an antigen-antibody complex, which is then read to examine the presence or expression level of the protein of interest, thereby diagnosing the occurrence of cancer.
  • the present invention provides a composition for suppressing angiogenesis, comprising a material for inhibiting the expression of clec14a.
  • the material may be a material for inhibiting the expression of CTLD of clec14a.
  • the CTLD of clec14a was identified as playing an important role in inhibiting cell migration and tube formation (eg. filopodium formation) (FIGS. 1a, 1b, 2a and 2b). These results suggest that the material for inhibiting the expression of clec14a, preferably clec14a-CTLD, makes to suppress angiogenesis.
  • the material for inhibiting the expression of clec14a includes antisense oligonucleotides, siRNA oligonucleotides, antibodies, aptamers, single chain variable region fragments, peptides, low-molecular-weight compounds, and natural extracts, but is not limited thereto.
  • the material for inhibiting the expression of clec14a is antisense oligonucleotides or siRNA oligonucleotides specifically binding to material for inhibiting the expression of clec14a, preferably clec14a-CTLD gene.
  • antisense oligonucleotide means DNA or RNA or derivatives thereof containing a nucleic acid sequence complementary to a particular mRNA sequence, and binds to the complementary sequence within mRNA to inhibit translation of mRNA into protein.
  • the antisense oligonucleotide sequence may be a DNA or RNA sequence that is complementary to clec14a, preferably clec14a-CTLD mRNA, and is able to bind to clec14a, preferably clec14a-CTLD mRNA, and it is able to inhibit translation, cytoplasmic translocation, or maturation of clec14a, preferably clec14a-CTLD mRNA or all other activities essential for overall biological functions.
  • the antisense oligonucleotide has a length of 6 to 100 bases, preferably 8 to 60 bases, and more preferably 10 to 40 bases.
  • the antisense oligonucleotide may be modified at one or more positions of the bases, sugars or backbones in order to have improved effectiveness (De Mesmaeker et al., Curr Opin Struct Biol., 5(3):343-55(1995)).
  • the oligonucleotide backbone may be modified, for example, with phosphorothioates, phosphotriesters, methyl phosphonates, short chain alkyl, cycloalkyl, or short chain heteroatomic or heterocyclic intersugar linkages.
  • the antisense oligonucleotide may contain one or more substituted sugar moieties.
  • the antisense oligonucleotide may also contain modified bases.
  • modified bases include hypoxanthine, 6-methyladenine, 5-methyl-pyrimidines (especially, 5-methylcytosine), 5-hydroxymethylcytosine (HMC), glycosyl HMC, gentiobiosyl HMC, 2-aminoadenine, 2-thiouracil, 2-thiothymine, 5-bromouracil, 5-hyroxymethyluracil, 8-azaguanine, 7-deazaguanine, N6 (6-aminohexyl) adenine, and 2, 6-diaminopurine.
  • the antisense oligonucleotide of the present invention may be chemically bonded to one or more moieties or conjugates enhancing the activity and cellular uptake of the antisense oligonucleotide.
  • liphophilic moieties include, but are not limited to, a cholesterol moiety, a cholesteryl moiety, cholic acid, a thioether, a thiocholesterol, an aliphatic chain, a phospholipid, a polyamine chain, a polyethylene glycol chain, adamantane acetic acid, a palmityl moiety, an octadecylamine moiety and a hexylamino-carbonyl-oxycholesterol moiety.
  • oligonucleotides including lipid moieties are well known in the art (US Patent Nos. 5,138,045, 5,218,105 and 5,459,255).
  • the modified oligonucleotide may have enhanced stability in the presence of nucleases and enhanced binding affinity to target mRNA.
  • the antisense oligonucleotide may be synthesized in vitro by an ordinary method and administered to the body, or may be synthesized in vivo.
  • a method for synthesizing antisense oligonucleotide in vitro employs RNA polymerase I.
  • a method for synthesizing antisense RNA in vivo involves performing transcription of antisense RNA using a vector containing a multicloning site (MCS) in the opposite direction.
  • MCS multicloning site
  • Such antisense RNA preferably contains a translation stop codon in its sequence to block translation into a peptide sequence.
  • Design of the antisense oligonucleotide useful in the present invention may be easily performed by the method known in the art with reference to the nucleotides sequence of clec14a, preferably clec14a-CTLD (Weiss, B. (ed.): Antisense Oligodeoxynucleotides and Antisense RNA: Novel Pharmacological and Therapeutic Agents, CRC Press, Boca Raton, FL, 1997; Weiss, B., et al., Antisense RNA gene therapy for studying and modulating biological processes. Cell. Mol. Life Sci., 55:334-358(1999)).
  • siRNA refers to a nucleic acid molecule that is able to mediate RNA interference or gene silencing (reference: WO 00/44895, WO 01/36646, WO 99/32619, WO 01/29058, WO 99/07409 and WO 00/44914). Since siRNA can suppress the expression of the target gene, it provides an effective way of gene knockdown or genetic therapy. First discovered in plants, worms, fruit flies and parasites, siRNA has been recently developed and used for studies of mammalian cells.
  • the siRNA molecule may have a structure in which its sense strand (a sequence corresponding to the clec14a, preferably clec14a-CTLD mRNA sequence) and its antisense strand (a sequence complementary to the clec14a, preferably clec14a-CTLD mRNA sequence) form a double strand.
  • it may have a single-stranded structure having self-complementary sense and antisense strands.
  • the siRNA is not limited to those in which double-stranded RNA moieties constitute complete pairs, but includes the unpaired moieties such as mismatch (corresponding bases are not complementary), bulge (no corresponding base in one chain), etc.
  • the total length of the siRNA may be 10 to 100 bases, preferably 15 to 80 bases, more preferably 20 to 70 bases.
  • the end of the siRNA may be either blunt or cohesive as long as it is capable of suppressing the expression of the clec14a, preferably clec14a-CTLD gene via RNA interference (RNAi).
  • the cohesive end may be either 3'- or 5'-cohesive end.
  • the siRNA molecule may have a short nucleotide sequence (e.g., about 5-15 nucleotides) inserted between the self-complementary sense and antisense strands.
  • the siRNA molecule formed from the expression of the nucleotide sequence forms a hairpin structure via intramolecular hybridization, resulting in a stem-and-loop structure overall.
  • the stem-and-loop structure is processed in vitro or in vivo to give an activated siRNA molecule capable of mediating RNAi.
  • aptamer refers to a nucleic acid molecule having a binding affinity for a particular target molecule.
  • the aptamer can also inhibit the activity of a particular target molecule by binding to the particular target molecule.
  • the aptamer of the present invention may be an RNA, a DNA, a modified nucleic acid or a mixture thereof.
  • the aptamer of the present invention can also be in a linear or circular form.
  • the aptamer of the present invention is not particularly limited to its length.
  • the aptamer of the present invention may also have a length of approximately 18, 20 or 25 nucleotides or more.
  • chemical synthesis and mass-production will be easier, and there is a major advantage in terms of cost.
  • Chemical modification is also easy, stability in the body is high, and toxicity is low.
  • the aptamer of the present invention can be prepared by utilizing the SELEX method or an improved version thereof (for example, Ellington et al., Nature, 1990 346, 818-822; Tuerk et al., Science, 1990 249, 505-510).
  • the SELEX method is a method of selecting an oligonucleotide specifically binding to the target molecule from an oligonucleotide pool having 10-14 different nucleotide sequences.
  • the oligonucleotide used has a random sequence of about 40 residues, which is flanked by primer sequences.
  • This oligonucleotide pool is allowed to mix with a target molecule, and only the RNA that has bound to the target molecule is collected using a filter or the like.
  • the oligonucleotide collected is amplified by RT-PCR, and this is used as a template for the next round. By repeating this operation about 10 times, an aptamer that binds specifically to the target molecule can be acquired. By increasing the number of rounds or using a competing substance, an aptamer exhibiting a stronger binding potential for the target molecule is concentrated and selected.
  • the SELEX method includes a process of amplification by PCR; by causing a mutation by using manganese ions or the like in the process, it is possible to perform SELEX with higher diversity.
  • aptamers can be also obtained using the Cell-SELEX method for complex targets, living cells or tissues (Guo et al. Int. J. Mol. Sci., 9(4): 668, 2008), and the Cell-SELEX method has the advantage of direct selection of aptamers against disease without previous knowledge of the target molecule on the surface. Moreover, the Cell-SELEX method is advantageous over the conventional SELEX method in that a functional approach for the target protein in its physiological state is possible during the selection procedure because it may not show its intrinsic properties when isolated.
  • an aptamer binds to the target molecule in a wide variety of binding modes, such as ionic bonds based on the negative charge of the phosphate group, hydrophobic bonds and hydrogen bonds based on ribose, and hydrogen bonds and stacking interaction based on nucleic acid bases.
  • ionic bonds based on the negative charge of the phosphate group which are present in the same number as the number of constituent nucleotides, are strong, and bind to lysine and arginine being present on the surface of the positive charge of protein. For this reason, nucleic acid bases not involved in the direct binding to the target molecule can be substituted.
  • nucleic acid bases are unlikely to bind directly to the target molecule. Therefore, even when a base pair is replaced with another base pair, the activity of the aptamer often does not decrease.
  • base substitution is possible. For example, at the 2'-position of ribose, a hydroxy group is substituted by any atom or group.
  • Examples of the atom or group may include hydrogen atom, fluorine atom or -O-alkyl group (e.g., -O-CH 3 ), -O-acyl group (e.g., -O-CHO), and amino group (e.g., -NH 2 ).
  • the aptamer unless the functional group involved in the direct binding to the target molecule is substituted or deleted, often retains the activity thereof.
  • aptamers are easily modifiable because they permit chemical synthesis.
  • For aptamers by predicting the secondary structure using the MFOLD program, or by predicting the steric structure by X-ray analysis or NMR analysis, it is possible to predict to some extent which nucleotide can be substituted or deleted, and where to insert a new nucleotide.
  • a predicted aptamer with the new sequence can easily be chemically synthesized, and it can be determined whether or not the aptamer retains the activity using an existing assay system.
  • the aptamer of the present invention may be one wherein a sugar residue (e.g., ribose) of each nucleotide has been modified to increase the binding activity, stability, drug deliverability and the like.
  • a sugar residue e.g., ribose
  • replacement of the oxygen atom at the 2'-position, 3'-position and/or 4'-position of the sugar residue with another atom, and the like can be mentioned.
  • fluorination, O-alkylation e.g., O-methylation, O-ethylation
  • Oarylation Oarylation
  • S-alkylation e.g., S-methylation, S-ethylation
  • S-arylation e.g., S-methylation, S-ethylation
  • S-arylation e.g., S-methylation, S-ethylation
  • S-arylation e.g., S-methylation, S-ethylation
  • amination e.g.
  • Such alterations in the sugar residue can be performed by a method known per se (e.g., Sproat et al., Nucle. Acid. Res. 1991 19, 733-738; Cotton et al., Nucl. Acid. Res. 1991 19, 2629-2635; Hobbs et al., Biochemistry 1973 12, 5138-5145).
  • the aptamer of the present invention may also have a nucleic acid base (e.g., purine or pyrimidine) altered (e.g., by chemical substitution) to increase binding activity.
  • a nucleic acid base e.g., purine or pyrimidine
  • pyrimidine alteration at the 5-position purine alteration at the 6- and/or 8-position(s), alteration with an extracyclic amine, substitution with 4-thiouridine, and substitution with 5-bromo or 5-iodo-uracil can be mentioned.
  • the phosphate group contained in the aptamer of the present invention may be altered to confer resistance to nuclease and hydrolysis.
  • the P(O)O group may be substituted with P(O)S (thioate), P(S)S (dithioate), P(O)NR2 (amidate), P(O)R, R(O)OR', CO or CH 2 (formacetal) or 3'-amine (-NH-CH 2 -CH 2 -) [wherein each unit of R or R' is independently H or a substituted or unsubstituted alkyl (e.g., methyl, ethyl)].
  • the joining group is, for example, -O-, -N- or -S-, and nucleotides can bind to an adjoining nucleotide via these joining groups.
  • the alterations may also include alterations such as capping at 3' and 5'.
  • An alteration can further be performed by adding to an end a polyethyleneglycol, amino acid, peptide, inverted dT, nucleic acid, nucleosides, Myristoyl, Lithocolic-oleyl, Docosanyl, Lauroyl, Stearoyl, Palmitoyl, Oleoyl, Linoleoyl, other lipids, steroids, cholesterol, caffeine, vitamins, pigments, fluorescent substances, anticancer agents, toxins, enzymes, radioactive substances, biotin and the like.
  • aptamers are attached to the surface of liposomes or nanoparticles to deliver an anticancer agent, a toxin, a tumor suppressor gene, and a siRNA (small interfering RNA) encapsulated in the liposomes or nanoparticles to the target cell.
  • an anticancer agent e.g., a toxin, a tumor suppressor gene, and a siRNA (small interfering RNA) encapsulated in the liposomes or nanoparticles to the target cell.
  • the material for inhibiting the expression of clec14a, preferably clec14a-CTLD, in particular, its activity is preferably an antibody, a peptide, a low-molecular-weight compound, or a natural extract that specifically binds to clec14a, preferably clec14a-CTLD.
  • the antibody which can specifically bind to clec14a, preferably clec14a-CTLD, is as elucidated above.
  • the peptide that specifically binds to clec14a, preferably clec14a-CTLD to inhibit its activity may be obtained by the typical method known in the art, for example, by phage display (Smith GP, "Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface”. Science 228 (4705):1315-1317(1985); Smith GP, Petrenko VA, “Phage display”. Chem. Rev. 97(2):391-410(1997)).
  • the composition for suppressing angiogenesis may treat cancer by suppressing angiogenesis.
  • the composition for suppressing angiogenesis may treat angiogenesis-related disease by suppressing angiogenesis.
  • the present invention provides a kit for suppressing angiogenesis, comprising the composition, and wherein the composition comprises material for inhibiting the expression of clec14a, preferably clec14a-CTLD.
  • the present invention provides a method for suppressing angiogenesis, comprising administering the composition to a subject in need thereof, and wherein the composition comprises material for inhibiting the expression of clec14a, preferably clec14a-CTLD.
  • the present invention provides a method for treating cancer, comprising administering the composition to a subject in need thereof, and wherein the composition comprises material for inhibiting the expression of clec14a, preferably clec14a-CTLD.
  • the present invention provides an antibody-drug conjugate comprising said antibody of any one among claims 1 to 17 attached to a drug.
  • the drug may be any one selected from the group consisting of a toxin, a chemotherapeutic agent, an anticancer drug, an antibiotic, ADP-ribosyl transferase, a radioactive isotope and a nucleolytic enzyme, but are not limited thereto.
  • the antibody-drug conjugate may be capable of being internalized into a cell. More preferably, the cell may be a cancer cell.
  • the clec14a-CTLD IgG can be internalized into a cell expressing clec14a such as a cancer cell (Fig. 9a, 9b).
  • the present invention provides a pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising fusion protein of CTLD of clec14a and Fc.
  • hCTLD-Fc inhibited tube formation in a concentration-dependent manner (Fig. 11).
  • Human umbilical vein endothelial cells (HUVECs, Lonza, Baltimore, MD, USA)were maintained in endothelial growth medium-2 (EGM-2).
  • Mouse aortic endothelial cells (MAECs) and COS-7 cells were grown in Dulbecco's modified Eagle medium containing 10% (v/v) fetal bovine serum and 1% (v/v) penicillin/streptomycin. Cells were maintained in a humidified, CO 2 -controlled incubator (Sanyo, Panasonic Healthcare Company, Secaucus, NJ, USA) at 37°C and 5% CO 2 .
  • HEK293F cells were maintained in FreestyleTM 293 expression media (Invitrogen) supplemented with 1% (v/v) penicillin/streptomycin in a humidified Multitron incubation shaker (Infors HT, Bottmingen (Switzerland) at 37°C and 8% CO 2 .
  • HUVECs and COS-7 cells were transfected with vectors encoding GFP, clec14a-GFP (wild-type clec14a), or clec14a ⁇ CTLD-GFP (clec14a CTLD deletion mutant) using Lipofectamine 2000 (Invitrogen, Carlsbad, CA, USA) according to the manufacturer's instruction.
  • DNA encoding amino acid residues 31-172 of hCTLD was amplified using the primers 5'-TCGCGCGGCCGCTGCTCGGCCTCGGGGGCCTGC-3' (SEQ ID NO:1) and 5'-TCGCCTCGAGCTTGCACAGGTAGCCGTTGG-3' (SEQ ID NO:2).
  • DNA encoding the same residues of mCTLD was amplified using the primers 5'-TCGCGGCCCAGGCGGCCTGTTCGGCCTCGGGGGCTTG-3' (SEQ ID NO:3) and 5'- TCGCGGCCGGCCTGGCCCTTGCATAGGTAGCCATCGG-3' (SEQ ID NO:4).
  • PCR fragments were digested with Sfi I (NEB, Ipswich, MA, USA) and cloned into the modified mammalian expression vector pCEP4 (Invitrogen) encoding the hinge and CH2-CH3 domain of human IgG1 in the 3' region of the cloning site (gift of Dr. Chung, Seoul National University, Seoul, South Korea).
  • Ligated products were transformed into competent Escherichia coli DH5 ⁇ cells and plasmid DNA was prepared.
  • HEK293F cells (6 ⁇ 10 8 cells) were transfected with 0.75 mg each DNA using 1.5 mg polyethylenimine (Polysciences, Inc., Warrington, PA, USA).
  • the transfected cells were maintained in FreestyleTM 293 expression media supplemented with 1% (v/v) penicillin/streptomycin. After 7 days in culture, culture medium was collected and fusion proteins were purified by affinity chromatography on protein A Sepharose (RepliGen, Waltham, MA, USA). Protein concentration was quantified using a NanoDrop spectrophotometer (Wilmington, DE, USA). Samples were dialyzed against PBS and analyzed by SDS-PAGE and Coomassie brilliant blue staining. Aliquots of the final pooled fraction were stored at -80°C.
  • a human synthetic scFv library was re-amplified (Barbas CF. Phage display : a laboratory manual. Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press; 2001).
  • human immunoglobulin-G Green Cross Pharma Derivatives Corp, Yong-in, Korea
  • the supernatant was collected and the pellet was discarded. This procedure was repeated two times. The final supernatant was analyzed by phage ELISA to assess the extent of clearing.
  • variable heavy chain (VH) gene of selected scFv clones (clones 1-4) was amplified using the primers 5'-CGGGAATTCGCCGCCACCATGGAATGGAGCTGGGTCTTTCTCTTCTTCCTGCTGTCAGTAACTACAGGTGTCCTCTCCGAGGTGCAGCTGTTGGAGTCTG-3' (SEQ ID NO: 5) and 5'-GGCGGGCCCTTGGTGGAGGCTGAGCTCACGGTGACCAGTGCCCTTGGCCCC-3'(SEQ ID NO: 6).
  • variable light chain (VL) gene of the clones was amplified using the primers 5'-CCCAAGCTTGCCGCCACCATGGAGACACATTCTCAGGTCTTTGTATACATGTTGCTGTGGTTGTCTGGTGTTGAAGGACCAGTCTGTGCTGACTCAGCC-3'(SEQ ID NO: 7) and 5'-GGCCGTA CGTAGGACCGTCAGCTTGGTGCCTCCGCCTAAGACATAACCACC-3' (SEQ ID NO: 8).
  • V H primers were designed to add EcoRI and ApaI restriction sites to both the 5' and 3' ends.
  • VL primers were designed to add Hind III and Bsi WI sites to both ends.
  • PCR fragments were digested with the appropriate restriction enzymes (NEB, Ipswich, MA, USA) and cloned into the bicistronic mammalian expression vector pCDNA3.1 (Invitrogen) encoding the hinge and CH2-CH3 domain of human IgG1 3' of the V H cloning site, (gift of Dr. Hong, Kangwon National University, Chuncheon, Kangwon, South Korea) (Sambrook J, Russell DW. Molecular cloning : a laboratory manual. 3rd ed. Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press; 2001).
  • pCDNA3.1 Invitrogen
  • Clec14a-CTLD IgG was produced and purified as described previously (Kim HY, Tsai S, Lo SC, Wear DJ, Izadjoo MJ. Production and characterization of chimeric monoclonal antibodies against Burkholderia pseudomallei and B. mallei using the DHFR expression system. PLoS ONE [Electronic Resource].6(5):e19867).
  • a CytoSelectTM 24-well wound healing assay kit (Cell Biolabs Inc, San Diego, CA, USA) was used according to the manufacturer's instructions. Briefly, COS-7 cells transfected with GFP, clec14a-GFP, or clec14a ⁇ CTLD-GFP were added to each well by carefully inserting the pipette tip through the open end at the top of the wound healing insert. When cells had grown to confluence, inserts were removed from the wells, and cells were washed twice with phosphate-buffered saline (PBS). Images were captured 20 hr after wounding.
  • PBS phosphate-buffered saline
  • HUVECs were cultured in the insert until monolayer formation and incubated in the absence or presence of 20 ⁇ g/ml clec14a-CTLD IgG or cetuximab for 9 hr at 37°C. Cells were washed twice with PBS and stained with crystal violet (Sigma, St. Louis, MO, USA). For quantitative analysis, five fields per plate were photographed under a light microscope (Nikon TS 100, Melville, NY, USA), and distance migrated was measured manually.
  • hCTLD-Fc 25 nM recombinant hCTLD-Fc, mCTLD-Fc, or Fc fragment of IgG1 in PBS was added to the 96-wells of a microtiter plate. After incubation overnight at 37°C, plates were washed three times with PBS containing 0.05% (v/v) Tween 20 (PBST), and incubated with 3% (w/v) BSA in PBST for 1 hr at 37°C. Plates were then incubated with 67 nM clec14a-CTLD IgG in PBST containing 3% (w/v) BSA for 3 hr at 37°C.
  • HRP horseradish peroxide
  • lysates (20 ⁇ g) of COS-7 cells transfected with GFP, clec14a-GFP, or clec14a ⁇ CTLD-GFP were added to wells of 96-well plates and incubated with 3% (w/v) BSA in PBST for 1 hr at 37°C, followed by addition of 0.15 ⁇ g of hCTLD-Fc or Fc in the same buffer and incubated for 2 hr at 37°C.
  • hCTLD-Fc was pre-incubated with increasing concentrations of clec14a-CTLD IgG in PBST containing 3% (w/v) BSA for 2 hr at 37°C.
  • the protein complexes were then added to wells and incubated for 2 hr at 37°C.
  • Wells were washed three times in PBST, and HRP-conjugated donkey anti-human Fc IgG (1:5000; Jackson Immunoresearch Laboratories, Inc., West Grove, PA, USA) was added and incubated for 1 hr at 37°C.
  • TMB substrate solution BD Biosciences, San Jose, CA, USA
  • Optical density was measured at 450 nm using a microtiter plate reader (VICTORTM X4, Perkin Elmer, Waltham, MA, USA).
  • HUVECs (3 ⁇ 10 5 ) grown in 6-well microtiter plates were incubated in the absence or presence of 20 ng/ml hTNF ⁇ (Millipore, Billerica, MA, USA) or 20 ⁇ g/ml clec14a-CTLD IgG or cetuximab for 24 hr. Cells were harvested and stained with 20 ⁇ g/ml anti-VCAM-1 or ICAM-1 polyclonal antibody in flow cytometry buffer for 1 hr at 37°C.
  • HUVECs (3 ⁇ 10 5 ) grown in 6-well microtiter plates were fixed with 4% (w/v) paraformaldehyde. Fixed and unfixed cells were washed twice with PBS and incubated in the absence or presence of 20 ⁇ g/ml clec14a-CTLD IgG for 2 hr at 37°C. Cells were stained with 7.5 ⁇ g/ml sheep anti-clec14a polyclonal antibody for 2 hr at 37°C.
  • Tube formation assays were performed as described previously (Rho SS, et al., Clec14a is specifically expressed in endothelial cells and mediates cell to cell adhesion. Biochemical & Biophysical Research Communications.404(1):103-8). Briefly, 250 ⁇ l Matrigel (BD Biosciences, Bedford, MA) was added to wells of a 24-well plate and allowed to polymerize for 20 min at 37°C. HUVECs cultured in EGM-2 were harvested, resuspended in EGM-2, and seeded onto the Matrigel (1 ⁇ 10 5 cells/well). Cultures were incubated in the absence or presence of clec14a-CTLD IgGs or cetuximab at 37°C and photographed at 21 hr. Tubes were counted manually.
  • HUVECs (10 4 ) were seeded in 96-well microtiter plates and incubated with 20 ⁇ g/ml clec14a-CTLD IgGs, cetuximab, or 5-FU (Sigma) for 2 days at 37°C.
  • Cell viability was measured using Cell Counting Kit-8 (Dojindo, Kumamoto, Japan) according to the manufacturer's instructions. Absorbance was measured at 450 nm with a VICTORTM X4 spectrophotometer (Perkin Elmer).
  • the membrane was washed with TTBS and incubated with HRP-conjugated Affinipure goat anti-mouse IgG (1:5000; Jackson ImmunoResearch, West Grove, PA, USA) in TTBS containing 5% (w/v) skim milk at room temperature for 1 hr. Following several washes with TTBS, protein bands were visualized using SuperSignal West Pico Chemiluminescent Substrate (Pierce, Rockford, IL, USA)according to the manufacturer's instructions.
  • HUVECs (10 4 ) plated on 96-well plates were incubated with 20 ⁇ g/ml clec14a-CTLD IgG or Fc for 0, 10, 30, 60, 120, or 180 min at 37°C.
  • Cells were washed twice with ice-cold PBS, blocked in 3% (w/v) BSA in PBS for 1 hr at 4°C, and incubated with sheep anti-clec14a polyclonal antibody (1:1000) in the blocking solution for 2 hr at 4°C.
  • Cells were washed three times with ice-cold PBS and incubated with HRP-conjugated anti-sheep IgG (1:5000; Santa Cruz Biotechnology) for 1 hr at 4°C. After several washes with PBS, 100 ⁇ l TMB substrate solution was added to each well. Optical density was measured at 450 nm using a microtiter plate reader.
  • Example 15 ELISA for epitope mapping
  • hCTLD-Fc 10 ⁇ g/ml hCTLD-Fc, Fc, or N-terminal or C-terminal fragments of hCTLD-Fc in PBS was added to 96-well plates. Plates were incubated overnight at 37°C, washed three times with PBS containing 0.05% (v/v) Tween 20 (PBST), and incubated with 3% (w/v) BSA in PBST for 1 hr at 37°C. Plates were incubated with 10 ⁇ g/ml clec14a-CTLD IgG in PBST containing 3% (w/v) BSA for 2 hr at 37°C.
  • PBST 0.05% (v/v) Tween 20
  • HRP horseradish peroxide
  • Example 16 Tube formation assay in the absense or presense of hCTLD-Fc
  • COS-7 cells were transfected with green fluorescent protein (GFP), wild-type clec14a fused to GFP (clec14a-GFP), or a clec14a CTLD deletion mutant fused to GFP (clec14a ⁇ CTLD-GFP), and assayed migration in a wound healing assay at 0 and 20 hr.
  • GFP green fluorescent protein
  • clec14a-GFP wild-type clec14a fused to GFP
  • clec14a ⁇ CTLD-GFP a clec14a CTLD deletion mutant fused to GFP
  • CTLD may play a crucial role in endothelial cell migration by regulating actin cytoskeletal rearrangements.
  • CTLD of human, mouse or chimpanzee clec14a (Table 1) were Fc fusion proteins, two sequential pre-clearing steps were performed for removing Fc binders from a human synthetic scFv library; removal of approximately 90% was confirmed by phage enzyme-linked immunosorbent assay.
  • Amino acid residues on the amino acid sequences used in the present invention are expressed by abbreviations according to the IUPAC-IUB nomenclature.
  • the library was then alternately biopanned with human (hCTLD-Fc) or mouse (mCTLD-Fc) CTLD fusion proteins, using CTLD-Fc-coated immunotubes and magnetic beads, to isolate clones having cross-species CTLD reactivity (Figure. 3a); several such clones were identified only with beads ( Figure. 3b-3d).
  • Figure. 3a Ninety-six phage clones were randomly selected, rescued by phage enzyme immunoassay.
  • Clone DNA was sequenced and four clones (clones 1- 4), recognizing both human and mouse CTLDs and having different complementarity determining region sequences, were selected (Tables 2 to 9). Meanwhile, four clones can specifically recognize chimpanzee CTLD, having cross-reactivity because amino acid sequence of chimpanzee clec14a-lectin is the same as that of the human clec14a-lectin.
  • nucleic acid sequences of clones 1-4 is the same as the following tables 10 to 17.
  • the scFv clones were converted to IgG, expressed in human embryonic kidney 293F (HEK293F) cells, and purified.
  • the four IgG clones was shown to be greater than 90% pure by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and Coomassie staining.
  • ELISA showed that the purified CTLD-specific IgGs (clec14a-CTLD IgGs) specifically bound both human and mouse CTLD-Fc, and not Fc alone.
  • Clones 1 and 2 showed much greater affinity than clones 3 and 4 (Fig. 4).
  • clec14a-CTLD IgGs wound healing assays with HUVECs were performed in the absence or presence of clec14a-CTLD IgGs.
  • Cetuximab an anti-EGFR antibody, was used as control IgG.
  • clones 1 and 2 significantly suppressed HUVEC cell migration to approximately 44% and 54%, respectively, whereas clones 3 and 4 and cetuximab alone had little effect. (Fig. 5a and 5b).
  • HUVECs were cultured in the absence or presence of clec14a-CTLD IgGs, cetuximab, or 5-fluorouracil (5-FU), an apoptosis inducer, for 2 days, and cell viability was checked using a cell counting kit.
  • the antibodies had little effect on HUVEC viability, whereas 5-FU specifically decreased viability (Fig. 6a).
  • HUVECs were cultured in the absence or presence of clec14a-CTLD IgGs, cetuximab, or human tumor necrosis factor alpha (hTNF ⁇ ).
  • Activation was determined based on the expression of vascular cell adhesion molecule-1 (VCAM-1) and intercellular cell adhesion molecule-1 (ICAM-1) measured by flow cytometry.
  • VCAM-1 vascular cell adhesion molecule-1
  • IAM-1 intercellular cell adhesion molecule-1
  • clec14a-CTLD IgGs the number of cell aggregates, an indicator of clec14a-mediated cell-cell contacts, formed by HEK293F cells transfected with GFP or clec14a-GFP and grown in the absence or presence of clec14a-CTLD IgGs or cetuximab was determined.
  • the number of cell aggregates was approximately 4-fold greater in cells expressing clec14a-GFP than in those expressing GFP alone (Fig. 7a and 7b).
  • clones 1 and 2 significantly suppressed the aggregation of cells transfected with clec14a-GFP, whereas the other clones and cetuximab had little effect.
  • clec14a-CTLD IgGs may play an inhibitory role in clec14a-mediated endothelial cell-cell contact during tumor angiogenesis.
  • clec14a-CTLD IgG blocks CTLD-CTLD interactions
  • hCTLD-Fc was incubated with increasing concentrations of clec14a-CTLD IgG (clone 1) and the protein complexes were incubated with lysates of GFP- or clec14a-GFP-transfected cells.
  • Competitive ELISA showed that clec14a-CTLD IgG specifically inhibited CTLD-CTLD interactions in a concentration-dependent manner (Fig. 8c), suggesting that clec14a-CTLD IgG may specifically block clec14a CTLD-CTLD interactions in endothelial cells.
  • clec14a-CTLD IgG To confirm down-regulation of clec14a on HUVEC membranes by clec14a-CTLD IgG, cells were treated with IgG (clone 1) or Fc, and membrane clec14a was measured by cell ELISA. Clec14a-CTLD IgG down-regulated clec14a on HUVEC membranes in a time-dependent manner (Fig. 9b).
  • clec14a-CTLD IgG cross-linking of clec14a specifically down-regulates clec14a on endothelial cell membranes. Additionally, these results suggest that clec14a-CTLD IgG is capable of being internalized into a cell expressing clec14a such as a cancer cell.
  • clec14a-CTLD IgGs of both clone1 and clone 2 specifically bound the N-terminal and C-terminal of hCTLD as well as wthCTLD.
  • N-terminal or C-terminal region of CTLD such as clec14a-CTLD IgGs of both clone1 and clone 2 specifically bound a fusion protein comprising an amino acid fragment from 1st amino acid to 42nd amino acid in hCTLD, a fusion protein comprising an amino acid fragment from 1st amino acid to 62nd amino acid in hCTLD, a fusion protein comprising an amino acid fragment from 82nd amino acid to 142nd amino acid in hCTLD, a fusion protein comprising an amino acid fragment from 62nd amino acid to 142nd amino acid in hCTLD and a fusion protein comprising an amino acid fragment from 122nd amino acid to 142nd amino acid in hCTLD can be used as an epitope.
  • tube formation was assayed in the presence hCTLD-Fc or Fc according to example 16.
  • hCTLD-Fc inhibited tube formation in a concentration-dependent manner.
  • the present invention Based on the novel finding that the CTLD of clec14a plays an important role in cell migration and filopodium formation, the present invention identified the function of a novel antibody against CTLD in suppressing angiogenesis. Accordingly, the present invention provides a novel target domain which will be available for suppressing angiogenesis. Further, the antibody of the present invention can be effective for preventing or treating angiogenesis-related diseases or clec14a-mediated cancer.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • Dermatology (AREA)
  • Oncology (AREA)
  • Ophthalmology & Optometry (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Pathology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Heart & Thoracic Surgery (AREA)

