WO2013109995A2 - Fused antigen vaccines and compositions against streptococcus pneumoniae - Google Patents
Fused antigen vaccines and compositions against streptococcus pneumoniae Download PDFInfo
- Publication number
- WO2013109995A2 WO2013109995A2 PCT/US2013/022309 US2013022309W WO2013109995A2 WO 2013109995 A2 WO2013109995 A2 WO 2013109995A2 US 2013022309 W US2013022309 W US 2013022309W WO 2013109995 A2 WO2013109995 A2 WO 2013109995A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- fusion protein
- seq
- immunogenic
- amino acid
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
- C07K14/3156—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci from Streptococcus pneumoniae (Pneumococcus)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
- A61K39/092—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
Definitions
- S. pneumoniae is a Gram-positive encapsulated coccus that colonizes the nasopharynx in about 5-10% of healthy adults and 20-40% of healthy children. Normal colonization becomes pathogenic when 5 * . pneumoniae is carried into the Eustachian tubes, nasal sinuses, lungs, bloodstream, meninges, joint spaces, bones or peritoneal cavity. S.
- pneumoniae has several virulence factors that enable the organism to evade the immune system.
- examples include a polysaccharide capsule that prevents phagocytosis by host immune cells, proteases that inhibit complement-mediated opsonization, and proteins that cause lysis of host cells.
- the presence of complex in the polysaccharide capsule, the presence of complex
- polysaccharides forms the basis for classifying pneumococci into different serotypes. To date, over 93 serotypes of S. pneumoniae have been identified.
- a polyvalent pneumococcal vaccine PPV-23
- the vaccine contains capsular polysaccharides (CPs) from 23 serotypes of S. pneumoniae.
- CPs capsular polysaccharides
- T independent antigens these CPs induce only shortlived antibody responses, necessitating repeated doses, which increases the risk of immunological tolerance.
- the antibodies raised against the S. pneumoniae capsular polysaccharides termed anticapsular antibodies, are recognized as protective in adult and immunocompetent individuals. However, children under 2 years of age and
- S. pneumoniae vaccine includes bacterial polysaccharides from 7 S. pneumoniae serovars conjugated to the diphtheria toxoid protein. This vaccine induces both B and T cell responses.
- serotype replacement can render Prevnar ineffective against non-vaccine serotypes.
- Serotype replacement has already been demonstrated in several clinical trials and epidemiologic studies, necessitating development of different formulations of these vaccines.
- An example is the recently introduced Prevnar 13, directed to 13 pneumococcal serotypes.
- the two Prevnar formulations are expensive to manufacture, greatly limiting their availability in the developing world.
- PPV-23 which consists of 23 purified but unconjugated
- polysaccharides has broader coverage, but does not provide protection to children under the age of 2 years, a population which is at the highest risk for pneumococcal disease.
- compositions need to incorporate novel or specific antigens that elicit an immune response against 5 * . pneumoniae.
- Streptococcus pneumoniae is a major health concern, especially in very young, elderly, or immunocompromised patients. While DNA and protein sequence information for S. pneumoniae have been known for some time, and researchers have long attempted to produce vaccines against S. pneumoniae, a major problem was how to elicit an immune response that is both long-lived and effective in all age groups. Certain of the S. pneumoniae antigens used in the instant application were initially identified by screening immune cells from mice either immunized with unencapsulated killed whole S. pneumoniae or infected with live S. pneumoniae, or from healthy human donors for T cell specific immune responses. Accordingly, the present disclosure provides, inter alia, certain highly effective vaccines against Streptococcus pneumoniae. The vaccines may be used therapeutically or
- the present disclosure also provides specific antigens and methods for using the antigens to elicit an immune response against S. pneumoniae.
- two, three, four, or more polypeptides from Table 1 or immunogenic fragments or variants thereof are covalently bound to each other, e.g. as a fusion protein.
- the vaccine formulation comprises or consists of one or more fusion proteins comprising (or consisting of) one or all or fragments of SP0148, SP2108 and SP 1912 or variants thereof, such as those shown in Table 2.