Description

NOVEL ANTIBODY SPECIFIC FOR CLEC14A AND USES THEREOF
The present invention relates to a novel antibody specifically binding to the C-type lectin domain family 14, member A (clec14a) and uses thereof. More particularly, the present invention relates to an antibody specifically binding to the C-type lectin like domain (CTLD) of clec14a, a method for preparing the antibody, a composition for the suppression of angiogenesis comprising the antibody, a method for suppressing angiogenesis by administering the antibody or the composition, a composition for preventing or treating cancer comprising the antibody, a method for treating cancer by administering the antibody or the composition, a composition for diagnosing cancer comprising the antibody, a kit for diagnosing cancer comprising the composition, a method for diagnosing cancer using the composition, a composition for the suppression of angiogenesis comprising a material for inhibiting expression of clec14a, a kit for angiogenesis comprising the composition, a method for suppressing angiogenesis or treating cancer using the composition, and the use of the CTLD of clec14a as an epitope for an antibody suppressive of angiogenesis.
The rapid recent development of recombinant antibody technology has produced approximately 30 antibodies that have been approved for human therapy and more than 270 that are currently in clinical development worldwide for a wide range of diseases. However, conventional antibody screening remains time- and labor-intensive and expensive. Traditionally, extracellular regions of target proteins have been used to screen antibodies. Consequently, most selected antibodies bind to cells, but are not functional antibodies with therapeutic potential. Due to recent advances in molecular biology and protein biochemistry, a large amount of information on protein domains and motifs that could link these structures to cell functions, is available. Use of a functional domain to screen recombinant antibodies may be an effective means of identifying functional antibodies and investigating underlying modes of action.
Tumor angiogenesis plays an important role in tumor progression. Vascular endothelial growth factor (VEGF) and epidermal growth factor receptor (EGFR) are key factors in angiogenesis, and targeting angiogenesis has become a promising strategy for cancer treatment. The anti-VEGF antibody bevacizumab has been used to treat patients with metastatic colorectal cancer, renal cell carcinoma, non-small-cell lung cancer, and malignant brain glioma. Cetuximab, an anti-EGFR antibody, may inhibit endothelial cell to cell contact and expression of angiogenic factors such as VEGF, interleukin-8, and basic fibroblast growth factor. However, due to the redundancy of tumor-secreted angiogenic factors, including placental growth factor, angiopoietin, basic fibroblast growth factor, and hepatocyte growth factor, these drugs generate a resistant phenotype in tumors (Kopetz S, et al., Phase II trial of infusional fluorouracil, irinotecan, and bevacizumab for metastatic colorectal cancer: efficacy and circulating angiogenic biomarkers associated with therapeutic resistance. Journal of Clinical Oncology.28(3):453-9; Lucio-Eterovic AK, et al., Mediators of glioblastoma resistance and invasion during antivascular endothelial growth factor therapy. Clinical Cancer Research. 2009;15(14):4589-99).
The human VEGF antibody, bevacizumab, is now being used to treat patients with a variety of cancers. However, because the VEGF receptor (VEGFR) is also expressed on normal cells, its use is likely to be associated with adverse effects including hypertension, proteinuria, and gastrointestinal perforation. Adverse effects may also limit the therapeutic use of many antibodies against pro-angiogenic factors such as VEGFR-2 and angiopoietin-2. Consequently, identification of new cancer-specific targets for treating cancer patients by inhibition of angiogenesis is critical for developing therapeutic antibodies with fewer adverse effects.
In addition, bevacizumab and cetuximab are therapeutic antibodies that suppress angiogenesis by inhibiting interaction of soluble angiogenic growth factors and their receptors. However, long-term use of these drugs generates a resistant tumor phenotype due to redundancy of tumor cell-secreted pro-angiogenic growth factors. This may pose the greatest challenge to use of antibodies against soluble growth factors in patients requiring long-term therapy.
Clec14a is a type I transmembrane protein, the extracellular domain of which consists of a C-type lectin-like domain (CTLD), a series of epidermal growth factorlike domains, and a sushi-like domain. Several reports suggest a role by clec14a in tumor angiogenesis. Rho et al. reported that clec14a is endothelial cell-specific and may play a key role in cell to cell contact in angiogenesis (Rho SS, et al., Clec14a is specifically expressed in endothelial cells and mediates cell to cell adhesion. Biochemical & Biophysical Research Communications.404(1):103-8). Mura et al. showed that clec14a is critical for regulating pro-angiogenic phenotypes associated with filopodium formation, cell migration, and endothelial tube formation; this group also identified clec14a as a tumor endothelial cell marker not expressed on the endothelium of normal tissues (Mura M, et al., Identification and angiogenic role of the novel tumor endothelial marker CLEC14A. Oncogene.31(3):293-305).
Despite increasing interest in clec14a in recent years, its molecular mechanism has not been clearly identified. Studies on the functional portion or domain of cle14a which accounts for the angiogenesis must be conducted so as to excavate and develop clinically applicable antibodies. In this context, there is a pressing demand for a monoclonal antibody that specifically binds mouse and human clec14a and that is convertible into a humanized antibody or human antibody for preclinical and clinical study. Preferably, an antibody which is clinically applicable to the inhibition of tumor angiogenesis and thus to the treatment of cancer is needed. In addition, a novel part which suppresses tumor angiogenesis is needed to identify and thus further the suppression of angiogenesis and treatment of cancer.
The above information disclosed in this Background section is only for enhancement of understanding of the background of the present invention, and therefore it may contain information that does not form the prior art that is already known to a person of ordinary skill in the art.
Disclosure of Invention
Technical Problem
The present inventors first identified CTLD functions in cell migration and filopodium formation, which are key events of angiogenesis. Using phage display technology the present inventors developed recombinant human antibodies against human and mouse clec14a CTLDs. Functional assays showed that the antibodies specifically inhibited endothelial cell migration and tube formation without affecting viability or activation. Finally, the present inventors propose a mechanism of action, whereby the antibodies may inhibit angiogenesis by modulating CTLD-mediated cell to cell interaction and down-regulating clec14a expression on the surface of endothelial cells. These results demonstrate the functional significance of CTLD in angiogenesis and the potential of CTLD-specific human antibodies to block clec14a-mediated tumor angiogenesis.
Solution to Problem
To achieve the above object, the present invention provides an antibody which binds specifically to clec14a (C-type lectin domain family 14, member A).
The present invention also provides a nucleic acid encoding said antibody.
The present invention also provides a vector comprising said nucleic acid.
The present invention also provides a host cell comprising said vector or said nucleic acid.
The present invention also provides a method of producing said antibody, comprising culturing said host cell such that the nucleic acid is expressed to produce the antibody.
The present invention also provides an antibody-drug conjugate comprising said antibody attached to a drug.
The present invention also provides a pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising said antibody.
The present invention also provides a use of said antibody for preparation of a pharmaceutical composition for preventing or treating angiogenesis-related disease.
The present invention also provides said antibody for use in preventing or treating angiogenesis-related disease.
The present invention also provides a method for treating angiogenesis-related disease, comprising administering said antibody or said pharmaceutical composition to a subject in need thereof.
The present invention also provides a composition for the suppression of angiogenesis, comprising said antibody.
The present invention also provides a use of said antibody for preparation of a composition for suppression of angiogenesis.
The present invention also provides said antibody for use in suppression of angiogenesis.
The present invention also provides a method for suppressing angiogenesis, comprising administering said antibody or said pharmaceutical composition to a subject in need thereof.
The present invention also provides a diagnostic composition for angiogenesis-related disease, comprising said antibody.
The present invention also provides a use of said antibody for preparation of a diagnostic composition for angiogenesis-related disease.
The present invention also provides said antibody for use in in-vitro diagnosis of angiogenesis-related disease.
The present invention also provides a diagnostic kit for angiogenesis-related disease, comprising said diagnostic composition.
The present invention also provides a method for diagnosing angiogenesis-related disease, comprising detecting clec14a through antigen-antibody complexes in an isolated biological sample from a subject with suspected angiogenesis-related disease.
The present invention also provides a polypeptide, comprising isolated CTLD of clec14a, serving as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
The present invention also provides a polypeptide, comprising isolated N-terminal or C-terminal of CTLD of clec14a as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
The present invention also provides a polypeptide, comprising an amino acid fragment from 1st amino acid to 42nd amino acid in CTLD of clec14a or a amino acid fragment from 122nd amino acid to 142nd amino acid in CTLD of clec14a as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
The present invention also provides a method for preparing an antibody binding specifically to clec14a (C-type lectin domain family 14, member A), comprising: biopanning using said polypeptide as an epitope.
The present invention also provides a composition for suppressing angiogenesis, comprising a material for inhibiting the expression of clec14a.
The present invention also provides a kit for suppressing angiogenesis, comprising said composition.
The present invention also provides a method for suppressing angiogenesis, comprising administering said composition to a subject in need thereof.
The present invention also provides a method for treating angiogenesis-related disease, comprising administering said composition to a subject in need thereof.
The present invention also provides a use of said material for inhibiting the expression of clec14a for preparation of a composition for suppressing of angiogenesis.
The present invention also provides said material for inhibiting the expression of clec14a for use in suppression of angiogenesis.
The present invention also provides a pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising fusion protein of CTLD of clec14a and Fc.
The present invention also provides a use of said fusion protein of CTLD of clec14a and Fc for preparation of a pharmaceutical composition for preventing or treating angiogenesis-related disease.
The present invention also provides said fusion protein of CTLD of clec14a and Fc for use in preventing or treating angiogenesis-related disease.
The present invention also provides a method for treating angiogenesis-related disease, comprising administering said fusion protein of CTLD of clec14a and Fc or said pharmaceutical composition to a subject in need thereof.
Other features and embodiments of the present invention will be more apparent from the following detailed descriptions and the appended claims.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1. shows the effect of clec14a CTLD in cell migration. a. Migration of COS-7 cells transfected with GFP, clec14a-GFP, or clec14aΔCTLD-GFP in the wound healing assay was monitored under a light microscope. Images were captured at 0 hr (top) and 20 hr (bottom). b. Distance migrated is expressed as percent of control migration. Values represent mean ± SD of triplicate measurements from one of three independent experiments.
Figure 2. shows the effect of clec14a CTLD on filopodium formation. COS-7 cells (a) and HUVECs (b) transfected with GFP, clec14a-GFP, and clec14aΔCTLD-GFP were fixed, stained with rhodamine-phalloidin and Hoechst, and examined by fluorescence microscopy (1000×). Arrows indicate regions of filopodium formation. Results are representative of three independent experiments.
Figure 3. shows isolation of scFv clones specific to human and mouse CTLDs. a. A human synthetic scFv antibody library was precleared of Fc binders and screened by alternative biopanning with recombinant hCTLD-Fc or mCTLD-Fc. b-d. Ninety-six phage clones (1-96) displaying scFv were randomly selected and the supernatants were analyzed by phage ELISA. Reactivity of the selected scFv clones to human and mouse CTLDs was assayed by measuring absorbance at 450 nm. Arrows indicate scFv clones reactive to hCTLD-Fc (■, black) and mCTLD-Fc (■, grey), and not reactiv to Fc (□). BSA (▨) served as a background control.
Figure 4. shows cross-species reactivity of clec14a-CTLD IgGs to human and mouse CTLDs. ELISA was performed with purified, selected IgG scFv clones (clones 1-4) on 96-well microtiter plates coated with hCTLD-Fc (■, black), mCTLD-Fc (■, grey), and Fc (□). BSA (▨) served as a background control. Values represent mean ± SD of triplicate measurements from one of two independent experiments.
Figure 5. shows the effect of clec14a-CTLD IgGs on endothelial cell migration and tube formation. a. After wounding, migration of HUVECs incubated in the absence (MOCK) or presence of clec14a-CTLD IgG (clones 1-4) or cetuximab was monitored by light microscopy. Images were captured at 0 hr (top) and 9 hr (bottom). b. Distance migrated is expressed as percent of control (MOCK) migration. Values represent mean ± SD of triplicate measurements from one of three independent experiments. c. Tube formation was assayed in the absence (MOCK) or presence of clec14a-CTLD IgG (clones 1-4) or cetuximab. d. Extent of tube formation is expressed as percent of control (MOCK) tube formation. Values represent mean ± SD of triplicate measurements from one of three independent experiments.
Figure 6. shows the effect of clec14a-CTLD IgGs on endothelial cell proliferation and activation. a. HUVECs were incubated in the absence (MOCK) or presence of clec14a-CTLD IgGs, cetuximab, or 5-FU (positive control) for 2 days. Cell viability was assessed by measuring absorbance at 450 nm. Values represent mean ± SD of triplicate measurements from one of two independent experiments. b. HUVECs were cultured in the absence (dashed line) or presence (solid line) of hTNFα, clec14a-CTLD IgGs, or cetuximab; stained with anti-VCAM-1 (upper) or ICAM-1 (lower) polyclonal antibody; and analyzed by flow cytometry. hTNFα served as a positive control for endothelial cell activation. Results are representative of three independent experiments.
Figure 7. shows the effect of clec14a-CTLD IgGs on clec14a-mediated cell-cell contact. a. HEK293F cells transfected with GFP and clec14a-GFP were incubated in the absence (MOCK) or presence of clec14a-CTLD IgGs or cetuximab for 8 hr. Cell aggregates (mass >4 cells; arrowheads) were counted under a optical microscope. The number of aggregates per field is shown in b. Values represent mean ± SD of triplicate measurements from one of three independent experiments.
Figure 8. shows the effect of clec14a-CTLD IgG on CTLD-CTLD interaction. a. Lysates of COS-7 cells transfected with GFP, clec14a-GFP, or clec14aΔCTLD-GFP were analyzed by immunoblotting with anti-GFP or anti-β-actin antibody. b. COS-7 cells expressing GFP (white), clec14a-GFP (black), or clec14aΔCTLD-GFP (light gray) were incubated with 0.15 ㎍ hCTLD-Fc or Fc and CTLD-CTLD interaction was measured by ELISA. c. Lysates of COS-7 cells transfected with GFP or clec14a-GFP were incubated with hCTLD-Fc that had been pre-incubated with increasing concentrations of clec14a-CTLD IgG (clone 1). Values represent mean ± SD of triplicate measurements from one of three independent experiments.
Figure 9. shows the effect of clec14a-CTLD IgG on the down-regulation of clec14a on the surface of endothelial cells. a. Fixed and unfixed HUVECs were incubated in the presence (dotted line) or absence (solid line) of a clec14a-CTLD IgG (clone 1) and analyzed by flow cytometry. b. Clec14a on the surface of HUVECs incubated with clec14a-CTLD IgG (white) or Fc (black) for the indicated time was was assayed by cell ELISA. Values represent mean ± SD of triplicate measurements from one of three independent experiments.
Figure 10. shows the specificity of clec14a-CTLD IgGs to partial fragment of CTLD of clec14a. a. fusion proteins of Fc and partial fragment of CTLD of clec14a. b. the graph showing specificity of clec14a-CTLD IgGs of both clone 1 (upper graph) and clone 2 (lower graph) to the fusion proteins of Fc and partial fragment of CTLD of clec14a, wtCTLD-Fc and Fc, respectivity.
Figure 11. is a graph showing the inhibitory effect of hCTLD-Fc on tube formation.
BEST MODE FOR CARRYING OUT THE INVENTION
In accordance with an aspect thereof, the present invention provides an antibody binding specifically to clec14a (C-type lectin domain family 14, member A).
Preperably, the antibody may be an antibody binding specifically to CTLD (C-type lectin like domain) of clec14a (C-type lectin domain family 14, member A).
As used herein, the term "antibody" means a protein molecule which comprises an immunoglobulin molecule immunologically reactive to a certain antigen, serving as a receptor specifically recognizing the antigen, and is intended to encompass polyclonal antibodies, monoclonal antibodies, whole antibodies and antibody fragments. In addition, chimeric antibodies (e.g., humanized murine antibodies), bivalent or bispecific molecules (e.g., bispecific antibodies), diabodies, triabodies, and tetrabodies fall within the scope of the antibody useful in the present invention. A whole antibody consists of two full-length light chains and two full-length heavy chains, with disulfide bonds between the light and heavy chains. In mammals, there are five antibody isotypes known as IgA, IgD, IgE, IgM and IgG, and IgG is further divided into four subtypes of IgG1, IgG2, IgG3 and IgG4. The term "antibody fragment" refers to a fragment which retains at least the antigen-binding function, and may include Fab, F(ab'), F(ab')2, and Fv. Fab is composed of one variable region of each of the heavy and the light chain, the constant domain of the light chain, and the first constant domain (CH1) of the heavy chain, with an antigen binding site. Fab' is different from Fab in that it further comprises at least one cysteine residue at the C-terminus of the CH1 domain of the heavy chain. F(ab')2 consists of two molecules of Fab' with a disulfide bond between the cysteine residues of the hinge region. Fv (variable fragment), composed of one variable region of each of the heavy and the light chain, is the smallest antibody fragment containing the original specificity of the parent immunoglobulin. Disulfide-stabilized Fv (dsFv) is formed by linking the variable region of the heavy chain to the variable region of the light chain via a disulfide bond. Single chain Fv (scFV) is an Fv in which the respective variable regions of the heavy and the light chain are covalently connected by a peptide linker. These antibody fragments can be obtained using proteases (for example, digestion of a whole antibody with papain or pepsin affords Fab or F(ab')2, respectively), and preferably may be constructed by genetic recombination technology.
Conventionally, antibody screening has been conducted using the overall extracellular regions of target proteins, resulting in problems with the separation of antibodies. In the present invention, an improvement in antibody screening is made with the use of a functional domain of the target protein, so as to produce antibodies more quickly. In one embodiment of the present invention, the CTLD of clec14a was identified as playing an important role in angiogenesis and was used in antibody screening. The process of antibody screening is schematically illustrated in FIG. 3a.
The term "monoclonal antibody", as used herein, refers to an antibody molecule with a uniform molecular composition, obtained from a substantially identical population of antibodies, which shows binding specificity and affinity for a single epitope.
Typically, an immunoglobulin has a basic structural unit composed two heavy and two light chains. Each heavy chain comprises one variable region (also known as "region") and three constant domains while each light chain is composed of one variable region and one constant domain. The variable region of each of the light and the heavy chain comprises three complementarity-determining regions (hereinafter referred to as "CDRs") and four framework regions. CDRs function to bind to an epitope of an antibody. CDRs on each chain start from the N terminus and are arranged sequentially as CDR1, CDR2, and CDR3. They are discriminated by the chain on which they are positioned.
As used herein, the term "human antibody" is a molecule which consists entirely of the amino acid sequence of all components of human immunoglobulin, including CDRs, framework regions, and the like. In the therapy of human diseases, human antibodies have at least three potential advantages. First, human antibodies more preferably interact with the human immune system to more effectively destroy target cells by, for example, complement-dependent cytotoxicity (CDC) or antibodydependent cell-mediated cytotoxicity (ADCC). Another advantage is that the human immune system does not recognize human antibodies as foreign molecules. Moreover, the half-lives of human antibodies are similar to those of naturally occurring antibodies in the human circulatory system even when they are administered in smaller doses or with less frequency. Therefore, the antibody according to the present invention may be preferably a human monoclonal antibody that can be useful for the therapy of angiogenesis-related diseases or cancer not only because it has potent affinity for clec14a, preferably clec14a-CTLD expressed on human endothelial cells which effectively inhibits clec14a-mediated angiogenesis, but also because it shows low immunogenicity because both of its heavy and light chains are derived from a human.
The term "clec14a (C-type lectin domain family 14, member A)," as used herein, means a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Clec14a is a type I transmembrane protein, the extracellular domain of which consists of a C-type lectin-like domain (CTLD), a series of epidermal growth factor-like domains, and a sushi-like domain. Information about clec14a may be obtained from a public database such as NCBI GenBank. For example, human clec14a may have Gene ID No 161198, but is not limited thereto. Clec14a is known to be involved in cell to cell adhesion and angiogenesis, but its concrete mechanism and substantial domains responsible for angiogenesis have remained unidentified. It is the present inventors that first found that CTLD, a domain stretching from amino acids 31st to amino acids 172nd on the amino acid sequence of cle14a, plays a key role in angiogenesis.
The term "C-type lectin-like domain (CTLD) of clec14a (C-type lectin domain family 14, member A)," as used herein, is interchangeable with the term "clec14a-CTLD" or "clec14a CTLD".
In accordance with another aspect thereof, the present invention provides an isolated polypeptide of clec14a (C-type lectin domain family 14, member A)-CTLD (C-type lectin like domain) as an epitope available for the suppression of angiogenesis. Preferably, clec14a may be derived from human, chimpanzee or mouse.
As used herein, the term "epitope" refers to the part of an antigen that determines antigen specificity, and may be interchangeably used with an antigenic determinant or an antigen determining site. For the purpose of the present invention, the epitope refers to CTLD having an amino acid sequence stretching from amino acids 31st to amino acids 172nd on the amino acid sequence of clec14a, which is available for the suppression of angiogenesis, or may refer to a polypeptide having the same function with the CTLD. Thus the extra region of CTLD may be included. So long as it has the same role in CTLD, any polypeptide, for example, having an identity of 80%, 85%, 90%, 95%, 98% or 99% or higher with the amino acid sequence, may be used as the epitope. Amino acid sequences of human, mouse and chimpanzee CTLDs, stretching from amino acids 31st to amino acids 172nd, are given in Table 1, and named SEQ ID NOS: 9, 10, and 133, respectively. The present inventors first found that the amino acid sequences of SEQ ID NOS: 9, 10 and 133 can serve as epitopes which can be used to produce antibodies suppressive of angiogenesis.
Also, in one preferred embodiment, it is suggested that the N-terminal or C-terminal region of CTLD can serve as epitopes which can be used to produce antibodies suppressive of angiogenesis (Fig. 10b). Preferably, the N-terminal region of CTLD may be a region comprising an amino acid fragment from 1st amino acid to 42nd amino acid in CTLD or an amino acid fragment from 1st amino acid to 62nd amino acid in CTLD. Preferably, the C-terminal region of CTLD may be a region comprising an amino acid fragment from 82nd amino acid to 142nd amino acid in CTLD, an amino acid fragment from 62nd amino acid to 142nd amino acid in CTLD, or an amino acid fragment from 122nd amino acid to 142nd amino acid in CTLD.
The antibodies may bind specifically to clec14a-CTLD or its effective fragments to inhibit angiogenesis, the present inventors suggest that clec14a-CTLD is a unique domain that regulates angiogenesis in a CTLD-CTLD interaction-dependent manner. First, clec14a-CTLD, particularly amino acids 31-172, played a key role in clec14a-mediated cell migration by regulating actin cytoskeletal rearrangement. Second, consistent with our observation that clec14a-CTLD IgG specifically suppresses clec14a-mediated cell-cell contacts. Third, clec14a modulation by clec14a-CTLD IgG specifically inhibited HUVEC migration and tube formation. Finally, formation of clec14a CTLD-CTLD complexes was specifically inhibited by clec14a-CTLD IgG.
The high-affinity clec14a-CTLD IgGs specifically inhibited endothelial cell migration and tube formation without affecting cell viability and activation. clec14a is expressed exclusively on endothelial cells and may be a specific, tumor endothelial cell marker. It is reasonable to speculate that the clec14a-CTLD antibodies might have fewer adverse effects in normal endothelium, target clec14a expressed exclusively on tumor endothelium, and suppress angiogenesis during clec14a-mediated tumor progression. Further, bevacizumab and cetuximab are therapeutic antibodies that suppress angiogenesis by inhibiting interaction of soluble angiogenic growth factors and their receptors. However, long-term use of these drugs generates a resistant tumor phenotype due to redundancy of tumor cell-secreted pro-angiogenic growth factors. This may pose the greatest challenge to use of antibodies against soluble growth factors in patients requiring long-term therapy. Clec14a is a type I transmembrane protein critical for endothelial cell to cell contact. The clec14a-CTLD IgG developed here specifically blocked CTLD-CTLD interaction in a concentration-dependent manner and clec14a cross-linking by IgG induced clec14a down-regulation on endothelial cell membranes. Within 2 hr of cross-linking, clec14a-CTLD IgG appeared in a dot-like pattern inside HUVECs, suggesting antibody-induced endocytosis. Thus, clec14a-CTLD IgG may have a dual mechanism of action in suppressing angiogenesis.
Accordingly, the antibody can suppress angiogenesis preferably by inhibiting cell migration, tube formation, or cell-cell contact, more preferably by inhibiting clec14a-mediated cell migration, tube formation, clec14a-mediated cell-cell contact, or clec14a CTLD-CTLD complex formation, or inducing the down-regulation of clec14a on the surface of vascular endothelial cells.
Having no influence on the viability and activation of endothelial cells (FIGS. 6A and 6B), the antibody of the present invention can be used as therapeutic antibodies.
In one embodiment of the present invention, the clec14a-CTLD IgG of the present invention was identified as inhibiting endothelial cell migration (FIGS. 5a and 5b) and tube formation (FIGS. 5c and 5d), and to specifically suppress clec14a-mediated cell-cell contact (FIGS. 7a and 7b), indicating that the antibody can inhibit endothelial cell-cell contact during tumor angiogenesis. In addition, clec14a CTLD-CTLD interaction was blocked by the clec14a-CTLD IgG (FIGS. 8a, 8b and 8c). Moreover, the antibody of the present invention was found to induce the down-regulation of clec14a on the surface of HUVEC (FIGS. 9a and 9b). These results suggest that the antibody of the present invention effectively inhibits clec14a-mediated angiogenesis and thus can be applied to the therapy of angiogenesis-related diseases or cancer.
Preferably, the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 14, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 16, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 18, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 42, light -chain CDR2 defined by the amino acid sequence of SEQ ID NO: 44, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 46, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 125 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 129, but is not limited thereto. The nucleic acid encoding the antibody may comprise a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 70, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 72, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 74, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 77, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 79, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 81, but is not limited thereto. In one embodiment of the present invention, a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 125 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 129 is designated as clone 1. A nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 133 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 134 for the light-chain variable region, but is not limited thereto.
In one preferred embodiment, the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 21, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 23, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 25, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 49, light-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 51, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 53, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 126 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 130, but is not limited thereto. The nucleic acid encoding the antibody may comprise a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 84, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 86, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 88, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 91, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 93, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 95, but is not limited thereto. In one embodiment of the present invention, a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 126 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 130 is designated clone 2. A nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 135 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 136 for the light-chain variable region, but is not limited thereto.
In another preferred embodiment, the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 28, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 30, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 32, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 56, light-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 58, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 60, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 127 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 131, but is not limited thereto. The nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 98, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 100, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 102, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 105, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 107, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 109, but is not limited thereto. In one embodiment of the present invention, a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 127 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 131 is designated as clone 3. A nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 137 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 138 for the light-chain variable region, but is not limited thereto.
In a further embodiment, the antibody of the present invention may comprise a heavy-chain variable region comprising heavy-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 35, heavy-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 37, and heavy-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 39, and a light-chain variable region comprising light-chain CDR1 defined by the amino acid sequence of SEQ ID NO: 63, light-chain CDR2 defined by the amino acid sequence of SEQ ID NO: 65, and light-chain CDR3 defined by the amino acid sequence of SEQ ID NO: 67, and more preferably may comprise a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 128 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 132, but is not limited thereto. The nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 112, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 114, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 116, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 119, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 121, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 123, but is not limited thereto. In one embodiment of the present invention, a human monoclonal antibody comprised of a heavy-chain variable region having the amino acid sequence of SEQ ID NO: 128 and a light-chain variable region having the amino acid sequence of SEQ ID NO: 132 is designated as clone 4. A nucleic acid encoding the antibody may comprise the nucleotide sequence of SEQ ID NO: 139 for the heavy-chain variable region, and the nucleotide sequence of SEQ ID NO: 140 for the light-chain variable region, but is not limited thereto.
As such, even the antibodies composed of heterogeneous sequences were found to inhibit angiogenesis so long as they specifically recognize clec14a-CTLD. Therefore, they were identified as effectively applicable to the prophylaxis or therapy of angiogenesis-related diseases or cancer.
When the antibody of the present invention comprises a constant domain, it may be derived from IgG, IgA, IgD, IgE, IgM, or combinations or hybrids thereof.
The "combination", as used herein, means that polypeptides encoding single-chain immunoglobulin Fc fragments of the same origin are linked to a single-chain polypeptide of a different origin to form a dimer or multimer. That is, a dimer or multimer may be formed from two or more constant domains selected from the group consisting of constant domains of IgG, IgA, IgD, IgE and IgM.
The term "hybrid", as used herein, means that sequences encoding two or more heavy-chain constant domains of different origins are present in a single-chain immunoglobulin heavy-chain constant domain. For example, domain hybrids may be composed of one to four domains selected from the group consisting of CH1, CH2, CH3 and CH4 of IgG, IgA, IgD, IgE and IgM. Also, a combination or a hybrid may be made from heavy-chain constant domains of the IgG subtypes IgG1, IgG2, IgG3 and IgG4. The combination and the hybrid are as defined above.
In addition, when the antibody of the present invention further comprises a light-chain constant region, it may be derived from the lamda (λ) or kappa (κ) light chain.
Preferably, the antibody may be a human monoclonal antibody that can specifically bind to murine clec14a-CTLD as well as human clec14a-CTLD thereby inhibiting angiogenesis. The ability of the human antibody to function in both humans and mice, that is, the cross-reactivity, provides the advantage of rendering the human antibody applicable to a pre-clinical study in mice.
In accordance with a further aspect thereof, the present invention provides a vector comprising said nucleic acid, and a host cell comprising said vector or said nucleic acid.
In accordance with a further aspect thereof, the present invention provides a method for preparing an antibody specifically binding to clec14a (C-type lectin domain family 14, member A), prefrably human clec14a-CTLD (C-type lectin like domain) or human and murine clec14a-CTLD. Preferably, the antibody may be a human monoclonal antibody. The method for preparing the antibody may comprise biopanning using functional domain. Additionally, the present invention provides a method of producing said antibody, comprising culturing said host cell such that the nucleic acid is expressed to produce the antibody.
The monoclonal antibody of the present invention may be easily prepared using a well-known technique. To quote an example, the production of monoclonal antibodies may be achieved by, but is not limited to, a hybridoma constructed with B lymphocytes from immunized animals (Koeher and Milstein, 1976, Nature, 256:495), or a phage display technology.
Preferably, the production of the monoclonal antibody of the present invention may be implemented using a phage display technology. The method of the present invention may be stepwise conducted with reference to, for example, Barbas et al. (METHODS: A Companion to Methods in Enzymology 2: 119, 1991 and J. Virol. 2001 Jul;75(14):6692-9), and Winter et al. (Ann. Rev. Immunol. 12:433, 1994). The phage useful for constructing an antibody library may be filamentous phage which may be exemplified by fd, M13, f1, If1, Ike, Zj/Z, Ff, Xf, Pf1 and Pf3, but is not limited thereto. Examples of the vector that can be used to display exogenous genes on the surface of the filamentous phage include phage vectors such as fUSE5, fAFF1, fdCAT1 and fdtetDOG, or phagemid vectors such as pHEN1, pComb3, pComb8 and pSEX, but are not limited thereto. A helper phage is used to supply a wild-type version of the coat proteins that are required for the successful reinfection of recombinant phage for amplification and may be exemplified by, but is not limited to, M13K07 and VSCM13.
A polynucleotide encoding the hybridoma-derived monoclonal antibody or phage display clone according to the present invention may be readily isolated and sequenced using a typical process. For example, oligonucleotide primers which are designed to specifically amplify heavy- and light-chain coding regions from a hybridoma or phage template DNA may be employed. Once it is isolated, the polynucleotide may be inserted into an expression vector which may be then introduced into a host cell. The resulting host cell (i.e., transformant) thus can produce the monoclonal antibody of interest. Accordingly, the preparation method of the antibody of the present invention may comprise amplifying an expression vector carrying a polynucleotide coding for the antibody. Preferably, a recombinant antibody may be prepared by pre-clearing a Fc binder from a human scFv library and conducting a biopanning technique with a functional domain to select a specific clone.
In accordance with still a further aspect thereof, the present invention provides a polynucleotide coding for the epitope or the antibody, an expression vector carrying the polynucleotide, and a transformant anchoring the vector therein.
The antibody is as described above.
The expression vector carrying the epitope or the antibody according to the present invention may include, but is not limited to, a vector that allows the replication and/or expression of the polynucleotide in eukaryotic or prokaryotic cells such as mammalian cells (e.g., humans, monkeys, rabbits, rats, hamsters, mice, etc.), plant cells, yeasts, insect cells and bacterial cells (e.g., E. coli). Preferably, the vector has a suitable promoter operably linked to the polynucleotide so as to induce the expression of the gene of interest, and at least one selection marker. For example, the polynucleotide may be introduced into a phage, a plasmid, a cosmid, a mini-chromosome, a virus, or a retroviral vector.
The expression vector carrying a polynucleotide coding for the antibody may be a combination of expression vectors carrying polynucleotides coding for the heavy chain of the antibody and the light chain of the antibody, respectively, or an expression vector carrying both the polynucleotides coding for the heavy chain of the antibody and the light chain of the antibody.
Examples of the transformant resulting from the introduction of the expression vector according to the present invention include, but are not limited to, bacterial cells, such as E. coli, streptomyces, Salmonella typhimurium; yeasts; fungi such as Pichia pastoria; insect cells, such as drosophila, spodoptera Sf9; animal cells, such as CHO (Chinese hamster ovary cells), SP2/0 (mouse myeloma), human lymphoblastoid, COS, NSO (mouse myeloma), 293T, melanoma cells, HT-1080, BHK (baby hamster kidney cells), HEK (human embryonic kidney cells), and PERC.6 (human retina cell); and plant cells.
The term "introduction", as used herein, is intended to mean the delivery of the polynucleotide coding for the epitope or the antibody into cells. The introduction can be carried out using various methods well known in the art, including calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroporation, microinjection, liposome fusion, Lipofectamine transfection, and protoplast fusion. Transduction refers to a process whereby foreign DNA is transferred to another cell via a viral vector on the basis of infection. In addition, the delivery of a vector into host cells may be achieved by gene bombardment. In the present invention, introduction may be interchangeably used with transformation.
In accordance with still another aspect thereof, the present invention provides a composition for the suppression of angiogenesis, comprising the antibody.
Since the antibody of the present invention is able to effectively suppress angiogenesis, the composition comprising the antibody as an active ingredient can be useful for suppressing angiogenesis and further for preventing or treating angiogenesis-related diseases.
As used herein, the term "suppression of angiogenesis" means the suppression of the formation or growth of new blood vessels from pre-existing vessels. For the purpose of the present invention, the suppression of angiogenesis is achieved by inhibiting cell migration, cell to cell contacts, more preferably by inhibiting clec14a-mediated cell migration, clec14a-mediated cell-cell contacts, HUVEC migration, or tube formation, clec14a CLTD-CLTD complex formation.
The term "angiogenesis-related disease", as used herein, means a disease that involves angiogenesis in its onset or progression. So long as it can be treated with the antibody, any disease may be within the scope of the angiogenesis-related diseases without limitation. Examples of the angiogenesis-related disease include cancer, metastasis, diabetic retinopathy, retinopathy of prematurity, corneal graft rejection, macular degeneration, neovascular glaucoma, erythrosis, proliferative retinopathy, psoriasis, hemophilic arthritis, capillary formation in atherosclerotic plaques, keloid, wound granulation, vascular adhesion, rheumatoid arthritis, osteoarthritis, autoimmune diseases, Crohn’s disease, restenosis, atherosclerosis, intestinal adhesions, cat scratch disease, ulcer, liver cirrhosis, nephritis, diabetic nephropathy, diabetes mellitus, inflammatory diseases, and neurodegenerative diseases, but are not limited thereto. Also, the cancer is selected from the group consisting of esophageal cancer, stomach cancer, large intestine cancer, rectal cancer, oral cancer, pharynx cancer, larynx cancer, lung cancer, colon cancer, breast cancer, uterine cervical cancer, endometrial cancer, ovarian cancer, prostate cancer, testis cancer, bladder cancer, renal cancer, liver cancer, pancreatic cancer, bone cancer, connective tissue cancer, skin cancer, brain cancer, thyroid cancer, leukemia, Hodgkin’s lymphoma, lymphoma and multiple myeloid blood cancer, but are not limited thereto.
As used herein, the term “prevention” or “prophylaxis” is intended to refer to any action resulting in the suppression or delay of the onset of diseases of interest thanks to the administration of the antibody or composition according to the present invention. The term “treatment” or “therapy” is intended to refer to any action resulting in an improvement in the symptoms of a disease of interest or the beneficial alteration of the symptoms thanks to the administration of the antibody or composition according to the present invention.