- the present disclosure provides a vaccine formulation comprising or consisting of a pharmaceutically acceptable carrier and a fusion protein comprising or consisting of two or more immunogenic polypeptides, wherein the
- immunogenic polypeptides have an amino acid sequence at least 70, 80 or 90% homologous to SEQ ID NO: 6, SEQ ID NO: 2 or SEQ ID NO: 9, or an immunogenic fragment thereof.
- the present disclosure provides fusion proteins comprising or consisting of a first immunogenic polypeptide having an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 6, or an immunogenic fragment thereof and a second immunogenic polypeptide having an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 9, or an immunogenic fragment thereof.
- the first immunogenic polypeptide consists of or comprises the amino acid sequence of SEQ ID NO: 6, or an immunogenic fragment thereof
- the second immunogenic polypeptide consists of or comprises the amino acid sequence of SEQ ID NO: 9, or an immunogenic fragment thereof.
- the first immunogenic polypeptide is located at the amino terminus of the fusion protein and the second immunogenic polypeptide is located at the carboxyl terminus of the fusion protein.
- the fusion protein further comprises or consists of a third immunogenic polypeptide having an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 2, or an immunogenic fragment thereof.
- the third immunogenic polypeptide consists of or comprises SEQ ID NO: 2, or an immunogenic fragment thereof.
- the third immunogenic polypeptide is located at the amino terminus of the fusion protein and the first immunogenic polypeptide is located at the carboxyl terminus of the fusion protein.
- the first immunogenic polypeptide is located at the amino terminus of the fusion protein and the second immunogenic polypeptide is located at the carboxyl terminus of the fusion protein.
- the third immunogenic polypeptide is located at the amino terminus of the fusion protein and the second immunogenic polypeptide is located at the carboxyl terminus of the fusion protein.
- the first immunogenic polypeptide is located at the amino terminus of the fusion protein and the third immunogenic polypeptide is located at the carboxyl terminus of the fusion protein.
- the present disclosure provides fusion proteins comprising or consisting of a first immunogenic polypeptide having an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 2, or an immunogenic fragment thereof and a second immunogenic polypeptide having an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 9, or an immunogenic fragment thereof.
- the first immunogenic polypeptide consists of or comprises the amino acid sequence of SEQ ID NO: 2, or an immunogenic fragment thereof
- the second immunogenic polypeptide consists of or comprises the amino acid sequence of SEQ ID NO: 9, or an immunogenic fragment thereof.
- the first immunogenic polypeptide is located at the amino terminus of the fusion protein and the second immunogenic polypeptide is located at the carboxyl terminus of the fusion protein.
- the present disclosure provides fusion proteins comprising or consisting of a first immunogenic polypeptide having an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 2, or an immunogenic fragment thereof and a second immunogenic polypeptide having an amino acid sequence at least 90% homologous to the amino acid sequence of SEQ ID NO: 6, or an immunogenic fragment thereof.
- the first immunogenic polypeptide consists of or comprises the amino acid sequence of SEQ ID NO: 2, or an immunogenic fragment thereof
- the second immunogenic polypeptide consists of or comprises the amino acid sequence of SEQ ID NO: 6, or an immunogenic fragment thereof.
- the first immunogenic polypeptide is located at the amino terminus of the fusion protein and the second immunogenic polypeptide is located at the carboxyl terminus of the fusion protein. In some embodiments, the second immunogenic polypeptide is located at the amino terminus of the fusion protein and the first immunogenic polypeptide is located at the carboxyl terminus of the fusion protein.
- the present disclosure provides vaccine formulations comprising or consisting of one or more fusion proteins described herein and a
- the present disclosure provides methods of treating a subject suffering from or susceptible to S. pneumoniae infection, comprising administering to the subject an effective amount of a vaccine formulation described herein.
- FIG. 1 shows the concentration of IL-17A generated by blood samples from mice that were immunized with the indicated protein(s) and cholera toxin adjuvant, then stimulated with killed, unencapsulated whole cell S. pneumoniae, as described in Example 1.
- the left panel shows the data in scatter format, and the right panel shows the average and standard deviation for each sample.
- Immunization group "All 3" represents animals immunized with a combination of SP2108, SP0148, and SP1634.