The composition comprising the antibody of the present invention is preferably a pharmaceutical composition and may further comprise a suitable vehicle, excipient or diluent typically used in the art.
The pharmaceutical composition comprising a pharmaceutically acceptable vehicle may be in various oral or non-oral dosage forms, such as tablets, pills, powders, granules, capsules, suspension, internal use solutions, emulsions, syrups, sterile aqueous solutions, non-aqueous solutions, suspensions, lyophilizates, and suppositories. In this regard, the pharmaceutical composition of the present invention may be formulated in combination with a diluent or excipient such as a filler, a thickener, a binder, a wetting agent, a disintegrant, a surfactant, etc. Solid preparations intended for oral administration may be in the form of tablets, pills, powders, granules, capsules, and the like. In regards to these solid agents, the compound of the present invention is formulated in combination with at least one excipient such as starch, calcium carbonate, sucrose, lactose, or gelatin. In addition to a simple excipient, a lubricant such as magnesium stearate, talc, etc. may be used. Among liquid preparations intended for oral administration are suspensions, internal use solutions, emulsion, syrups, and the like. In addition to a simple diluent such as water or liquid paraffin, various excipients, such as wetting agents, sweeteners, aromatics, preservatives, and the like may be contained in the liquid preparations. Also, the pharmaceutical composition of the present invention may be in a parenteral dosage form such as sterile aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilizates, suppositories, and the like. Injectable propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and esters such as ethyl oleate may be suitable for the non-aqueous solvents and suspensions. The basic materials of suppositories include Witepsol, macrogol, Tween 61, cacao butter, laurin butter, and glycerogelatin.
The composition of the present invention is administered in a pharmaceutically effective amount.
The term "pharmaceutically effective amount", as used herein, is intended to refer to an amount of a pharmaceutical composition for treating a disease that is sufficient, at a reasonable benefit/risk ratio applicable to any medical treatment. The effective amount may vary depending on various factors including the severity of the disease being treated, the patient's age and sex, the kind of disease, drug activity, sensitivity to the drug, the time of administration, the route of administration, the rate of excretion, the period of time of treatment, the co-administration of drugs, and other parameters well known in the art. The composition of the present invention may be administered alone or in combination with other therapeutics. In this case, the administration may be conducted sequentially or simultaneously together with conventional therapeutics. Also, the composition may be administered in a single dose or may be divided into multiple doses. In full consideration of these factors, it is important to administer a minimal dose sufficient to being about a maximal effect without side effects. The dose can be readily determined by an expert in the art. The dose of the pharmaceutical composition of the present invention is not imparted with special limitations, but varies depending on various factors including patient's health state and weight, the severity of disease, the kind of drug, the route of administration, and the time of administration. The composition may be administered in a single dose or in multiple doses per day into mammals including rats, domestic animals, humans, etc. via any typically accepted route, for example, orally, rectally, intravenously, subcutaneously, intrauterinely, or intracerebrovascularly.
In accordance still another aspect thereof, the present invention provides a method for suppressing angiogenesis, comprising administering the antibody or the composition to a subject in need thereof.
The antibody, the composition and the suppression of angiogenesis are as elucidated above.
In detail, the suppressing method of the present invention comprises administering the pharmaceutical composition at a pharmaceutically effective dose to a subject in need of the suppression of angiogenesis. The subject may be a mammal, such as a dog, cow, horse, rabbit, mouse, rat, chicken, and human, but is not limited thereto. The pharmaceutical composition may be administered parenterally, subcutaneously, intraperitoneally, intrapulmonarily, or intranasally, or by a suitable method including, if necessary, intralesional injection for topical treatment. The preferred dose of the pharmaceutical composition of the present invention varies depending on various factors including in the subject's health state and weight, the severity of the disease, the kind of drug, the route of administration, and the time of administration, and can be readily determined by those skilled in the art.
In accordance with yet still another aspect thereof, the present invention provides a pharmaceutical composition for preventing or treating cancer, comprising the antibody.
The terms "antibody", "preventing", and "treating" are as described above.
So long as it is treatable with the peptide of the present invention, the cancer is not subject to any limitation. Preferred is a cancer in which clec14a-mediated tumor progression takes place. In detail, the onset or progression of cancer is prevented by suppressing angiogenesis with the antibody of the present invention. Examples of the cancer include esophageal cancer, stomach cancer, large intestine cancer, rectal cancer, oral cancer, pharynx cancer, larynx cancer, lung cancer, colon cancer, breast cancer, uterine cervical cancer, endometrial cancer, ovarian cancer, prostate cancer, testis cancer, bladder cancer, renal cancer, liver cancer, pancreatic cancer, bone cancer, connective tissue cancer, skin cancer, brain cancer, thyroid cancer, leukemia, Hodgkin’s lymphoma, lymphoma and multiple myeloid blood cancer, but are not limited thereto.
In addition, the antibody of the present invention may be used in combination with other antibodies or biologically active agents or materials for various purposes.
In one embodiment of the present invention, the antibody of the present invention was found to suppress angiogenesis, resulting in the retardation or prevention of the onset or progression of cancer. Hence, the antibody of the present invention is effectively applicable to the prophylaxis or therapy of cancer.
In accordance with yet still a further aspect thereof, the present invention provides a method for treating cancer, comprising administering the antibody or the pharmaceutical composition for preventing or treating cancer to a subject in need thereof.
The antibody, the composition and the cancer are as described above.
In the treatment method, the pharmaceutical composition is administered at a pharmaceutically effective dose to a subject suspected of cancer. The subject may be a mammal, such as a dog, cow, horse, rabbit, mouse, rat, chicken, and human, but is not limited thereto. The pharmaceutical composition may be administered parenterally, subcutaneously, intraperitoneally, intrapulmonarily, or intranasally, or by a suitable method including, if necessary, intralesional injection for topical treatment. The preferred dose of the pharmaceutical composition of the present invention varies depending on various factors including the subject's health state and weight, the severity of the disease, the kind of drug, the route of administration, and the time of administration, and can be readily determined by those skilled in the art.
In accordance with yet still a further aspect thereof, the present invention provides a diagnostic composition for cancer,comprising the antibody.
The antibody and the cancer are as described above.
Preferred is a cancer in which clec14a is expressed specifically.
The term "diagnosis", as used herein, refers to evaluation of the presence or properties of pathological states. With respect to the objects of the present invention, the diagnosis is to determine the incidence of cancer.
In accordance with yet still a further aspect thereof, the present invention provides a diagnostic kit for cancer, comprising the diagnostic composition.
The kit of the present invention can detect the marker for cancer, clec14a, preferably CTLD of clec14a. The detection kit of the present invention may comprise an antibody selectively recognizing the marker, as well as one or more kinds of a composition, a solution, or an apparatus, which are suitable for the analysis method.
Preferably, the diagnostic kit may include a matrix, a suitable buffer solution, a coloring enzyme, or a secondary antibody labeled with a fluorescent substance, a coloring substrate or the like for the immunological detection of antibody. As for the matrix, a nitrocellulose membrane, a 96 well plate made of polyvinyl resin, a 96 well plate made of polystyrene resin, and a slide glass may be used. As for the coloring enzyme, peroxidase and alkaline phosphatase may be used. As for the fluorescent substance, FITC and RITC may be used, and as for the coloring substrate solution, ABTS (2, 2'-azino-bis (3-ethylbenzthiazoline-6-sulfonic acid)), OPD (o-phenylenediamine), or TMB (tetramethyl benzidine) may be used.
In accordance with yet still a further aspect thereof, the present invention provides a method for diagnosing cancer, comprising detecting clec14a, preferably clec14a-CTLD through antigen-antibody complexes in a isolated biological sample from a subject with suspected cancer.
The antibody, the cancer, and diagnosis are as described above.
More specifically, the isolation of protein from a biological sample may be achieved using a known process.
The term "biological sample", as used herein includes samples displaying a difference in expression levels of a cancer marker clec14a, preferably clec14a-CTLD, such as tissues, cells, whole blood, serum, plasma, saliva, sputum, cerebrospinal fluid or urine, but is not limited thereto.
With the detection methods, the occurrence of cancer can be diagnosed by comparing the clec14a, preferably clec14a-CTLD, expression level in a patient with suspected cancer to that in a normal control group. That is, the expression level of the marker of the present invention in suspected cancer cell is compared to that in normal cell. If a significant increase in the expression level of the marker is observed in the suspected cancer cell, the suspected cancer can be diagnosed as cancer.
Analysis methods for measuring protein levels include, but are not limited to, Western blotting, ELISA, radioimmunoassay, radialimmunodiffusion, Ouchterlony immunodiffusion, rocket immunoelectrophoresis, immunohistostaining, immunoprecipitation assay, complement fixation assay, FACS, and protein chip assay. With the analysis methods, a patient with suspected cancer is compared with a normal control for the amount of formed antigen-antibody complexes, and the patient's suspected cancer is diagnosed by evaluating a significant increase in expression levels of a protein from the cancer marker gene.
The term "antigen-antibody complexes", as used herein, refers to binding products of a cancer marker protein to an antibody specific thereto. The amount of formed antigen-antibody complexes may be quantitatively determined by measuring the signal intensity of a detection label.
Such a detection label may be selected from the group consisting of enzymes, fluorescent substances, ligands, luminescent substances, microparticles, redox molecules and radioactive isotopes, but the present invention is not limited to the examples. Examples of enzymes available as detection labels include, but are not limited to, β-glucuronidase, β-D-glucosidase, β-D-galactosidase, urase, peroxidase or alkaline phosphatase, acetylcholinesterase, glucose oxidase, hexokinase and GDPase, RNase, glucose oxidase and luciferase, phosphofructokinase, phosphoenolpyruvate carboxylase, aspartate aminotransferase, phosphenolpyruvate decarboxylase, and β-latamase. Examples of the fluorescent substances include, but are not limited to, fluorescein, isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, ophthaldehyde and fluorescamine. Examples of the ligands include, but are not limited to, biotin derivatives. Examples of luminescent substances include, but are not limited to, acridinium esters, luciferin and luciferase. Examples of the microparticles include, but are not limited to, colloidal gold and colored latex. Examples of the redox molecules include, but are not limited to, ferrocene, ruthenium complexes, viologen, quinone, Ti ions, Cs ions, diimide, 1 ,4-benzoquinone, hydroquinone, K4W(CN)8, [Os(bpy)3]2+ ,[RU(bpy)3]2+, and [MO(CN)8]4-. Examples of the radioactive isotopes include, but are not limited to, 3H, 14C, 32P, 35S, 36Cl, 51Cr, 57Co, 58Co, 59Fe, 90Y, 125I, 131I, and 186Re.
Preferably, the protein expression levels are measured by ELISA. Examples of ELISA include direct ELISA using a labeled antibody recognizing an antigen immobilized on a solid support, indirect ELISA using a labeled antibody recognizing a capture antibody forming complexes with an antigen immobilized on a solid support, direct sandwich ELISA using another labeled antibody recognizing an antigen in an antigen-antibody complex immobilized on a solid support, and indirect sandwich ELISA, in which another labeled antibody recognizing an antigen in an antigen-antibody complex immobilized on a solid support is reacted, and then a secondary labeled antibody recognizing the another labeled antibody is used. More preferably, the protein expression levels are detected by sandwich ELISA, where a sample reacts with an antibody immobilized on a solid support, and the resulting antigen-antibody complexes are detected by adding a labeled antibody specific for the antigen, followed by enzymatic color development, or by adding a secondary labeled antibody specific to the antibody which recognizes the antigen of the antigen-antibody complex, followed by enzymatic development. The incidence of cancer may be diagnosed by measuring the degree of complex formation of a cancer marker protein and an antibody thereto.
Further, the protein expression levels are preferably measured by Western blotting using one or more antibodies to the cancer markers. Total proteins are isolated from a sample, electrophoresed to be separated according to size, transferred onto a nitrocellulose membrane, and reacted with an antibody. The amount of proteins produced by gene expression is determined by measuring the amount of produced antigen-antibody complexes using a labeled antibody, thereby diagnosing the incidence of cancer. The detection methods are composed of methods of assessing expression levels of marker genes in a control and cells in which cancer occurs. mRNA or protein levels may be expressed as an absolute (e.g., ㎍/㎖) or relative (e.g., relative intensity of signals) difference in the amount of marker proteins.
In addition, the protein expression levels are preferably measured by immunohistostaining using one or more antibodies against the cancer markers. Normal epithelial tissues and suspected cancer tissues were collected and fixed, and then paraffin-embedded blocks were prepared according to a widely known method. The blocks were cut into small sections (several ㎛ in thickness), and attached to glass slides to be
reacted with one or more selected from the antibodies according to a known method.
Subsequently, the unreacted antibodies were washed, and the reacted antibodies were labeled with an above mentioned detection labele selected from the above, and then observed under a microscope.
It is also preferable to analyze the protein level using a protein chip in which one or more antibodies against the cancer marker are arranged and fixed at a high density at predetermined positions on a substrate. In this regard, proteins are separated from a sample and hybridized with a protein chip to form an antigen-antibody complex, which is then read to examine the presence or expression level of the protein of interest, thereby diagnosing the occurrence of cancer.
In accordance with yet still a further aspect thereof, the present invention provides a composition for suppressing angiogenesis, comprising a material for inhibiting the expression of clec14a.
Preferably, the material may be a material for inhibiting the expression of CTLD of clec14a.
In one embodiment of the present invention, the CTLD of clec14a was identified as playing an important role in inhibiting cell migration and tube formation (eg. filopodium formation) (FIGS. 1a, 1b, 2a and 2b). These results suggest that the material for inhibiting the expression of clec14a, preferably clec14a-CTLD, makes to suppress angiogenesis.
The material for inhibiting the expression of clec14a, preferably clec14a-CTLD, includes antisense oligonucleotides, siRNA oligonucleotides, antibodies, aptamers, single chain variable region fragments, peptides, low-molecular-weight compounds, and natural extracts, but is not limited thereto.
Preferably, the material for inhibiting the expression of clec14a, preferably clec14a-CTLD, is antisense oligonucleotides or siRNA oligonucleotides specifically binding to material for inhibiting the expression of clec14a, preferably clec14a-CTLD gene.
As used herein, the term "antisense oligonucleotide" means DNA or RNA or derivatives thereof containing a nucleic acid sequence complementary to a particular mRNA sequence, and binds to the complementary sequence within mRNA to inhibit translation of mRNA into protein. The antisense oligonucleotide sequence may be a DNA or RNA sequence that is complementary to clec14a, preferably clec14a-CTLD mRNA, and is able to bind to clec14a, preferably clec14a-CTLD mRNA, and it is able to inhibit translation, cytoplasmic translocation, or maturation of clec14a, preferably clec14a-CTLD mRNA or all other activities essential for overall biological functions. The antisense oligonucleotide has a length of 6 to 100 bases, preferably 8 to 60 bases, and more preferably 10 to 40 bases.
The antisense oligonucleotide may be modified at one or more positions of the bases, sugars or backbones in order to have improved effectiveness (De Mesmaeker et al., Curr Opin Struct Biol., 5(3):343-55(1995)). The oligonucleotide backbone may be modified, for example, with phosphorothioates, phosphotriesters, methyl phosphonates, short chain alkyl, cycloalkyl, or short chain heteroatomic or heterocyclic intersugar linkages. Also, the antisense oligonucleotide may contain one or more substituted sugar moieties. The antisense oligonucleotide may also contain modified bases. Examples of the modified bases include hypoxanthine, 6-methyladenine, 5-methyl-pyrimidines (especially, 5-methylcytosine), 5-hydroxymethylcytosine (HMC), glycosyl HMC, gentiobiosyl HMC, 2-aminoadenine, 2-thiouracil, 2-thiothymine, 5-bromouracil, 5-hyroxymethyluracil, 8-azaguanine, 7-deazaguanine, N6 (6-aminohexyl) adenine, and 2, 6-diaminopurine. In addition, the antisense oligonucleotide of the present invention may be chemically bonded to one or more moieties or conjugates enhancing the activity and cellular uptake of the antisense oligonucleotide. For example, liphophilic moieties include, but are not limited to, a cholesterol moiety, a cholesteryl moiety, cholic acid, a thioether, a thiocholesterol, an aliphatic chain, a phospholipid, a polyamine chain, a polyethylene glycol chain, adamantane acetic acid, a palmityl moiety, an octadecylamine moiety and a hexylamino-carbonyl-oxycholesterol moiety. A method of preparing oligonucleotides including lipid moieties is well known in the art (US Patent Nos. 5,138,045, 5,218,105 and 5,459,255). The modified oligonucleotide may have enhanced stability in the presence of nucleases and enhanced binding affinity to target mRNA.
The antisense oligonucleotide may be synthesized in vitro by an ordinary method and administered to the body, or may be synthesized in vivo. A method for synthesizing antisense oligonucleotide in vitro employs RNA polymerase I. A method for synthesizing antisense RNA in vivo involves performing transcription of antisense RNA using a vector containing a multicloning site (MCS) in the opposite direction. Such antisense RNA preferably contains a translation stop codon in its sequence to block translation into a peptide sequence.
Design of the antisense oligonucleotide useful in the present invention may be easily performed by the method known in the art with reference to the nucleotides sequence of clec14a, preferably clec14a-CTLD (Weiss, B. (ed.): Antisense Oligodeoxynucleotides and Antisense RNA: Novel Pharmacological and Therapeutic Agents, CRC Press, Boca Raton, FL, 1997; Weiss, B., et al., Antisense RNA gene therapy for studying and modulating biological processes. Cell. Mol. Life Sci., 55:334-358(1999)).
As used herein, the term “siRNA” refers to a nucleic acid molecule that is able to mediate RNA interference or gene silencing (reference: WO 00/44895, WO 01/36646, WO 99/32619, WO 01/29058, WO 99/07409 and WO 00/44914). Since siRNA can suppress the expression of the target gene, it provides an effective way of gene knockdown or genetic therapy. First discovered in plants, worms, fruit flies and parasites, siRNA has been recently developed and used for studies of mammalian cells.
In the case in which the siRNA molecule is used in the present invention, it may have a structure in which its sense strand (a sequence corresponding to the clec14a, preferably clec14a-CTLD mRNA sequence) and its antisense strand (a sequence complementary to the clec14a, preferably clec14a-CTLD mRNA sequence) form a double strand. Alternatively, it may have a single-stranded structure having self-complementary sense and antisense strands.
The siRNA is not limited to those in which double-stranded RNA moieties constitute complete pairs, but includes the unpaired moieties such as mismatch (corresponding bases are not complementary), bulge (no corresponding base in one chain), etc. The total length of the siRNA may be 10 to 100 bases, preferably 15 to 80 bases, more preferably 20 to 70 bases.
The end of the siRNA may be either blunt or cohesive as long as it is capable of suppressing the expression of the clec14a, preferably clec14a-CTLD gene via RNA interference (RNAi). The cohesive end may be either 3'- or 5'-cohesive end.
In the present invention, the siRNA molecule may have a short nucleotide sequence (e.g., about 5-15 nucleotides) inserted between the self-complementary sense and antisense strands. In this case, the siRNA molecule formed from the expression of the nucleotide sequence forms a hairpin structure via intramolecular hybridization, resulting in a stem-and-loop structure overall. The stem-and-loop structure is processed in vitro or in vivo to give an activated siRNA molecule capable of mediating RNAi.