- FIG. 2 shows the concentration of IL-17A generated by blood samples from mice that were immunized with the indicated protein(s) and cholera toxin adjuvant, then stimulated with a combination of three proteins (SP2108, SP0148, and SP 1634), as described in Example 1.
- FIG. 3 shows the number of S. pneumoniae colonies obtained from a nasal wash in mice that were immunized with the indicated protein(s) and cholera toxin adjuvant, then challenged with intranasal administration of S. pneumoniae, as described in Example 1.
- 003 represents a control unrelated antigen.
- FIG. 4 shows the number of S. pneumoniae colonies obtained from a nasal wash in BALB/c mice that were immunized with the indicated protein(s) and cholera toxin adjuvant, then challenged with intranasal administration of S. pneumoniae, as described in Example 2.
- FIG. 5 shows the concentration of IL-17A generated by blood samples from mice that were immunized with the indicated proteins and cholera toxin adjuvant, then stimulated with the protein of immunization (left panel) or killed, unencapsulated whole cell S. pneumoniae (right panel), as described in Example 3.
- FIG. 6 shows the number of S. pneumoniae colonies obtained from a nasal wash in mice that were immunized with the indicated proteins and cholera toxin adjuvant, then challenged with intranasal administration of S. pneumoniae, as described in Example 4.
- FIG. 7 shows survival of mice that were immunized with the indicated proteins and the adjuvant alum, then underwent aspiration challenge with 5 * . pneumoniae as described in Example 5.
- FIG. 8 shows survival of mice that were immunized with the indicated proteins and the adjuvant alum, then underwent aspiration challenge with 5 * . pneumoniae as described in Example 6.
- FIG. 9 shows the number of S. pneumoniae colonies obtained from a nasal wash in mice that were immunized with the indicated proteins and cholera toxin adjuvant, then challenged with intranasal administration of S. pneumoniae, as described in Example 7.
- FIG. 10 shows the concentration of IL-17A generated by blood samples from mice that were immunized with the indicated proteins and alum, then stimulated with the proteins indicated at upper left, as described in Example 8.
- FIG. 1 1 shows the number of S. pneumoniae colonies obtained from a nasal wash in mice that were immunized with the indicated proteins and alum or with killed, unencapsulated whole cell S. pneumoniae plus alum (WCV), then challenged with intranasal administration of S. pneumoniae, as described in Example 9.
- FIG. 12 shows the number of S. pneumoniae colonies obtained from a nasal wash in mice that were immunized with the indicated proteins and alum or with killed, unencapsulated whole cell S. pneumoniae plus alum (WCV), then challenged with intranasal administration of S. pneumoniae, in two pooled studies as described in Example 10.
- FIG. 13 shows the number of S. pneumoniae colonies obtained from a nasal wash in mice that were immunized with the indicated proteins and alum or with killed, unencapsulated whole cell S. pneumoniae plus alum (WCB), then challenged with intranasal administration of S. pneumoniae, as described in Example 1 1.
- FIG. 14 shows survival of mice that were injected with antibodies or sera specific to the indicated proteins, then underwent aspiration challenge with S. pneumoniae, as described in Example 12.
- FIG. 15 shows the percent of animals protected from sepsis in six separate aspiration challenge studies, two of which are described in more detail in Examples 6 and 12.
- FIG. 16 Panels A-C show the mean IL-17A response generated by blood samples from mice that were immunized with the indicated proteins and alum, then stimulated with the proteins indicated at upper right, as described in Example 13.
- FIG. 17 Panels A and B show the concentration of IL-17A generated by blood samples from mice immunized with the indicated fusion proteins and alum, or with alum alone. Blood samples were stimulated with the protein of immunization or a control protein, as indicated at upper right and described in Example 14.
- FIG. 19 Panels A and B show the mean IL-17A response generated by blood samples from mice immunized at the indicated doses with the indicated proteins and alum, or with alum alone. Blood samples were stimulated with overlapping peptides (OLP) or killed unencapsulated whole cell S. pneumoniae (WCA), as indicated at upper left and described in Example 16.
- OFP overlapping peptides
- WCA killed unencapsulated whole cell S. pneumoniae
- FIG. 20 shows the concentration of IL-17A generated by blood samples from mice immunized with the indicated proteins and alum, or with alum alone. Blood samples were stimulated with killed unencapsulated whole cell S. pneumoniae as described in Example 17.
- FIG. 21, Panels A-D show the number of S. pneumoniae colonies (CFU) obtained from nasal washes of mice immunized with the indicated proteins and alum, or alum alone, then challenged by intranasal administration of S. pneumoniae, as described in Example 18.
- CFU S. pneumoniae colonies
- FIG. 22 Panels A and B show the concentration of IL-17A generated by blood samples from mice immunized with the indicated combinations of proteins and alum, killed unencapsulated whole cell S. pneumoniae and alum (WCB), or alum alone. Blood samples were stimulated with overlapping peptides (OLP) or killed unencapsulated whole cell S. pneumoniae (WCA), as indicated above each graph and described in Example 20.
- FIG. 23 Panels A and B show the number of S. pneumoniae colonies (CFU) obtained from nasal washes of mice immunized with the indicated combinations of proteins and alum, killed unencapsulated whole cell S. pneumoniae and alum (WCB), or alum alone, then challenged by intranasal administration of S. pneumoniae, as described in Example 21.
- CFU S. pneumoniae colonies
- FIG. 24 Panels A and B show hours to moribund for mice immunized with the indicated combinations of proteins and alum, or alum alone, then challenged by intravenous administration of S. pneumoniae, as described in Example 22.
- the fusion proteins include one, two or more polypeptides that elicit (e.g., primarily elicit) a T cell response, or that elicit both a T cell and a B cell response.
- the fusion protein comprises one, two or more of the polypeptides or genes listed in Table 1.
- the fusion protein comprises two of the polypeptides or genes listed in Table 1.
- the fusion protein comprises three of the polypeptides or genes listed in Table 1.
- a fusion protein comprises two or more immunogenic polypeptides having an amino acid sequence comprising SEQ ID NOs: 1-1 1, shown in Table 1, or immunogenic fragments thereof. In some embodiments, a fusion protein comprises two immunogenic polypeptides having an amino acid sequence comprising SEQ ID NOs: 1-11, shown in Table 1 , or immunogenic fragments thereof. In some embodiments, a fusion protein comprises three immunogenic polypeptides having an amino acid sequence comprising SEQ ID NOs: 1-11, shown in Table 1, or immunogenic fragments thereof. In some embodiments, at least one immunogenic polypeptide is SP2108 (SEQ ID NO: 6). In some embodiments, at least one immunogenic polypeptide is SP0148 (SEQ ID NO: 2). In some embodiments, at least one immunogenic polypeptide is SP1912 (SEQ ID NO: 9).
- a fusion protein comprises one or more polypeptides homologous to the polypeptides listed in Table 1 (for example, SP1912, SP1912L, SP0148 with or without a signal sequence, SP2108 with or without a signal sequence).
- Individual strains of S. pneumoniae contain numerous mutations relative to each other, and some of these result in different protein sequences between the different strains.
- One of skill in the art may readily substitute an amino acid sequence, or a portion thereof, with the homologous amino acid sequence from a different 5 * . pneumoniae strain.
- this application provides immunogenic polypeptides with at least 90%, 95%, 97%, 98%, 99%, or 99.5% identity to the polypeptides listed in Table 1 or an immunogenic fragment thereof. Serotypic variation may be used to design such variants of the polypeptides listed in Table 1.
- fusion proteins described herein comprise two or more fragments of immunogenic peptides listed in Table 1 (for example, fragments of SP 1912, SP1912L, SP0148 with or without a signal sequence, SP2108 with or without a signal sequence).
- fusion proteins described herein comprise truncation mutants that are close in size to the polypeptides listed in Table 1. For example, they may lack at most one, two three, four, five, ten, or twenty amino acids from one or both termini (referring to component polypeptides in a fusion protein).
- a fragment is a truncated fragment of any of SEQ ID NOs: 1-1 1 lacking 1-5, 1-10, or 1-20 amino acid residues from the N-terminus, C-terminus, or both, of any one of SEQ ID NOs: 1- 1 1.