As used herein, the term "aptamer" refers to a nucleic acid molecule having a binding affinity for a particular target molecule. The aptamer can also inhibit the activity of a particular target molecule by binding to the particular target molecule. The aptamer of the present invention may be an RNA, a DNA, a modified nucleic acid or a mixture thereof. The aptamer of the present invention can also be in a linear or circular form. The aptamer of the present invention is not particularly limited to its length. Typically, it may have a length of approximately 15 - 200 nucleotides, for example, approximately 100 nucleotides or less, preferably approximately 80 nucleotides or less, more preferably approximately 60 nucleotides or less, and most preferably approximately 45 nucleotides or less. The aptamer of the present invention may also have a length of approximately 18, 20 or 25 nucleotides or more. When the total number of nucleotides is smaller, chemical synthesis and mass-production will be easier, and there is a major advantage in terms of cost. Chemical modification is also easy, stability in the body is high, and toxicity is low.
The aptamer of the present invention can be prepared by utilizing the SELEX method or an improved version thereof (for example, Ellington et al., Nature, 1990 346, 818-822; Tuerk et al., Science, 1990 249, 505-510). The SELEX method is a method of selecting an oligonucleotide specifically binding to the target molecule from an oligonucleotide pool having 10-14 different nucleotide sequences. The oligonucleotide used has a random sequence of about 40 residues, which is flanked by primer sequences. This oligonucleotide pool is allowed to mix with a target molecule, and only the RNA that has bound to the target molecule is collected using a filter or the like. The oligonucleotide collected is amplified by RT-PCR, and this is used as a template for the next round. By repeating this operation about 10 times, an aptamer that binds specifically to the target molecule can be acquired. By increasing the number of rounds or using a competing substance, an aptamer exhibiting a stronger binding potential for the target molecule is concentrated and selected. Hence, by adjusting the number of rounds of SELEX and/or changing the competitive condition, aptamers with different binding forces or binding modes, and aptamers with the same binding force or binding mode but different base sequences can be obtained in some cases. The SELEX method includes a process of amplification by PCR; by causing a mutation by using manganese ions or the like in the process, it is possible to perform SELEX with higher diversity.
In addition to the known SELEX method, aptamers can be also obtained using the Cell-SELEX method for complex targets, living cells or tissues (Guo et al. Int. J. Mol. Sci., 9(4): 668, 2008), and the Cell-SELEX method has the advantage of direct selection of aptamers against disease without previous knowledge of the target molecule on the surface. Moreover, the Cell-SELEX method is advantageous over the conventional SELEX method in that a functional approach for the target protein in its physiological state is possible during the selection procedure because it may not show its intrinsic properties when isolated.
Meanwhile, an aptamer binds to the target molecule in a wide variety of binding modes, such as ionic bonds based on the negative charge of the phosphate group, hydrophobic bonds and hydrogen bonds based on ribose, and hydrogen bonds and stacking interaction based on nucleic acid bases. In particular, ionic bonds based on the negative charge of the phosphate group, which are present in the same number as the number of constituent nucleotides, are strong, and bind to lysine and arginine being present on the surface of the positive charge of protein. For this reason, nucleic acid bases not involved in the direct binding to the target molecule can be substituted. In particular, because the region of the stem structure has already formed base pairs and faces the inside of the double helical structure, nucleic acid bases are unlikely to bind directly to the target molecule. Therefore, even when a base pair is replaced with another base pair, the activity of the aptamer often does not decrease. In structures wherein no base pairs are formed, such as loop structures, provided that the nucleic acid base is not involved in the direct binding to the target molecule, base substitution is possible. For example, at the 2'-position of ribose, a hydroxy group is substituted by any atom or group. Examples of the atom or group may include hydrogen atom, fluorine atom or -O-alkyl group (e.g., -O-CH3), -O-acyl group (e.g., -O-CHO), and amino group (e.g., -NH2). The aptamer, unless the functional group involved in the direct binding to the target molecule is substituted or deleted, often retains the activity thereof.
In addition, aptamers are easily modifiable because they permit chemical synthesis. For aptamers, by predicting the secondary structure using the MFOLD program, or by predicting the steric structure by X-ray analysis or NMR analysis, it is possible to predict to some extent which nucleotide can be substituted or deleted, and where to insert a new nucleotide. A predicted aptamer with the new sequence can easily be chemically synthesized, and it can be determined whether or not the aptamer retains the activity using an existing assay system.
The aptamer of the present invention may be one wherein a sugar residue (e.g., ribose) of each nucleotide has been modified to increase the binding activity, stability, drug deliverability and the like. As examples of the modification in a sugar residue, replacement of the oxygen atom at the 2'-position, 3'-position and/or 4'-position of the sugar residue with another atom, and the like can be mentioned. As the kind of the modification, fluorination, O-alkylation (e.g., O-methylation, O-ethylation), Oarylation, S-alkylation (e.g., S-methylation, S-ethylation), S-arylation, and amination (e.g., -NH) can be mentioned. Such alterations in the sugar residue can be performed by a method known per se (e.g., Sproat et al., Nucle. Acid. Res. 1991 19, 733-738; Cotton et al., Nucl. Acid. Res. 1991 19, 2629-2635; Hobbs et al., Biochemistry 1973 12, 5138-5145).
The aptamer of the present invention may also have a nucleic acid base (e.g., purine or pyrimidine) altered (e.g., by chemical substitution) to increase binding activity. As examples of such alterations, pyrimidine alteration at the 5-position, purine alteration at the 6- and/or 8-position(s), alteration with an extracyclic amine, substitution with 4-thiouridine, and substitution with 5-bromo or 5-iodo-uracil can be mentioned.
The phosphate group contained in the aptamer of the present invention may be altered to confer resistance to nuclease and hydrolysis. For example, the P(O)O group may be substituted with P(O)S (thioate), P(S)S (dithioate), P(O)NR2 (amidate), P(O)R, R(O)OR', CO or CH2 (formacetal) or 3'-amine (-NH-CH2-CH2-) [wherein each unit of R or R' is independently H or a substituted or unsubstituted alkyl (e.g., methyl, ethyl)]. The joining group is, for example, -O-, -N- or -S-, and nucleotides can bind to an adjoining nucleotide via these joining groups.
The alterations may also include alterations such as capping at 3' and 5'. An alteration can further be performed by adding to an end a polyethyleneglycol, amino acid, peptide, inverted dT, nucleic acid, nucleosides, Myristoyl, Lithocolic-oleyl, Docosanyl, Lauroyl, Stearoyl, Palmitoyl, Oleoyl, Linoleoyl, other lipids, steroids, cholesterol, caffeine, vitamins, pigments, fluorescent substances, anticancer agents, toxins, enzymes, radioactive substances, biotin and the like. For such alterations, see, for example, US Patent Nos. 5,660,985 and 5,756,703.
In addition, aptamers are attached to the surface of liposomes or nanoparticles to deliver an anticancer agent, a toxin, a tumor suppressor gene, and a siRNA (small interfering RNA) encapsulated in the liposomes or nanoparticles to the target cell.
In the present invention, the material for inhibiting the expression of clec14a, preferably clec14a-CTLD, in particular, its activity is preferably an antibody, a peptide, a low-molecular-weight compound, or a natural extract that specifically binds to clec14a, preferably clec14a-CTLD.
The antibody which can specifically bind to clec14a, preferably clec14a-CTLD, is as elucidated above.
The peptide that specifically binds to clec14a, preferably clec14a-CTLD to inhibit its activity may be obtained by the typical method known in the art, for example, by phage display (Smith GP, "Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface". Science 228 (4705):1315-1317(1985); Smith GP, Petrenko VA, “Phage display”. Chem. Rev. 97(2):391-410(1997)).
Preferably, the composition for suppressing angiogenesis may treat cancer by suppressing angiogenesis.
Preferably, the composition for suppressing angiogenesis may treat angiogenesis-related disease by suppressing angiogenesis.
In accordance with yet still a further aspect thereof, the present invention provides a kit for suppressing angiogenesis, comprising the composition, and wherein the composition comprises material for inhibiting the expression of clec14a, preferably clec14a-CTLD.
In accordance with yet still a further aspect thereof, the present invention provides a method for suppressing angiogenesis, comprising administering the composition to a subject in need thereof, and wherein the composition comprises material for inhibiting the expression of clec14a, preferably clec14a-CTLD. In accordance with yet still a further aspect thereof, the present invention provides a method for treating cancer, comprising administering the composition to a subject in need thereof, and wherein the composition comprises material for inhibiting the expression of clec14a, preferably clec14a-CTLD.
In accordance with yet still a further aspect thereof, the present invention provides an antibody-drug conjugate comprising said antibody of any one among claims 1 to 17 attached to a drug. The drug may be any one selected from the group consisting of a toxin, a chemotherapeutic agent, an anticancer drug, an antibiotic, ADP-ribosyl transferase, a radioactive isotope and a nucleolytic enzyme, but are not limited thereto.
Preferably, the antibody-drug conjugate may be capable of being internalized into a cell. More preferably, the cell may be a cancer cell. In one embodiment of the present invention, clec14a-CTLD IgG can be internalized into a cell expressing clec14a such as a cancer cell (Fig. 9a, 9b).
In accordance with yet still a further aspect thereof, the present invention provides a pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising fusion protein of CTLD of clec14a and Fc.
In one embodiment of the present invention, hCTLD-Fc inhibited tube formation in a concentration-dependent manner (Fig. 11).
MODE FOR THE INVENTION
Hereinafter, the present invention will be described in further detail with reference to examples. It will be obvious to a person having ordinary skill in the art that these examples are illustrative purposes only and are not to be construed to limit the scope of the present invention.
Example 1: Cell culture and transfection
Human umbilical vein endothelial cells (HUVECs, Lonza, Baltimore, MD, USA)were maintained in endothelial growth medium-2 (EGM-2). Mouse aortic endothelial cells (MAECs) and COS-7 cells were grown in Dulbecco's modified Eagle medium containing 10% (v/v) fetal bovine serum and 1% (v/v) penicillin/streptomycin. Cells were maintained in a humidified, CO2-controlled incubator (Sanyo, Panasonic Healthcare Company, Secaucus, NJ, USA) at 37°C and 5% CO2. HEK293F cells were maintained in Freestyle™ 293 expression media (Invitrogen) supplemented with 1% (v/v) penicillin/streptomycin in a humidified Multitron incubation shaker (Infors HT, Bottmingen (Switzerland) at 37℃ and 8% CO2. HUVECs and COS-7 cells were transfected with vectors encoding GFP, clec14a-GFP (wild-type clec14a), or clec14aΔCTLD-GFP (clec14a CTLD deletion mutant) using Lipofectamine 2000 (Invitrogen, Carlsbad, CA, USA) according to the manufacturer's instruction.
Example 2: Construction and preparation of human and mouse CTLD Fc fusion proteins
DNA encoding amino acid residues 31-172 of hCTLD was amplified using the primers 5'-TCGCGCGGCCGCTGCTCGGCCTCGGGGGCCTGC-3' (SEQ ID NO:1) and 5'-TCGCCTCGAGCTTGCACAGGTAGCCGTTGG-3' (SEQ ID NO:2). DNA encoding the same residues of mCTLD was amplified using the primers 5'-TCGCGGCCCAGGCGGCCTGTTCGGCCTCGGGGGCTTG-3' (SEQ ID NO:3) and 5'- TCGCGGCCGGCCTGGCCCTTGCATAGGTAGCCATCGG-3' (SEQ ID NO:4). PCR fragments were digested with SfiI (NEB, Ipswich, MA, USA) and cloned into the modified mammalian expression vector pCEP4 (Invitrogen) encoding the hinge and CH2-CH3 domain of human IgG1 in the 3' region of the cloning site (gift of Dr. Chung, Seoul National University, Seoul, South Korea). Ligated products were transformed into competent Escherichia coli DH5α cells and plasmid DNA was prepared. HEK293F cells (6 × 108 cells) were transfected with 0.75 mg each DNA using 1.5 mg polyethylenimine (Polysciences, Inc., Warrington, PA, USA). The transfected cells were maintained in Freestyle™ 293 expression media supplemented with 1% (v/v) penicillin/streptomycin. After 7 days in culture, culture medium was collected and fusion proteins were purified by affinity chromatography on protein A Sepharose (RepliGen, Waltham, MA, USA). Protein concentration was quantified using a NanoDrop spectrophotometer (Wilmington, DE, USA). Samples were dialyzed against PBS and analyzed by SDS-PAGE and Coomassie brilliant blue staining. Aliquots of the final pooled fraction were stored at -80°C.
Example 3: Pre-clearing of human synthetic scFv library
A human synthetic scFv library was re-amplified (Barbas CF. Phage display : a laboratory manual. Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press; 2001). To pre-clear Fc binders, human immunoglobulin-G (Green Cross Pharma Derivatives Corp, Yong-in, Korea) was immobilized on protein A Sepharose and the antibody-protein A complexes were incubated with the library at 37°C for 2 hr. Following brief centrifugation, the supernatant was collected and the pellet was discarded. This procedure was repeated two times. The final supernatant was analyzed by phage ELISA to assess the extent of clearing.
Example 4: Selection of CTLD-specific scFvs using phage display
Three rounds of biopanning were carried out with immunotubes (Immuno™tube maxisorp, Nunc, Rochester, NY, USA) or magnetic beads (Dynabeads M-270 epoxy, Invitrogen) coated with 4 ㎍ recombinant human (hCTLD-Fc) or mouse (mCTLD-Fc) fusion protein to select clones with cross-species reactivity, as described previously (Barbas CF. Phage display : a laboratory manual. Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press; 2001; Vestweber D. Lymphocyte trafficking through blood and lymphatic vessels: more than just selectins, chemokines and integrins. European Journal of Immunology. 2003;33(5):1361-4). Ninety-six phage clones were randomly selected from colonies grown on output plates and tested for reactivity to human and mouse CTLDs by phage enzyme immunoassay. DNA of the final scFv clones was sequenced and classified as four scFv clones identified having different complementarity determining region sequences.
Example 5: Preparation of clec14a-CTLD IgG
The variable heavy chain (VH) gene of selected scFv clones (clones 1-4) was amplified using the primers 5'-CGGGAATTCGCCGCCACCATGGAATGGAGCTGGGTCTTTCTCTTCTTCCTGCTGTCAGTAACTACAGGTGTCCTCTCCGAGGTGCAGCTGTTGGAGTCTG-3' (SEQ ID NO: 5) and 5'-GGCGGGCCCTTGGTGGAGGCTGAGCTCACGGTGACCAGTGCCCTTGGCCCC-3'(SEQ ID NO: 6). The variable light chain (VL) gene of the clones was amplified using the primers 5'-CCCAAGCTTGCCGCCACCATGGAGACACATTCTCAGGTCTTTGTATACATGTTGCTGTGGTTGTCTGGTGTTGAAGGACCAGTCTGTGCTGACTCAGCC-3'(SEQ ID NO: 7) and 5'-GGCCGTA CGTAGGACCGTCAGCTTGGTGCCTCCGCCTAAGACATAACCACC-3' (SEQ ID NO: 8). VH primers were designed to add EcoRI and ApaI restriction sites to both the 5' and 3' ends. VL primers were designed to add HindIII and BsiWI sites to both ends. PCR fragments were digested with the appropriate restriction enzymes (NEB, Ipswich, MA, USA) and cloned into the bicistronic mammalian expression vector pCDNA3.1 (Invitrogen) encoding the hinge and CH2-CH3 domain of human IgG1 3' of the VH cloning site, (gift of Dr. Hong, Kangwon National University, Chuncheon, Kangwon, South Korea) (Sambrook J, Russell DW. Molecular cloning : a laboratory manual. 3rd ed. Cold Spring Harbor, N.Y.: Cold Spring Harbor Laboratory Press; 2001). Clec14a-CTLD IgG was produced and purified as described previously (Kim HY, Tsai S, Lo SC, Wear DJ, Izadjoo MJ. Production and characterization of chimeric monoclonal antibodies against Burkholderia pseudomallei and B. mallei using the DHFR expression system. PLoS ONE [Electronic Resource].6(5):e19867).
Example 6: Wound healing and cell migration assay
A CytoSelectTM 24-well wound healing assay kit (Cell Biolabs Inc, San Diego, CA, USA) was used according to the manufacturer's instructions. Briefly, COS-7 cells transfected with GFP, clec14a-GFP, or clec14aΔCTLD-GFP were added to each well by carefully inserting the pipette tip through the open end at the top of the wound healing insert. When cells had grown to confluence, inserts were removed from the wells, and cells were washed twice with phosphate-buffered saline (PBS). Images were captured 20 hr after wounding.
To analyze endothelial cell migration, HUVECs were cultured in the insert until monolayer formation and incubated in the absence or presence of 20 ㎍/ml clec14a-CTLD IgG or cetuximab for 9 hr at 37°C. Cells were washed twice with PBS and stained with crystal violet (Sigma, St. Louis, MO, USA). For quantitative analysis, five fields per plate were photographed under a light microscope (Nikon TS 100, Melville, NY, USA), and distance migrated was measured manually.
Example 7: Immunocytochemistry
Immunocytochemistry was performed as described previously (Lee S, et al., Hydrogen peroxide increases human leukocyte adhesion to porcine aortic endothelial cells via NFkappaB-dependent up-regulation of VCAM-1. Int Immunol. 2007 Dec;19(12):1349-5926). Briefly, COS-7 cells and HUVECs transfected with GFP, clec14a-GFP, or clec14aΔCTLD-GFP grown on collagen-coated coverslips for 1 day were fixed with 4% (w/v) paraformaldehyde for 30 min at 37°C. Cells were washed twice with PBS and blocked by incubation in PBS containing 5% (w/v) bovine serum albumin (BSA) and 0.1% TX-100 for 1 hr at 37°C. Cells were incubated with 0.1 unit/well rhodamine phalloidin and 2 ㎍/ml Hoechst for 1 hr and viewed under a fluorescence microscope (Leica DM2500, Wetzlar, Germany).
Example 8: ELISA
25 nM recombinant hCTLD-Fc, mCTLD-Fc, or Fc fragment of IgG1 in PBS was added to the 96-wells of a microtiter plate. After incubation overnight at 37°C, plates were washed three times with PBS containing 0.05% (v/v) Tween 20 (PBST), and incubated with 3% (w/v) BSA in PBST for 1 hr at 37°C. Plates were then incubated with 67 nM clec14a-CTLD IgG in PBST containing 3% (w/v) BSA for 3 hr at 37°C. Plates were washed twice with PBST and incubated with horseradish peroxide (HRP)-conjugated anti-human lambda light chain antibody (Bethyl Laboratories, Montgomery, TX, USA) diluted 1:1000) in PBST containing 3% (w/v) BSA, for 1 hr at 37°C.
To measure CTLD-CTLD interaction, lysates (20 ㎍) of COS-7 cells transfected with GFP, clec14a-GFP, or clec14aΔCTLD-GFP were added to wells of 96-well plates and incubated with 3% (w/v) BSA in PBST for 1 hr at 37°C, followed by addition of 0.15 ㎍ of hCTLD-Fc or Fc in the same buffer and incubated for 2 hr at 37°C. To assay competition with clec14a-CTLD IgG, hCTLD-Fc was pre-incubated with increasing concentrations of clec14a-CTLD IgG in PBST containing 3% (w/v) BSA for 2 hr at 37°C. The protein complexes were then added to wells and incubated for 2 hr at 37°C. Wells were washed three times in PBST, and HRP-conjugated donkey anti-human Fc IgG (1:5000; Jackson Immunoresearch Laboratories, Inc., West Grove, PA, USA) was added and incubated for 1 hr at 37°C. Wells were washed three times in PBST and 100μl TMB substrate solution (BD Biosciences, San Jose, CA, USA) were added to each well. Optical density was measured at 450 nm using a microtiter plate reader (VICTOR™ X4, Perkin Elmer, Waltham, MA, USA).
Example 9: Flow cytometry
HUVECs (3 × 105) grown in 6-well microtiter plates were incubated in the absence or presence of 20 ng/ml hTNFα (Millipore, Billerica, MA, USA) or 20 ㎍/ml clec14a-CTLD IgG or cetuximab for 24 hr. Cells were harvested and stained with 20㎍/ml anti-VCAM-1 or ICAM-1 polyclonal antibody in flow cytometry buffer for 1 hr at 37°C. Cells were washed three times with flow cytometry buffer, centrifuged at 1000 × g for 10 min, and incubated for 1 hr at 37°C with Alexa Fluor 488-labeled antirabbit antibody (1:1000; Jackson ImmunoResearch) in flow cytometry buffer.
HUVECs (3 × 105) grown in 6-well microtiter plates were fixed with 4% (w/v) paraformaldehyde. Fixed and unfixed cells were washed twice with PBS and incubated in the absence or presence of 20 ㎍/ml clec14a-CTLD IgG for 2 hr at 37°C. Cells were stained with 7.5 ㎍/ml sheep anti-clec14a polyclonal antibody for 2 hr at 37°C. Cells were washed three times with flow cytometry buffer, incubated with Northern Lights™ 493 Fluorochrome (NL493)-labeled anti-sheep antibody (1:200; R&D Systems, Minneapolis, MN, USA) in flow cytometry buffer, and analyzed by flow cytometry (BD FACSCalibur, BD Bioscience, Miami, FL, USA).
Example 10: Tube formation
Tube formation assays were performed as described previously (Rho SS, et al., Clec14a is specifically expressed in endothelial cells and mediates cell to cell adhesion. Biochemical & Biophysical Research Communications.404(1):103-8). Briefly, 250 ㎕ Matrigel (BD Biosciences, Bedford, MA) was added to wells of a 24-well plate and allowed to polymerize for 20 min at 37°C. HUVECs cultured in EGM-2 were harvested, resuspended in EGM-2, and seeded onto the Matrigel (1 × 105 cells/well). Cultures were incubated in the absence or presence of clec14a-CTLD IgGs or cetuximab at 37°C and photographed at 21 hr. Tubes were counted manually.
Example 11: HUVEC cell viability assay
HUVECs (104) were seeded in 96-well microtiter plates and incubated with 20 ㎍/ml clec14a-CTLD IgGs, cetuximab, or 5-FU (Sigma) for 2 days at 37°C. Cell viability was measured using Cell Counting Kit-8 (Dojindo, Kumamoto, Japan) according to the manufacturer's instructions. Absorbance was measured at 450 nm with a VICTOR™ X4 spectrophotometer (Perkin Elmer).
Example 12: Measurement of cell-cell contact
Cell-cell contact assays were performed as described previously (Rho SS, et al., Clec14a is specifically expressed in endothelial cells and mediates cell to cell adhesion. Biochemical & Biophysical Research Communications.404(1):103-8). Briefly, 1.5 × 107 HEK293F cells in suspension were transfected with plasmids expressing GFP, Clec14a-GFP, and Clec14aΔCTLD-GFP, cultured in Freestyle™ 293 expression medium overnight, and seeded in 6-well plates (5 × 105 cells/well). Cells were maintained in the absence or presence of 20 ㎍/ml clec14a-CTLD IgG or cetuximab for 8 hr. Cell aggregates (mass >4 cells) were counted in at least 10 fields and mean ± standard deviation (SD) were determined.