- a fragment is a truncated fragment of any of SEQ ID NOs: 1-11 lacking 1-10 amino acid residues from the N-terminus, C-terminus, or both, of any one of SEQ ID NOs: 1-1 1.
- a fragment may lack 10 amino acid residues at both the N- terminus and C-terminus of any one of SEQ ID NOs: 1-11, resulting in a protein lacking 20 amino acid residues.
- Internal deletions e.g., of 1-10, 1 1-20, 21-30, or 31-40 amino acids, are also contemplated.
- SP0148 including signal sequence 2 38 NC_003028.3
- SP2108 including signal sequence 6 NC 003028.31:2020750- 2022021
- a fusion protein comprises an N-terminal polypeptide and a C-terminal polypeptide.
- one or both of the N-terminal polypeptide and the C-terminal polypeptide comprise an immunogenic polypeptide, for example, a polypeptide having an amino acid sequence comprising one of SEQ ID NOs: 1-11 or an immunogenic fragment or variant thereof.
- the N-terminal polypeptide and the C-terminal polypeptide are directly bound to each other.
- the N-terminal polypeptide and the C-terminal polypeptide are linked via a linker peptide.
- a linker when present, can be adjusted to obtain a more flexible or rigid linker.
- exemplary peptide linkers are shown as SEQ ID NOs: 69-71.
- a linker can generally be from 1-40, such as 10-30 and specifically 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acids in length.
- a fusion protein comprises an immunogenic fragment of a fusion protein shown in Table 2.
- a fusion protein is or includes an immunogenic fragment of any of SEQ ID NOs: 47-54.
- a fusion protein may lack at most one, two three, four, five, ten, or twenty amino acids from the N-terminus, C- terminus, or both, of any one of SEQ ID NOs: 47-54.
- the same number of residues is removed from the N-terminus and the C-terminus, while in other embodiments, a different number of residues is removed from the N-terminus compared to the C-terminus.
- the N-terminal polypeptide is not truncated so as not to prevent lipidation.
- this application provides fusion proteins with at least 90%
- a fusion protein is or includes an amino acid sequence having at least 90%, 95%, 97%, 98%, 99%, or 99.5% identity to any one of SEQ ID NOs: 47-54.
- the fusion proteins include variants or fragments of the polypeptides or genes listed in Table 1.
- a fragment included in a fusion protein described herein is close in size to a full-length polypeptide or a polypeptide listed in Table 1. For example, they may lack at most one, two, three, four, five, ten, twenty, or thirty amino acids from one or both termini.
- the fragment is 100- 500 amino acids in length, or 150-450, or 200-400, or 250-350 amino acids in length.
- the fragment is 100-200, 150-250, 200-300, 250-350, 300-400, 350-450, or 400-500 amino acids in length.
- the fragments result from processing, or partial processing, of signal sequences by an expression host, e.g. E. coli, an insect cell line (e.g., the baculovirus expression system), or a mammalian (e.g., human or Chinese Hamster Ovary) cell line.
- an expression host e.g. E. coli, an insect cell line (e.g., the baculovirus expression system), or a mammalian (e.g., human or Chinese Hamster Ovary) cell line.
- the fragments described above or sub-fragments thereof e.g., fragments of 8-50, 8-30, or 8-20 amino acid residues
- SP0148 SEQ ID NO: 2 and variants thereof
- the protein SP0148 is named "ABC transporter, substrate-binding protein”.
- SP0148 is typically extracellular proteins that interact transiently with a transmembrane protein complex. Such complexes use energy generated by ATP hydrolysis to translocate specific substrates across a cell membrane.
- SP0148 is a 276 or 277 (depending on the isolate) amino acid protein that contains a conserved PBPb (periplasmic binding protein) domain, spanning amino acids 40-246, which is typical of membrane-bound transport complexes.
- PBPb peripheral binding protein domain
- SP0148 has a bacterial extracellular solute-binding proteins family 3 domain which is largely co-extensive with the PBPb domain and extends from amino acid 40 to 244.
- a fusion protein comprises a truncation mutant of SP0148 comprising or lacking one or more of said domains and motifs.
- a fusion protein includes a polypeptide containing at least 20 consecutive amino acid residues selected from SP0148.
- the polypeptide may also be a variant of the at least 20 residue fragment.
- the polypeptide includes no more than 250, 225, 200, 175, 150, 125, or 100 consecutive amino acids from SP0148.
- Endogenous SP0148 comprises a signal sequence that directs its secretion and potential lipidation.
- the signal sequence of the polypeptide of SEQ ID NO: 2 is partially or fully processed by an expression host, e.g. E. coli.
- an expression host e.g. E. coli.
- a variant of SP0148 that lacks the signal sequence (SEQ ID NO: 1) is used.
- the polypeptide of SEQ ID NO: 1 is encoded by the nucleic acid of SEQ ID NO: 37, although other nucleic acid sequences (including codon-optimized sequences) may be used.
- SEQ ID NO: 38 encodes the full length sequence of SP0148 used in the screens herein. [0057] Variants of the amino acid sequence and nucleotide sequence of SP0148 may be found in U.S. Patent Application Publication No. 2005/0020813, U.S. Patent Nos.
- a fusion protein includes a polypeptide having an amino acid sequence comprising, or consisting of, either of SEQ ID NOs: 3-4, or an immunogenic fragment thereof (e.g., in place of a polypeptide having an amino acid sequence comprising one of SEQ ID NOs: 1 or 2).
- a fusion protein comprises or consists of an immunogenic fragment of SP0148.
- immunogenic fragments of SP0148 include ALGLVAAGV (SEQ ID NO: 74), ELTGYEIEV (SEQ ID NO: 75), AVNNLSYTK (SEQ ID NO: 76), TYLPAEADI (SEQ ID NO: 77), RYNMAVNNL (SEQ ID NO: 78), DFQQIMVRL (SEQ ID NO: 79), EHTDNPTIL (SEQ ID NO: 80), APIAQNPNV (SEQ ID NO: 81), LPSDQQPYV (SEQ ID NO: 82), YVYPLLAQG (SEQ ID NO: 83), QGLDNLKVI (SEQ ID NO: 84), KYLYAAPI (SEQ ID NO: 85), GELTGYEI (SEQ ID NO: 86), NPNVLVVKK (SEQ ID NO: 87), KLSKQFFGD (SEQ ID NO:
- SP2108 SEQ ID NO: 6
- the polypeptide SP2108 is 423 amino acids in length and is alternatively known as MalX, maltose/maltodextrin ABC transporter, or maltose/maltodextrin-binding protein. Much of the protein (amino acids 3-423) is classified as a MalE (Maltose-binding periplasmic) domain.
- SP2108 contains a signal sequence that directs its secretion and potential lipidation.
- the signal sequence of the polypeptide of SEQ ID NO: 6 is partially or fully processed by an expression host, e.g. E. coli.
- a fusion protein comprises a truncation mutant of SP2108 comprising one or more of said domains and motifs.
- a fusion protein includes an SP2108 variant that lacks the signal sequence.
- This variant is represented by polypeptide sequence SEQ ID NO: 5 and may be encoded by, for example, a nucleic acid according to SEQ ID NO: 39, although due to degeneracy in the genetic code, other DNA sequences (including codon-optimized sequences) may be used.
- a fusion protein includes a polypeptide containing at least 20 consecutive amino acid residues selected from SP2108.
- the polypeptide may also be a variant of the at least 20 residue fragment.
- the polypeptide includes no more than 400, 350, 300, 250, 200, 150, or 100 consecutive amino acids from SP2108.
- a fusion protein contains a polypeptide having an amino acid sequence comprising, or consisting of, either of SEQ ID NOs: 7-8, or an immunogenic fragment thereof (e.g., in place of a polypeptide having an amino acid sequence comprising one of SEQ ID NOs: 5 or 6).