Example 13: Immunoblot analysis
Immunoblot analysis were performed as described previously (Van Meter KE, et al., A monoclonal antibody that inhibits translation in Sf21 cell lysates is specific for glyceraldehyde-3-phosphate dehydrogenase. Archives of Insect Biochemistry & Physiology. 2008;69(3):107-17). Briefly, lysates (20 ㎍) of COS-7 cells transfected with GFP-, clec14a-GFP-, or clec14aΔCTLD-GFP were separated by electrophoresis in a 12% polyacrylamide gel. Proteins were transferred to nitrocellulose membranes using a wet transfer system (GE Healthcare Life Sciences, Pittsburgh, PA, USA). Membranes incubated in 10 mM Tris/HCl, pH 7.5, 150 mM NaCl, and 0.05 (v/v)% Tween 20 (TTBS), containing 5% (w/v) skim milk at room temperature for 1 hr, followed by incubation with anti-GFP monoclonal antibody (1:5000; Santa Cruz Biotechnology, Santa Cruz, CA, USA) or anti-β-actin monoclonal antibody (1:5000; Applied Biological Materials, Richmond, BC, Canada) in the same solution overnight at 4°C. The membrane was washed with TTBS and incubated with HRP-conjugated Affinipure goat anti-mouse IgG (1:5000; Jackson ImmunoResearch, West Grove, PA, USA) in TTBS containing 5% (w/v) skim milk at room temperature for 1 hr. Following several washes with TTBS, protein bands were visualized using SuperSignal West Pico Chemiluminescent Substrate (Pierce, Rockford, IL, USA)according to the manufacturer's instructions.
Example 14: Cell ELISA
HUVECs (104) plated on 96-well plates were incubated with 20 ㎍/ml clec14a-CTLD IgG or Fc for 0, 10, 30, 60, 120, or 180 min at 37°C. Cells were washed twice with ice-cold PBS, blocked in 3% (w/v) BSA in PBS for 1 hr at 4°C, and incubated with sheep anti-clec14a polyclonal antibody (1:1000) in the blocking solution for 2 hr at 4°C. Cells were washed three times with ice-cold PBS and incubated with HRP-conjugated anti-sheep IgG (1:5000; Santa Cruz Biotechnology) for 1 hr at 4°C. After several washes with PBS, 100 μl TMB substrate solution was added to each well. Optical density was measured at 450 nm using a microtiter plate reader.
Example 15: ELISA for epitope mapping
Each of 10㎍/ml hCTLD-Fc, Fc, or N-terminal or C-terminal fragments of hCTLD-Fc in PBS was added to 96-well plates. Plates were incubated overnight at 37°C, washed three times with PBS containing 0.05% (v/v) Tween 20 (PBST), and incubated with 3% (w/v) BSA in PBST for 1 hr at 37°C. Plates were incubated with 10 μg/ml clec14a-CTLD IgG in PBST containing 3% (w/v) BSA for 2 hr at 37°C. Following two times washings with PBST, horseradish peroxide (HRP)-conjugated anti-human lambda light chain antibody (1:1000; Bethyl Laboratories, TX, USA) in PBST containing 3% (w/v) BSA was incubated for 1 hr at 37°C.
Example 16: Tube formation assay in the absense or presense of hCTLD-Fc
250μl of Matrigel (BD Biosciences) was added to 24-well plates and allowed to polymerize for 20 min at 37°C. HUVECs cultured in EGM-2 were harvested, resuspended in EGM-2, and seeded onto the Matrigel (1×105 cells/well). Cultures were incubated in the absence or presence of 10 and 25 μg/ml hCTLD Fc or Fc at 37°C and photographed at 8 hr.
Experimental Example 1: Clec14a CTLD may play a key role in cell migration and filopodium formation
To elucidate the role of CTLD in clec14a-mediated cell migration, COS-7 cells were transfected with green fluorescent protein (GFP), wild-type clec14a fused to GFP (clec14a-GFP), or a clec14a CTLD deletion mutant fused to GFP (clec14aΔCTLD-GFP), and assayed migration in a wound healing assay at 0 and 20 hr. The extent of migration of cells expressing wild-type clec14a was approximately 1.6-fold greater than that of cells expressing GFP alone, whereas expression of the clec14aΔCTLD deletion mutant had little effect on migration (Fig. 1a and 1b).
Because cell migration is specifically regulated by actin cytoskeletal rearrangement, immunocytochemistry was used to investigate actin network organization in COS-7 cells and human umbilical vein endothelial cells (HUVECs) expressing GFP, clec14a-GFP, or clec14aΔCTLD-GFP. In both cell types, clec14a-GFP overexpression dramatically increased filopodium formation, whereas GFP or clec14aΔCTLD-GFP had minimal effect (Fig. 2a and 2b).
Together, these results suggest that CTLD may play a crucial role in endothelial cell migration by regulating actin cytoskeletal rearrangements.
Experimental Example 2: Isolation of CTLD-specific single-chain variable fragments (scFvs)
Because CTLD of human, mouse or chimpanzee clec14a (Table 1) were Fc fusion proteins, two sequential pre-clearing steps were performed for removing Fc binders from a human synthetic scFv library; removal of approximately 90% was confirmed by phage enzyme-linked immunosorbent assay.
Table 1
Amino acid sequences of clec14a-CTLDs
Human clec14a-lectin (a.a 31-172) CSASGACYSLHHATMKRQAAEEACILRGGALSTVRAGAELRAVLALLRAGPGPGGGSKDLLFWVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTARRCAVLQATGGVEPAGWKEMRCHLRANGYLCK SEQ IDNO:9
Mouse clec14a-lectin (a.a 31-172) CSASGACYSLHHATFKRRAAEEACSLRGGTLSTVHSGSEFQAVLLLLRAGPGPGGGSKDLLFWVALERSISQCTQEKEPLRGFSWLHPDSEDSEDSPLPWVEEPQRSCTVRKCAALQATRGVEPAGWKEMRCHLRTDGYLCK SEQ IDNO:10
Chimpanzee clec14a-lectin (a.a 31-172) CSASGACYSLHHATMKRQAAEEACILRGGALSTVRAGAELRAVLALLRAGPGPGGGSKDLLFWVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTARRCAVLQATGGVEPAGWKEMRCHLRANGYLCK SEQ ID NO: 133
Nucleotide sequences of clec14a-CTLDs
Human clec14a-lectin (nt 91-516) tgctcggcctcgggggcctgctacagcctgcaccacgctaccatgaagcggcaggcggccgaggaggcctgcatcctgcgaggtggggcgctcagcaccgtgcgtgcgggcgccgagctgcgcgctgtgctcgcgctcctgcgggcaggcccagggcccggagggggctccaaagacctgctgttctgggtcgcactggagcgcaggcgttcccactgcaccctggagaacgagcctttgcggggtttctcctggctgtcctccgaccccggcggtctcgaaagcgacacgctgcagtgggtggaggagccccaacgctcctgcaccgcgcggagatgcgcggtactccaggccaccggtggggtcgagcccgcaggctggaaggagatgcgatgccacctgcgcgccaacggctacctgtgcaag SEQ IDNO:11
Mouse clec14a-lectin (nt 91-516) tgttcggcctcgggggcttgctacagccttcaccacgctaccttcaagagaagggcggcggaggaggcctgcagcctaaggggcgggactctcagcaccgtgcactcaggctcggagtttcaagctgtgctcctgctcttgcgtgcaggtcccgggcctggcggaggctccaaagatcttctgttctgggtggctctggaacgcagcatctcacagtgcactcaggagaaagagcctttaaggggtttctcctggttgcacccggactcagaagactcagaggacagcccactaccgtgggtggaagagccacaacgttcctgtacagtgagaaagtgcgctgcgctccaggccaccaggggagtggagcctgctggttggaaggagatgcgctgtcatctgcgcaccgatggctacctatgcaag SEQ IDNO:12
Chimpanzee clec14a-lectin (nt 91-516) tgctcggcctcgggggcctgctacagcctgcaccacgctaccatgaagcggcaggcggccgaggaggcctgcatcctgcgaggtggggcgctcagcaccgtgcgtgcgggcgccgagctgcgcgctgtgctcgcgctcctgcgggcaggcccagggcccggagggggctccaaagacctgctgttctgggtcgcactggagcgcaggcgttcccactgcaccctggagaacgagcctttgcggggtttctcctggctgtcctccgaccccggcggtctcgaaagcgacacgctgcagtgggtggaggagccccaacgctcctgcaccgcgcggagatgcgcggtactccaggccaccggtggggtcgagcccgcaggctggaaggagatgcgatgccacctgcgcgccaacggctacctgtgcaag SEQ ID NO: 134
Amino acid residues on the amino acid sequences used in the present invention are expressed by abbreviations according to the IUPAC-IUB nomenclature.
Alanine: A Arginine: R
Asparagine: N Aspartic acid: D
Cysteine: C Glutamic acid: E
Glutamine: Q Glycine: G
Histidine: H Isoleucine: I
Leucine: L Lysine: K
Methionine: M Phenylalanine: F
Proline: P Serine: S
Threonine: T Tryptophane: W
Tyrosine: Y Valine: V
The library was then alternately biopanned with human (hCTLD-Fc) or mouse (mCTLD-Fc) CTLD fusion proteins, using CTLD-Fc-coated immunotubes and magnetic beads, to isolate clones having cross-species CTLD reactivity (Figure. 3a); several such clones were identified only with beads (Figure. 3b-3d). Ninety-six phage clones were randomly selected, rescued by phage enzyme immunoassay. Clone DNA was sequenced and four clones (clones 1- 4), recognizing both human and mouse CTLDs and having different complementarity determining region sequences, were selected (Tables 2 to 9). Meanwhile, four clones can specifically recognize chimpanzee CTLD, having cross-reactivity because amino acid sequence of chimpanzee clec14a-lectin is the same as that of the human clec14a-lectin.
Table 2
Amino acid sequences of VH domains of clec14a-CTLD IgGs
Clone
1 FR1 EVQLLESGGGLVQPGGSLRLSCAAS SEQ ID NO:13
CDR1 GFTFSGYDMS SEQ ID NO:14
FR2 WVRQAPGKGLEWVS SEQ ID NO:15
CDR2 GIYPDGGNTYYADSVKG SEQ ID NO:16
FR3 RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR SEQ ID NO:17
CDR3 GATWWVLGPFDY SEQ ID NO:18
FR4 WGQGTLVTVSS SEQ ID NO:19
Table 3
Amino acid sequences of VH domains of clec14a-CTLD IgGs
Clone
2 FR1 EVQLLESGGGLVQPGGSLRLSCAAS SEQ ID NO:20
CDR1 GFTFSSYDMS SEQ ID NO:21
FR2 WVRQAPGKGLEWVS SEQ ID NO:22
CDR2 VISPDSSSTYYADSVKG SEQ ID NO:23
FR3 RFTISRDNSKNTLHLQMNSLRAEDTAVYYCAR SEQ ID NO:24
CDR3 HTGWQSRPHTYYDYGMDV SEQ ID NO:25
FR4 WGQGTLVTVSS SEQ ID NO:26
Table 4
Amino acid sequences of VH domains of clec14a-CTLD IgGs
Clone
3 FR1 EVQLLESGGGLVQPGGSLRLSCAAS SEQ ID NO:27
CDR1 GFTFSDYYMS SEQ ID NO:28
FR2 WVRQAPGKGLEWVS SEQ ID NO:29
CDR2 LISYDGGSTYYADSVKG SEQ ID NO:30
FR3 RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR SEQ ID NO:31
CDR3 SNDWFDY SEQ ID NO:32
FR4 WGQGTLVTVSS SEQ ID NO:33
Table 5
Amino acid sequences of VH domains of clec14a-CTLD IgGs
Clone
4 FR1 EVQLLESGGGLVQPGGSLRLSCAAS SEQ ID NO:34
CDR1 GFTFSGYYMS SEQ ID NO:35
FR2 WVRQAPGKGLEWVS SEQ ID NO:36
CDR2 VIYSGDGSTYYADSVKG SEQ ID NO:37
FR3 RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR SEQ ID NO:38
CDR3 GLNSSSALPFDY SEQ ID NO:39
FR4 WGQGTLVTVSS SEQ ID NO:40
Table 6
Amino acid sequences of VL domains of clec14a-CTLD IgGs
Clone
1 FR1 QSVLTQPPSASGTPGQRVTISC SEQ ID NO:41
CDR1 TGSSSNIGNNSVT SEQ ID NO:42
FR2 WYQQLPGTAPKLLIY SEQ ID NO:43
CDR2 ADSHRPS SEQ ID NO:44
FR3 GVPDRFSGSKSGTSASLAISGLRSEDEADYYC SEQ ID NO:45
CDR3 GAWDDSLSGYV SEQ ID NO:46
FR4 FGGGTKLTVL SEQ ID NO:47
Table 7
Amino acid sequences of VL domains of clec14a-CTLD IgGs
Clone
2 FR1 QSVLTQPPSASGTPGQRVTISC SEQ ID NO:48
CDR1 SGSSSNIGNNAVT SEQ ID NO:49
FR2 WYQQLPGTAPKLLIY SEQ ID NO:50
CDR2 SDNHRPS SEQ ID NO:51
FR3 GVPDRFSGSKSGTSASLAISGLRSEDEADYYC SEQ ID NO:52
CDR3 GTWDASLSGYV SEQ ID NO:53
FR4 FGGGTKLTVL SEQ ID NO:54
Table 8
Amino acid sequences of VL domains of clec14a-CTLD IgGs
Clone
3 FR1 QSVLTQPPSASGTPGQRVTISC SEQ ID NO:55
CDR1 SGSSSNIGSNNVY SEQ ID NO:56
FR2 WYQQLPGTAPKLLIY SEQ ID NO:57
CDR2 YDSQRPS SEQ ID NO:58
FR3 GVPDRFSGSKSGTSASLAISGLRSEDEADYYC SEQ ID NO:59
CDR3 GAWDDSLSAYV SEQ ID NO:60
FR4 FGGGTKLTVL SEQ ID NO:61
Table 9
Amino acid sequences of VL domains of clec14a-CTLD IgGs
Clone
4 FR1 QSVLTQPPSASGTPGQRVTISC SEQ ID NO:62
CDR1 SGSSSNIGSNAVN SEQ ID NO:63
FR2 WYQQLPGTAPKLLIY SEQ ID NO:64
CDR2 ADSNRPS SEQ ID NO:65
FR3 GVPDRFSGSKSGTSASLAISGLRSEDEADYYC SEQ ID NO:66
CDR3 GSWDYSLSAYV SEQ ID NO:67
FR4 FGGGTKLTVL SEQ ID NO:68
Also, the nucleic acid sequences of clones 1-4 is the same as the following tables 10 to 17.
Table 10
Nuleotide sequences of VH domains of clec14a-CTLD IgGs
Clone
1 FR1 gaggtgcagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctct SEQ ID NO:69
CDR1 ggattcacctttagcggttatgatatgagc SEQ ID NO:70
FR2 tgggtccgccaggctccagggaaggggctggagtgggtctca SEQ ID NO:71
CDR2 gggatctatcctgatggtggtaatacatattacgctgattctgtaaaaggt SEQ ID NO:72
FR3 cggttcaccatctccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcgaga SEQ ID NO:73
CDR3 ggtgctacgtggtgggtgcttggtcctttcgactac SEQ ID NO:74
FR4 tggggccagggtacactggtcaccgtgagctca SEQ ID NO:75
Table 11
Nucleotide sequences of VL domains of clec14a-CTLD IgGs
Clone
1 FR1 cagtctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgt SEQ ID NO:76
CDR1 actggctcttcatctaatattggcaataattctgtcacc SEQ ID NO:77
FR2 tggtaccagcagctcccaggaacggcccccaaactcctcatctat SEQ ID NO:78
CDR2 gctgatagtcatcggccaagc SEQ ID NO:79
FR3 ggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtgggctccggtccgaggatgaggctgattattactgt SEQ ID NO:80
CDR3 ggtgcttgggatgatagcctgagtggttatgtc SEQ ID NO:81
FR4 ttcggcggaggcaccaagctgacggtccta SEQ ID NO:82
Table 12
Nucleotide sequences of VH domains of clec14a-CTLD IgGs
Clone
2 FR1 gaggtgcagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctct SEQ ID NO:83
CDR1 ggattcacctttagcagttatgatatgagc SEQ ID NO:84
FR2 tgggtccgccaggctccagggaaggggctggagtgggtctca SEQ ID NO:85
CDR2 gtgatctctcctgatagtagtagtacatattacgctgattctgtaaaaggt SEQ ID NO:86
FR3 cggttcaccatctccagagacaattccaagaacacgctgcatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcgaga SEQ ID NO:87
CDR3 catactggttggcagagtcggcctcatacgtattatgattatggtatggacgtc SEQ ID NO:88
FR4 tggggccagggtacactggtcaccgtgagctca SEQ ID NO:89
Table 13
Nucleotide sequences of VL domains of clec14a-CTLD IgGs
Clone
2 FR1 cagtctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgt SEQ ID NO:90
CDR1 agtggctcttcatctaatattggcaataatgctgtcacc SEQ ID NO:91
FR2 tggtaccagcagctcccaggaacggcccccaaactcctcatctat SEQ ID NO:92
CDR2 tctgataatcatcggccaagc SEQ ID NO:93
FR3 ggggtccctgaccgattctctggctccaagtctggcacctcagcctcnctggccatcagtgggctccggtccgaggatgaggctgattattactgt SEQ ID NO:94
CDR3 ggtacttgggatgctagcctgagtggttatgtc SEQ ID NO:95
FR4 ttcggcggaggcaccaagctgacggtccta SEQ ID NO:96
Table 14
Nucleotide sequences of VH domains of clec14a-CTLD IgGs
Clone
3 FR1 gaggtgcagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctct SEQ ID NO:97
CDR1 ggattcacctttagcgattattatatgagc SEQ ID NO:98
FR2 tgggtccgccaggctccagggaaggggctggagtgggtctca SEQ ID NO:99
CDR2 ttgatctcttatgatggtggtagtacatattacgctgattctgtaaaaggt SEQ ID NO:100
FR3 cggttcaccatctccagagacaattccaagaacacgctgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcgaga SEQ ID NO:101
CDR3 agtaatgattggttcgactac SEQ ID NO:102
FR4 tggggccagggtacactggtcaccgtgagctca SEQ ID NO:103
Table 15
Nucleotide sequences of VL domains of clec14a-CTLD IgGs
Clone
3 FR1 cagtctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgt SEQ ID NO:104
CDR1 agtggctcttcatctaatattggcagtaataatgtctac SEQ ID NO:105
FR2 tggtaccagcagctcccaggaacggctcccaaactcctcatctat SEQ ID NO:106
CDR2 tatgatagtcagcggccaagc SEQ ID NO:107
FR3 ggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtgggctccggtccgaggatgaggctgattattactgt SEQ ID NO:108
CDR3 ggtgcttgggatgatagcctgagtgcttatgtc SEQ ID NO:109
FR4 ttcggcggaggcaccaagctgacggtccta SEQ ID NO:110
Table 16
Nucleotide sequences of VH domains of clec14a-CTLD IgGs
Clone
4 FR1 gaggtgcagctgttggagtctgggggaggcttggtacagcctggggggtccctgagactctcctgtgcagcctct SEQ ID NO:111
CDR1 ggattcacctttagcggttattatatgagc SEQ ID NO:112
FR2 tgggtccgccaggctccagggaaggggctggagtgggtctca SEQ ID NO:113
CDR2 gtgatctattctggtgatggtagtacatattacgctgattctgtaaaaggt SEQ ID NO:114
FR3 cggttcaccatctccagagacaactccaagaacacgctgtatctgcaaatgaacagcctgagagccgaggacacggccgtgtattactgtgcgaga SEQ ID NO:115
CDR3 ggtcttaattcgtcttcggctctgccgttcgactac SEQ ID NO:116
FR4 tggggccagggtacactggtcaccgtgagctca SEQ ID NO:117
Table 17
Nucleotide sequences of VL domains of clec14a-CTLD IgGs
Clone
4 FR1 cagtctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgt SEQ ID NO:118
CDR1 agtggctcttcatctaatattggcagtaatgctgtcaac SEQ ID NO:119
FR2 tggtaccagcagctcccaggaacggcccccaaactcctcatctat SEQ ID NO:120
CDR2 gctgatagtaatcggccaagc SEQ ID NO:121
FR3 ggggtccctgaccgattctctggctccaagtctggcacctcagcctccctggccatcagtgggctccggtccgaggatgaggctgattattactgt SEQ ID NO:122
CDR3 ggttcttgggattatagcctgagtggttatgtc SEQ ID NO:123
FR4 ttcggcggaggtaccaagctgacggtccta SEQ ID NO:124
Experimental Example 3: Clec14a-CTLD IgGs specifically recognized human and mouse clec14a-CTLDs
The scFv clones were converted to IgG, expressed in human embryonic kidney 293F (HEK293F) cells, and purified. The four IgG clones was shown to be greater than 90% pure by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and Coomassie staining. ELISA showed that the purified CTLD-specific IgGs (clec14a-CTLD IgGs) specifically bound both human and mouse CTLD-Fc, and not Fc alone. Clones 1 and 2 showed much greater affinity than clones 3 and 4 (Fig. 4).
Experimental Example 4: Clec14a-CTLD IgGs specifically suppressed endothelial cell migration and tube formation
To investigate the inhibitory effect of clec14a-CTLD IgGs on endothelial cell migration, wound healing assays with HUVECs were performed in the absence or presence of clec14a-CTLD IgGs. Cetuximab, an anti-EGFR antibody, was used as control IgG. Of the selected clec14a-CTLD IgGs, clones 1 and 2 significantly suppressed HUVEC cell migration to approximately 44% and 54%, respectively, whereas clones 3 and 4 and cetuximab alone had little effect. (Fig. 5a and 5b).
To determine the effect of clec14a-CTLD IgGs on tube formation, tube formation was assayed in the absence or presence of the clec14a-CTLD IgGs and cetuximab. Clones 1 and 2, and cetuximab as previously reported specifically blocked HUVEC tube formation, whereas the other clones did not have a significant effect (Fig. 5c and 5d).
These results strongly suggest that clec14a-CTLD IgGs specifically inhibits tumor angiogenesis.
Experimental Example 5: Effect of Clec14a-CTLD IgGs on endothelial cell viability and activation
To investigate the effect of clec14a-CTLD IgGs on endothelial cell viability, HUVECs were cultured in the absence or presence of clec14a-CTLD IgGs, cetuximab, or 5-fluorouracil (5-FU), an apoptosis inducer, for 2 days, and cell viability was checked using a cell counting kit. The antibodies had little effect on HUVEC viability, whereas 5-FU specifically decreased viability (Fig. 6a).
To determine the effect of clec14a-CTLD IgGs on endothelial cell activation, HUVECs were cultured in the absence or presence of clec14a-CTLD IgGs, cetuximab, or human tumor necrosis factor alpha (hTNFα). Activation was determined based on the expression of vascular cell adhesion molecule-1 (VCAM-1) and intercellular cell adhesion molecule-1 (ICAM-1) measured by flow cytometry. Cells were treated with hTNFα, which induces up-regulation of VCAM-1 and ICAM-1, as a positive control. The antibodies and cetuximab had no effect on HUVEC activation (Fig. 6b).
Taken together, these results suggest that clec14a-CTLD IgGs have little effect on endothelial cell viability or activation.
Experimental Example 6: Clec14a-CTLD IgGs specifically inhibited clec14a-mediated cell-cell contact
To elucidate the role of clec14a-CTLD IgGs in endothelial cell-cell contact, the number of cell aggregates, an indicator of clec14a-mediated cell-cell contacts, formed by HEK293F cells transfected with GFP or clec14a-GFP and grown in the absence or presence of clec14a-CTLD IgGs or cetuximab was determined. The number of cell aggregates was approximately 4-fold greater in cells expressing clec14a-GFP than in those expressing GFP alone (Fig. 7a and 7b). Furthermore, clones 1 and 2 significantly suppressed the aggregation of cells transfected with clec14a-GFP, whereas the other clones and cetuximab had little effect.
Taken together, these results suggest that clec14a-CTLD IgGs may play an inhibitory role in clec14a-mediated endothelial cell-cell contact during tumor angiogenesis.
Experimental Example 7: Clec14a-CTLD IgG specifically blocked clec14a CTLD-CTLD interactions
Immunoanalysis was used to confirm the expression of GFP, clec14a-GFP, and clec14aΔCTLD-GFP in lysates of transfected COS-7 cells (Fig. 8a). Lysates were then incubated with hCTLD-Fc or Fc to observe interactions between CTLDs. Although hCTLD-Fc may interact with some other proteins in COS-7 cell lysates, it bound strongly to clec14a-GFP but not to clec14aΔCTLD-GFP, suggesting a specific CTLDCTLD interaction in endothelial cells (Fig. 8b).
To determine if clec14a-CTLD IgG blocks CTLD-CTLD interactions, hCTLD-Fc was incubated with increasing concentrations of clec14a-CTLD IgG (clone 1) and the protein complexes were incubated with lysates of GFP- or clec14a-GFP-transfected cells. Competitive ELISA showed that clec14a-CTLD IgG specifically inhibited CTLD-CTLD interactions in a concentration-dependent manner (Fig. 8c), suggesting that clec14a-CTLD IgG may specifically block clec14a CTLD-CTLD interactions in endothelial cells.
Experimental Example 8: Cross-linking with clec14a-CTLD IgG downregulated clec14a on the surface of HUVECs
To investigate a possible role of clec14a-CTLD IgG in suppressing pro-angiogenenic phenotypes, flow cytometry was used to compare the level of clec14a expression on HUVEC membranes before and after treatment with clec14a-CTLD IgG (clone 1). IgG treatment significantly reduced clec14a on live, but not paraformaldehyde-fixed, cells (Fig. 9a).
To confirm down-regulation of clec14a on HUVEC membranes by clec14a-CTLD IgG, cells were treated with IgG (clone 1) or Fc, and membrane clec14a was measured by cell ELISA. Clec14a-CTLD IgG down-regulated clec14a on HUVEC membranes in a time-dependent manner (Fig. 9b).
These results strongly suggest that clec14a-CTLD IgG cross-linking of clec14a specifically down-regulates clec14a on endothelial cell membranes. Additionally, these results suggest that clec14a-CTLD IgG is capable of being internalized into a cell expressing clec14a such as a cancer cell.
Experimental Example 9: Fine mapping of epitope
For fine mapping of epitope, specificity of clec14a-CTLD IgGs to Clec14awtCTLD and the fragments of hCTLD-Fc (Fig. 10a) were tested by ELISA.
As a result, as can be seen Fig. 10b, clec14a-CTLD IgGs of both clone1 and clone 2 specifically bound the N-terminal and C-terminal of hCTLD as well as wthCTLD.
These results strongly suggest that the N-terminal or C-terminal region of CTLD such as clec14a-CTLD IgGs of both clone1 and clone 2 specifically bound a fusion protein comprising an amino acid fragment from 1st amino acid to 42nd amino acid in hCTLD, a fusion protein comprising an amino acid fragment from 1st amino acid to 62nd amino acid in hCTLD, a fusion protein comprising an amino acid fragment from 82nd amino acid to 142nd amino acid in hCTLD, a fusion protein comprising an amino acid fragment from 62nd amino acid to 142nd amino acid in hCTLD and a fusion protein comprising an amino acid fragment from 122nd amino acid to 142nd amino acid in hCTLD can be used as an epitope.
Experimental Example 10: Test for examining if CTLD-Fc inhibits Tube formation
To investigate the inhibitory effect of hCTLD-Fc on angiogenesis, tube formation was assayed in the presence hCTLD-Fc or Fc according to example 16.
As a result, as can be seen Fig. 11, hCTLD-Fc inhibited tube formation in a concentration-dependent manner.
These results strongly suggest that hCTLD-Fc specifically inhibits tumor angiogenesis.
Based on the novel finding that the CTLD of clec14a plays an important role in cell migration and filopodium formation, the present invention identified the function of a novel antibody against CTLD in suppressing angiogenesis. Accordingly, the present invention provides a novel target domain which will be available for suppressing angiogenesis. Further, the antibody of the present invention can be effective for preventing or treating angiogenesis-related diseases or clec14a-mediated cancer.
Although the present invention has been described in detail with reference to the specific features, it will be apparent to those skilled in the art that this description is only for a preferred embodiment and does not limit the scope of the present invention. Thus, the substantial scope of the present invention will be defined by the appended claims and equivalents thereof.
Attach electronic file.