- a fusion protein comprises or consists of an
- immunogenic fragment of SP2108 include AIIDGPWKA (SEQ ID NO: 99), VMMAPYDRV (SEQ ID NO: 100), SIAGINYAK (SEQ ID NO: 101), VWDPAKNML (SEQ ID NO: 102), QPLPNISQM (SEQ ID NO: 103), APYDRVGSL (SEQ ID NO: 104), APAVIESLV (SEQ ID NO: 105), FYYTYGLLA (SEQ ID NO: 106), SKYAFAGE (SEQ ID NO: 107), TEGAGNLI (SEQ ID NO: 108),
- AIIDGPWKA SEQ ID NO: 99
- VMMAPYDRV SEQ ID NO: 100
- SIAGINYAK SEQ ID NO: 101
- VWDPAKNML SEQ ID NO: 102
- QPLPNISQM SEQ ID NO: 103
- APYDRVGSL SEQ ID NO: 104
- APAVIESLV SEQ ID NO: 105
- FYYTYGLLA S
- LADWTNFYY (SEQ ID NO: 109), SLVMYYNKD (SEQ ID NO: 110), KEAGVKVTL (SEQ ID NO: 11 1), KSTAVLGTV (SEQ ID NO: 1 12), GAKTDDTTK (SEQ ID NO: 113), SQKFVDFLV (SEQ ID NO: 1 14), QAFKDAKVN (SEQ ID NO: 115), AVIESLVMY (SEQ ID NO: 116), DAKTAANDA (SEQ ID NO: 117), YGVATIPTL (SEQ ID NO: 1 18), KTAAIIDGP (SEQ ID NO: 119), KAYEKEAGV (SEQ ID NO: 120), AGNGAYVFG (SEQ ID NO: 121), and AWVIPQAVK (SEQ ID NO: 122).
- SP 1912 is a hypothetical protein of 99 amino acids. While the protein function is not definitively known, sequence analysis suggests it is a putative thioredoxin.
- a fusion protein includes a polypeptide containing at least 20 consecutive amino acid residues selected from SP 1912.
- the polypeptide may also be a variant of the at least 20 residue fragment.
- the polypeptide includes no more than 90, 75, 60, 45 or 30 consecutive amino acids from SP 1912.
- a fusion protein includes an SP 1912 variant that comprises an exogenous lipidation sequence.
- a signal sequence directs lipidation.
- the lipidation signal may be, e.g., the signal sequence of SP2108 (SEQ ID NO: 67) or SP0148, or an E. coli signal sequence.
- the exemplary variant SP1912L comprising the signal sequence of the E.
- coli gene RlpB (SEQ ID NO: 68) is represented by polypeptide sequence SEQ ID NO: 10.
- SP1912 (SEQ ID NO: 9) and SP1912L (SEQ ID NO: 10) may be encoded, respectively, by nucleic acids according to SEQ ID NO: 40 and 41, although due to degeneracy in the genetic code, other DNA sequences (including codon- optimized sequences) may be used.
- the lipidation sequence is provided by fusing a full-length polypeptide such as SP2108 (SEQ ID NO: 6) or SP0148 (SEQ ID NO: 2) to SP 1912.
- Exemplary fusions are SEQ ID NOs: 49-54.
- formulation fusion protein comprises a polypeptide having an amino acid sequence comprising, or consisting of, SEQ ID NO: 11, or an immunogenic fragment thereof (e.g., in place of a polypeptide having an amino acid sequence comprising SEQ ID NO: 9).
- a fusion protein comprises or consists of an
- immunogenic fragment of SP1912 include KMWMAGLALLGIGSL (SEQ ID NO: 123), LLGIGSLALATKKVA (SEQ ID NO: 124), MAGLALLGIGSLALA (SEQ ID NO: 125), WMAGLALLGIGSLAL (SEQ ID NO: 126), GLALLGIG SL ALATK (SEQ ID NO: 127), LALLGIGSLALATKK (SEQ ID NO: 128), FSDMGEIATLYVQVY (SEQ ID NO: 129), KAKKMWMAGLALLGI (SEQ ID NO: 130), ALLGIGSLALATKKVAKKMWMAGLALLGIG (SEQ ID NO: 131), SDMGEIATLYVQVYE (SEQ ID NO: 132), DMGEIATL YVQVYE S (SEQ ID NO: 133), AGLALLGIGSLALAT (SEQ ID NO: 134), MGEIATLYVQVYESS (SEQ ID NO: 123), LLGIGSL
- a fusion protein described herein contains at least one lipidated polypeptide.
- the fusion protein is lipidated.