Claims (55)

  1. An antibody, binding specifically to clec14a (C-type lectin domain family 14, member A).
  2. The antibody of claim 1, wherein the antibody binds specifically to CTLD (C-type lectin like domain) of clec14a.
  3. The antibody of claim 1, wherein the antibody binds specifically to N-terminal or C-terminal of CTLD of clec14a.
  4. The antibody of claim 1, wherein the antibody binds specifically to a region comprising an amino acid fragment from 1st amino acid to 42nd amino acid in CTLD of clec14a or an amino acid fragment from 122nd amino acid to 142nd amino acid in CTLD of clec14a.
  5. The antibody of claim 2, wherein the antibody binds specifically human, chimpanzee and murine CTLD of clec14a, having cross-reactivity.
  6. The antibody of claim 1, being suppressive of angiogenesis.
  7. The antibody of claim 2, wherein the CTLD is a polypeptide stretching from amino acids 31st to amino acids 172nd on an amino acid sequence of clec14a.
  8. The antibody of claim 2, comprising a heavy-chain variable region comprising heavy-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 14, heavy-chain CDR2 defined by an amino acid sequence of SEQ ID NO: 16, and heavy-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 18, and a light-chain variable region comprising light-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 42, light -chain CDR2 defined by an amino acid sequence of SEQ ID NO: 44, and light-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 46.
  9. The antibody of claim 2, comprising a heavy-chain variable region comprising heavy-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 21, heavy-chain CDR2 defined by an amino acid sequence of SEQ ID NO: 23, and heavy-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 25, and a light-chain variable region comprising light-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 49, light-chain CDR2 defined by an amino acid sequence of SEQ ID NO: 51, and light-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 53.
  10. The antibody of claim 2, comprising a heavy-chain variable region comprising heavy-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 28, heavy-chain CDR2 defined by an amino acid sequence of SEQ ID NO: 30, and heavy-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 32, and a light-chain variable region comprising light-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 56, light-chain CDR2 defined by an amino acid sequence of SEQ ID NO: 58, and light-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 60.
  11. The antibody of claim 2, comprising a heavy-chain variable region comprising heavy-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 35, heavy-chain CDR2 defined by an amino acid sequence of SEQ ID NO: 37, and heavy-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 39, and a light-chain variable region comprising light-chain CDR1 defined by an amino acid sequence of SEQ ID NO: 63, light-chain CDR2 defined by an amino acid sequence of SEQ ID NO: 65, and light-chain CDR3 defined by an amino acid sequence of SEQ ID NO: 67.
  12. The antibody of claim 2, wherein the antibody is selected from the group consisting of an antibody comprising a heavy-chain variable region having an amino acid sequence of SEQ ID NO: 125 and a light-chain variable region having an amino acid sequence of SEQ ID NO: 129; an antibody comprising a heavy-chain variable region having an amino acid sequence of SEQ ID NO: 126 and a light-chain variable region having an amino acid sequence of SEQ ID NO: 130; an antibody comprising a heavy-chain variable region having an amino acid sequence of SEQ ID NO: 127 and a light-chain variable region having an amino acid sequence of SEQ ID NO: 131; and an antibody comprising a heavy-chain variable region having an amino acid sequence of SEQ ID NO: 128 and a light-chain variable region having an amino acid sequence of SEQ ID NO: 132.
  13. The antibody of claim 1, functioning to inhibit cell migration.
  14. The antibody of claim 1, functioning to inhibit tube formation.
  15. The antibody of claim 1, functioning to inhibit cell to cell contact.
  16. The antibody of claim 1, functioning to inhibit clec14a CTLD-CTLD complex formation.
  17. The antibody of claim 1, functioning to induce down-regulation of clec14a on the surface of vascular endothelial cells.
  18. An nucleic acid encoding the antibody of any one of claims 1 to 17.
  19. The nucleic acid of claim 18, the nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 70, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 72, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 74, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 77, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 79, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 81.
  20. The nucleic acid of claim 18, the nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 84, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 86, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 88, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 91, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 93, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 95.
  21. The nucleic acid of claim 18, the nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 98, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 100, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 102, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 105, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 107, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 109.
  22. The nucleic acid of claim 18, the nucleic acid encoding the antibody comprises a heavy-chain nucleic acid sequence comprising heavy-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 112, heavy-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 114, and heavy-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 116, and a light-chain nucleic acid sequence comprising light-chain CDR1 nucleotide sequence set forth in SEQ ID NO: 119, light-chain CDR2 nucleotide sequence set forth in SEQ ID NO: 121, and light-chain CDR3 nucleotide sequence set forth in SEQ ID NO: 123.
  23. The nucleic acid of claim 18, the nucleic acid encoding the antibody is selected from a nucleic acid comprising the nucleotide sequence of SEQ ID NO: 133 for the heavy-chain variable region and the nucleotide sequence of SEQ ID NO: 134 for the light-chain variable region; a nucleic acid comprising the nucleotide sequence of SEQ ID NO: 135 for the heavy-chain variable region and the nucleotide sequence of SEQ ID NO: 136 for the light-chain variable region; a nucleic acid comprising the nucleotide sequence of SEQ ID NO: 137 for the heavy-chain variable region and the nucleotide sequence of SEQ ID NO: 138 for the light-chain variable region and a nucleic acid comprising the nucleotide sequence of SEQ ID NO: 139 for the heavy-chain variable region and the nucleotide sequence of SEQ ID NO: 140 for the light-chain variable region.
  24. A vector comprising the nucleic acid of any one of claims 18 to 23.
  25. A host cell comprising the vector of claim 20 or the nucleic acid of any one of claims 18 to 23.
  26. A method of producing the antibody of any one of claims 1 to 17, comprising culturing a host cell of claim 21 such that the nucleic acid is expressed to produce the antibody.
  27. An antibody-drug conjugate comprising the antibody of any one of claims 1 to 17 attached to a drug.
  28. The antibody-drug conjugate of claim 27, wherein the drug is any one selected from the group consisting of a toxin, a chemotherapeutic agent, an anticancer drug, an antibiotic, ADP-ribosyl transferase, a radioactive isotope and a nucleolytic enzyme.
  29. The antibody-drug conjugate of claim 27, wherein the antibody-drug conjugate is capable of being internalized into a cell.
  30. The antibody-drug conjugate of claim 29, wherein the cell is a cancer cell.
  31. A pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising the antibody of any one of claims 1 to 17.
  32. The pharmaceutical composition of claim 31, wherein the angiogenesis-related disease is selected from the group consisting of cancer, metastasis, diabetic retinopathy, retinopathy of prematurity, corneal graft rejection, macular degeneration, neovascular glaucoma, erythrosis, proliferative retinopathy, psoriasis, hemophilic arthritis, capillary formation in atherosclerotic plaques, keloid, wound granulation, vascular adhesion, rheumatoid arthritis, osteoarthritis, autoimmune diseases, Crohn’s disease, restenosis, atherosclerosis, intestinal adhesions, cat scratch disease, ulcer, liver cirrhosis, nephritis, diabetic nephropathy, diabetes mellitus, inflammatory diseases, and neurodegenerative diseases.
  33. The pharmaceutical composition of claim 31, wherein the cancer is selected from the group consisting of esophageal cancer, stomach cancer, large intestine cancer, rectal cancer, oral cancer, pharynx cancer, larynx cancer, lung cancer, colon cancer, breast cancer, uterine cervical cancer, endometrial cancer, ovarian cancer, prostate cancer, testis cancer, bladder cancer, renal cancer, liver cancer, pancreatic cancer, bone cancer, connective tissue cancer, skin cancer, brain cancer, thyroid cancer, leukemia, Hodgkin’s lymphoma, lymphoma and multiple myeloid blood cancer.
  34. A method for treating angiogenesis-related disease, comprising administering the antibody of claim 1 or the pharmaceutical composition of claim 31 to a subject in need thereof.
  35. A composition for the suppression of angiogenesis, comprising the antibody of any one of claims 1 to 17.
  36. A method for suppressing angiogenesis, comprising administering the antibody of claim 1 or the pharmaceutical composition of claim 31 to a subject in need thereof.
  37. A diagnostic composition for angiogenesis-related disease, comprising the antibody of any one of claims 1 to 17.
  38. The diagnostic composition of claim 37, wherein the angiogenesis-related disease is selected from the group consisting of cancer, metastasis, diabetic retinopathy, retinopathy of prematurity, corneal graft rejection, macular degeneration, neovascular glaucoma, erythrosis, proliferative retinopathy, psoriasis, hemophilic arthritis, capillary formation in atherosclerotic plaques, keloid, wound granulation, vascular adhesion, rheumatoid arthritis, osteoarthritis, autoimmune diseases, Crohn’s disease, restenosis, atherosclerosis, intestinal adhesions, cat scratch disease, ulcer, liver cirrhosis, nephritis, diabetic nephropathy, diabetes mellitus, inflammatory diseases, and neurodegenerative diseases.
  39. The diagnostic composition of claim 38, wherein the cancer is characterized by expressing clec14a.
  40. A diagnostic kit for angiogenesis-related disease, comprising the diagnostic composition according to claim 37.
  41. A method for diagnosing angiogenesis-related disease, comprising detecting clec14a through antigen-antibody complexes in an isolated biological sample from a subject with suspected angiogenesis-related disease.
  42. A polypeptide, comprising isolated CTLD of clec14a, serving as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
  43. A polypeptide, comprising isolated N-terminal or C-terminal of CTLD of clec14a as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
  44. A polypeptide, comprising an amino acid fragment from 1st amino acid to 42nd amino acid in CTLD of clec14a or a amino acid fragment from 122nd amino acid to 142nd amino acid in CTLD of clec14a as an epitope capable of inducing production of an antibody suppressive of angiogenesis.
  45. A method for preparing an antibody binding specifically to clec14a (C-type lectin domain family 14, member A), comprising:
    biopanning using the polypeptide of any one of claims 42 to 44 as an epitope.
  46. A composition for suppressing angiogenesis, comprising a material for inhibiting the expression of clec14a.
  47. The composition of claim 46, wherein the material is a material for inhibiting the expression of CTLD of clec14a.
  48. The composition of claim 46, wherein the material is selected from the group consisting of antisense oligonucleotides, siRNAs, aptamers and antibodies that are specific to clec14a.
  49. The composition of claim 46, treating angiogenesis-related disease by suppressing angiogenesis.
  50. A kit for suppressing angiogenesis, comprising the composition of any one of claims 46 to 49.
  51. A method for suppressing angiogenesis, comprising administering the composition of any one of claims 46 to 49 to a subject in need thereof.
  52. A method for treating angiogenesis-related disease, comprising administering the composition of any one of claims 46 to 49 to a subject in need thereof.
  53. A pharmaceutical composition for preventing or treating angiogenesis-related disease, comprising fusion protein of CTLD of clec14a and Fc.
  54. The pharmaceutical composition of claim 53, wherein the angiogenesis-related disease is selected from the group consisting of cancer, metastasis, diabetic retinopathy, retinopathy of prematurity, corneal graft rejection, macular degeneration, neovascular glaucoma, erythrosis, proliferative retinopathy, psoriasis, hemophilic arthritis, capillary formation in atherosclerotic plaques, keloid, wound granulation, vascular adhesion, rheumatoid arthritis, osteoarthritis, autoimmune diseases, Crohn’s disease, restenosis, atherosclerosis, intestinal adhesions, cat scratch disease, ulcer, liver cirrhosis, nephritis, diabetic nephropathy, diabetes mellitus, inflammatory diseases, and neurodegenerative diseases.
  55. A method for treating angiogenesis-related disease, comprising administering fusion protein of CTLD of clec14a and Fc or a pharmaceutical composition of claim 53 to a subject in need thereof.
PCT/KR2013/005272 2012-06-14 2013-06-14 Novel antibody specific for clec14a and uses thereof Ceased WO2013187724A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
US14/407,756 US9751933B2 (en) 2012-06-14 2013-06-14 Antibody specific for CLEC14A and uses thereof
KR1020157000309A KR101760465B1 (en) 2012-06-14 2013-06-14 Novel Antibody Specific for Clec14a and Uses Thereof
EP13805033.1A EP2861623A4 (en) 2012-06-14 2013-06-14 NEW SPECIFIC CLEC14A ANTIBODY AND USES THEREOF
CN201380043426.9A CN104903350B (en) 2012-06-14 2013-06-14 It is specific to the new antibodies and application thereof of CLEC14A
JP2015517188A JP6129305B2 (en) 2012-06-14 2013-06-14 Novel antibody having specificity for CLEC14A and use thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201261659654P 2012-06-14 2012-06-14
US61/659,654 2012-06-14
KRPCT/KR2012/008618 2012-10-19
PCT/KR2012/008618 WO2013187556A1 (en) 2012-06-14 2012-10-19 Novel antibody specific for clec14a and uses thereof

Publications (1)

Publication Number Publication Date
WO2013187724A1 true WO2013187724A1 (en) 2013-12-19

Family

ID=49758359

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/KR2012/008618 Ceased WO2013187556A1 (en) 2012-06-14 2012-10-19 Novel antibody specific for clec14a and uses thereof
PCT/KR2013/005272 Ceased WO2013187724A1 (en) 2012-06-14 2013-06-14 Novel antibody specific for clec14a and uses thereof

Family Applications Before (1)

Application Number Title Priority Date Filing Date
PCT/KR2012/008618 Ceased WO2013187556A1 (en) 2012-06-14 2012-10-19 Novel antibody specific for clec14a and uses thereof

Country Status (6)

Country Link
US (1) US9751933B2 (en)
EP (1) EP2861623A4 (en)
JP (1) JP6129305B2 (en)
KR (1) KR101760465B1 (en)
CN (1) CN104903350B (en)
WO (2) WO2013187556A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016116760A2 (en) 2015-01-21 2016-07-28 Cancer Research Technology Limited Inhibitors
CN110312735A (en) * 2016-09-08 2019-10-08 宇里技术有限公司 Specifically it is bound to the deglycosylation antibody and application thereof of CLEC14A

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8956859B1 (en) 2010-08-13 2015-02-17 Aviex Technologies Llc Compositions and methods for determining successful immunization by one or more vaccines
KR20200091499A (en) * 2015-05-06 2020-07-30 스니프르 테크놀로지스 리미티드 Altering microbial populations & modifying microbiota
CA3015293A1 (en) * 2016-03-15 2017-09-21 Cancer Research Technology Limited Chimeric antigen receptor
JP7501991B2 (en) 2016-03-15 2024-06-18 キャンサー・リサーチ・テクノロジー・リミテッド Antibodies and related molecules and uses thereof
GB201609811D0 (en) 2016-06-05 2016-07-20 Snipr Technologies Ltd Methods, cells, systems, arrays, RNA and kits
GB201712733D0 (en) 2017-08-08 2017-09-20 Snipr Tech Ltd Methods & cells
US10760075B2 (en) 2018-04-30 2020-09-01 Snipr Biome Aps Treating and preventing microbial infections
US11851663B2 (en) 2018-10-14 2023-12-26 Snipr Biome Aps Single-vector type I vectors
US20220275081A1 (en) * 2018-10-17 2022-09-01 Good T Cells, Inc. Binding molecule specific for lrig-1 protein and use thereof
GB201914514D0 (en) * 2019-10-08 2019-11-20 Univ Birmingham Treatment of osteopenia and/or osteoporosis
US12281161B2 (en) 2021-07-28 2025-04-22 Trustees Of Boston University Polypeptides and uses thereof
GB202209518D0 (en) 2022-06-29 2022-08-10 Snipr Biome Aps Treating & preventing E coli infections

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5660985A (en) 1990-06-11 1997-08-26 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands containing modified nucleotides
WO2011027132A1 (en) 2009-09-03 2011-03-10 Cancer Research Technology Limited Clec14a inhibitors
WO2011119980A1 (en) * 2010-03-25 2011-09-29 The Board Of Trustees Of The Leland Stanford Junior University Protein and gene biomarkers for rejection of organ transplants

Family Cites Families (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4281061A (en) * 1979-07-27 1981-07-28 Syva Company Double antibody for enhanced sensitivity in immunoassay
TW589189B (en) 1997-08-04 2004-06-01 Scras Kit containing at least one double-stranded RNA combined with at least one anti-viral agent for therapeutic use in the treatment of a viral disease, notably of viral hepatitis
US6506559B1 (en) 1997-12-23 2003-01-14 Carnegie Institute Of Washington Genetic inhibition by double-stranded RNA
WO2000044914A1 (en) 1999-01-28 2000-08-03 Medical College Of Georgia Research Institute, Inc. Composition and method for in vivo and in vitro attenuation of gene expression using double stranded rna
DE19956568A1 (en) 1999-01-30 2000-08-17 Roland Kreutzer Method and medicament for inhibiting the expression of a given gene
EP1235842A4 (en) 1999-10-15 2003-04-23 Univ Massachusetts GENESIS OF THE RNA INTERFERENCE PATH AS AID OF TARGETED GENTIAN INTERFERENCE
GB9927444D0 (en) 1999-11-19 2000-01-19 Cancer Res Campaign Tech Inhibiting gene expression
US20040033495A1 (en) * 2001-08-03 2004-02-19 Eos Biotechnology, Inc. Methods of diagnosis of angiogenesis, compositions and methods of screening for angiogenesis modulators

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5660985A (en) 1990-06-11 1997-08-26 Nexstar Pharmaceuticals, Inc. High affinity nucleic acid ligands containing modified nucleotides
WO2011027132A1 (en) 2009-09-03 2011-03-10 Cancer Research Technology Limited Clec14a inhibitors
WO2011119980A1 (en) * 2010-03-25 2011-09-29 The Board Of Trustees Of The Leland Stanford Junior University Protein and gene biomarkers for rejection of organ transplants

Non-Patent Citations (15)

* Cited by examiner, † Cited by third party
Title
DATABASE GENBANK [online] 1 April 2007 (2007-04-01), "IMMUNOGLOBULIN HEAVY CHAIN VARIABLE REGION PROTEIN, PARTIAL [HOMO SAPIENS]", XP003034229, Database accession no. AAT84384.1 *
DATABASE GENBANK [online] 1 July 2001 (2001-07-01), "IMMUNOGLOBULIN HEAVY CHAIN VARIABLE REGION, PARTIAL [HOMO SAPIENS]", XP003034226, Database accession no. CAC43215.1 *
DATABASE GENBANK [online] 1 June 2004 (2004-06-01), "IMMUNOGLOBULIN HEAVY CHAIN VARIABLE REGION, PARTIAL [HOMO SAPIENS]", XP003034227, Database accession no. CAE45477.1 *
DATABASE GENBANK [online] 11 January 2012 (2012-01-11), XP003034230, Database accession no. JN577822.1 *
DATABASE GENBANK [online] 12 August 2008 (2008-08-12), "TRICHOPLAX ADHAERENS HYPOTHETICAL PROTEIN, MRNA", XP003034231, Database accession no. XM_002115467.1 *
DATABASE GENBANK [online] 14 November 2006 (2006-11-14), "IMMUNOGLOBULIN HEAVY CHAIN VARIABLE REGION, PARTIAL [HOMO SAPIENS]", XP003034225, Database accession no. CAL05539.1 *
DATABASE GENBANK [online] 24 May 2004 (2004-05-24), "HOMO SAPIENS CLONE 011.13A9H IMMUNOGLOBULIN HEAVY CHAIN VARIABLE REGION MRNA,PARTIAL CDS", XP003034232, Database accession no. AY423191.1 *
DATABASE GENBANK [online] 28 August 2007 (2007-08-28), "IMMUNOGLOBULIN HEAVY CHAIN VARIABLE REGION, PARTIAL [HOMO SAPIENS]", XP003034228, Database accession no. ABI50652.1 *
KI, M-K ET AL.: "Human antibodies targeting the C-type lectin-like domain of the tumor endothelial cell marker clec14a regulate angiogenic properties in vitro", ONCOGENE, 6 May 2013 (2013-05-06), XP055177751 *
MURA, M. ET AL.: "Identification and angiogenic role of the novel tumor endothelial marker CLEC14A", ONCOGENE, vol. 31, no. 3, 27 June 2011 (2011-06-27), pages 293 - 305, XP055177748 *
RHO, SEUNG-SIK ET AL.: "Clec14a is specifically expressed in endothelial cells and mediates cell to cell adhesion", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, vol. 404, no. 1, 21 November 2010 (2010-11-21), pages 103 - 108, XP027586993 *
See also references of EP2861623A4
SMITH GP: "Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface", SCIENCE, vol. 228, no. 4705, 1985, pages 1315 - 1317, XP002464311, DOI: doi:10.1126/science.4001944
SMITH GP; PETRENKO VA: "Phage display", CHEM. REV., vol. 97, no. 2, 1997, pages 391 - 410, XP000683275, DOI: doi:10.1021/cr960065d
ZELENSKY, ALEX N. ET AL.: "The C-type lectin-like domain superfamily", THE FEBS JOURNAL, vol. 272, no. 24, December 2005 (2005-12-01), pages 6179 - 6217, XP009111435 *

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2016116760A2 (en) 2015-01-21 2016-07-28 Cancer Research Technology Limited Inhibitors
JP2018505875A (en) * 2015-01-21 2018-03-01 キャンサー・リサーチ・テクノロジー・リミテッドCancer Research Technology Limited Inhibitor
US20180282418A1 (en) * 2015-01-21 2018-10-04 Cancer Research Technology Limited Inhibitors of the interaction between clec14a and multimerin-2 for inhibition of angiogenesis
US10808031B2 (en) 2015-01-21 2020-10-20 Cancer Research Technology Limited Inhibitors of the interaction between CLEC14A and multimerin-2 for inhibition of angiogenesis
EP3247727B1 (en) * 2015-01-21 2022-03-23 Cancer Research Technology Limited Inhibitors of the interaction between clec14a and multimerin-2 for inhibition of angiogenesis
US11919959B2 (en) 2015-01-21 2024-03-05 Cancer Research Technology Limited Inhibitors of the interaction between CLEC14A and multimerin-2 for inhibition of angiogenesis
CN110312735A (en) * 2016-09-08 2019-10-08 宇里技术有限公司 Specifically it is bound to the deglycosylation antibody and application thereof of CLEC14A
AU2017322783B2 (en) * 2016-09-08 2020-04-30 Woori Technologies Corporation Deglycosylated antibody specifically binding to clec14a and uses thereof

Also Published As

Publication number Publication date
EP2861623A1 (en) 2015-04-22
CN104903350B (en) 2018-10-23
US20150140001A1 (en) 2015-05-21
KR101760465B1 (en) 2017-07-24
JP6129305B2 (en) 2017-05-17
EP2861623A4 (en) 2015-12-02
CN104903350A (en) 2015-09-09
WO2013187556A1 (en) 2013-12-19
KR20150023665A (en) 2015-03-05
JP2016503286A (en) 2016-02-04
US9751933B2 (en) 2017-09-05

Similar Documents

Publication Publication Date Title
EP2861623A1 (en) Novel antibody specific for clec14a and uses thereof
WO2019124951A1 (en) Gpcr heteromer inhibitors and uses thereof
WO2014077648A1 (en) Antibody binding specifically to human and mouse l1cam protein, and use therefor
CN110139874B (en) Anti-CEACAM6 antibodies and methods of use thereof
WO2015130115A1 (en) Novel antibody specific for tspan8 and uses thereof
WO2016013870A1 (en) Method for positioning, in cytoplasm, antibody having complete immunoglobulin form by penetrating antibody through cell membrane, and use for same
CN101616689A (en) CCR2 antagonists for the treatment of fibrosis
WO2019190206A1 (en) Antibody binding specifically to ecl-2 of claudin 3, fragment thereof, and use thereof
WO2022039490A1 (en) Anti-b7-h4/anti-4-1bb bispecific antibodies and use thereof
WO2017010744A1 (en) Antigenic composition for detecting auto-antibody with specific response to exosomal protein eif3a, and method for diagnosing liver cancer using antigenic composition
WO2021101346A1 (en) Anti-ror1/anti-4-1bb bispecific antibodies and uses thereof
WO2024155098A1 (en) Regulatory t cell surface antigen and antibody that specifically binds thereto
WO2016013871A1 (en) Method for suppressing ras activated in cell by using antibody having cytoplasm penetration capacity and complete immunoglobulin form, and use for same
EP4054643A1 (en) Glypican-3-specific modified aptamer and use thereof
WO2021010800A1 (en) Antibody specifically binding to wrs protein, and use thereof
WO2014021693A2 (en) Novel monoclonal antibody which is specifically bound to tm4sf5 protein and use thereof
WO2020250204A1 (en) Novel antibodies specific for cthrc1 and use thereof
WO2021010799A1 (en) Antibody specifically binding to wrs protein, and use thereof
WO2021015419A1 (en) Antibody specifically binding to phosphorylated beta-catenin, and use thereof
WO2020013644A1 (en) Epitope specific to smo protein, antibody recognizing same, and composition comprising same
WO2019022274A1 (en) Antibody specifically binding to pauf protein, and use thereof
WO2015088256A1 (en) Binding molecules capable of neutralizing rabies viruses
WO2019004550A1 (en) Antibody specifically binding to mic-1 protein, and use thereof
WO2025258951A1 (en) Anti-apolipoprotein e4 (apoe4) antibodies and uses thereof
WO2025005692A1 (en) Anti-cxcr2 antibody and use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 13805033

Country of ref document: EP

Kind code of ref document: A1

REEP Request for entry into the european phase

Ref document number: 2013805033

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2013805033

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 14407756

Country of ref document: US

ENP Entry into the national phase

Ref document number: 2015517188

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20157000309

Country of ref document: KR

Kind code of ref document: A