- the fusion protein is lipidated on the N-terminal peptide. Conjugation to the lipid moiety may be direct or indirect (e.g., via a linker). The lipid moiety may be synthetic or naturally produced.
- a polypeptide from Table 1 or 2 may be chemically conjugated to a lipid moiety.
- a construct may comprise a gene or polypeptide from Table 1, or 2, or an immunogenic fragment or variant thereof, and a lipidation sequence including a lipobox motif.
- a canonical lipobox motif is shown as SEQ ID NO: 66.
- a lipidation sequence may be N-terminal or C-terminal to the protein, and may be embedded in a signal or other sequence, or in a fusion protein.
- Exemplary lipidation sequences include the signal sequence of SP2108 (SEQ ID NO: 67) and the signal sequence of the E. coli gene RlpB (SEQ ID NO: 68).
- a signal sequence may be, for example, an E. coli or S. pneumoniae signal sequence.
- Exemplary E. coli signal sequences include the mlpA signal sequence (Lin, J.J.
- Lpp is an exemplary E. coli signal sequence that directs lipidation (Cullen, P.A. et al. "Construction and evaluation of a plasmid vector for the expression of recombinant lipoproteins in Escherichia coi Plasmid. 2003 Jan;49(l): 18-29.) E. coli signal sequences that direct lipidation are also described in Legrain, M. et al. ("Production of lipidated meningococcal transferrin binding protein 2 in Escherichia coli” Protein Expr Purif. 1995 Oct;6(5):570-8), e.g. the signal sequence of the gene RlpB (SEQ ID NO: 68). Numerous S. pneumoniae signal sequences are known in the art. One such signal sequence is SEQ ID NO: 67.
- one or more polypeptides included in a fusion protein described herein may comprise a tag.
- a tag may be N-terminal or C-terminal.
- tags may be added to a nucleic acid or polypeptide to facilitate purification, detection, solubility, or confer other desirable characteristics on the protein or nucleic acid.
- a purification tag may be a peptide, oligopeptide, or polypeptide that may be used in affinity purification.
- the polypeptide is free of tags such as protein purification tags, and is purified by a method not relying on affinity for a purification tag.
- the fused portion is short. This, in some instances, the fusion protein comprises no more than 1, 2, 3, 4, 5, 10, or 20 additional amino acids on one or both termini of the polypeptide of Table 1 or 2.
- this application provides nucleic acids encoding one or more of the polypeptides and/or fusion proteins described herein, such as DNA, RNA, or an analog thereof.
- the underlying DNA sequences for the polypeptides described above may be modified in ways that do not affect the sequence of the protein product, and such sequences are included in the invention.
- the DNA sequence may be codon- optimized to improve expression in a host such as E. coli, an insect cell line (e.g., using the baculovirus expression system), or a mammalian (e.g., human or Chinese Hamster Ovary) cell line.
- this application provides polynucleotides (such as
- DNA, RNA, or an analog thereof that are at least 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% identical to polynucleotide sequences of Table 1 or 2, or a variant or portion of said sequence.
- the polynucleotide is 600-2000, 800-1800, 1000-1600, 1200-1400 nucleotides in length. In some embodiments, the polynucleotide is 600-1600, 800-1800, 1000-2000, 2000-3000, or 3000-4000 nucleotides in length.
- the nucleic acids may be used, for example, for recombinant production of a polypeptide of Table 1 or a fusion protein of Table 2, or immunogenic fragments thereof.
- Polynucleotides encoding peptides of Tables 1 or 2 or a fragment thereof can be cloned into any of a variety of expression vectors, under the control of a variety of regulatory elements, and fusions can be created with other peptides of Tables 1 or 2 or with other sequences of interest.
- Methods of cloning nucleic acids are routine and conventional in the art.
- isolating, cloning, modifying, labeling, manipulating, sequencing and otherwise treating or analyzing nucleic acids and/or proteins see, e.g., Sambrook, J. et al. (1989).
- the present disclosure also provides immunogenic compositions (e.g., vaccine compositions) of, or including, one or more fusion proteins described herein.
- an immunogenic composition further includes a pharmaceutically acceptable carrier.
- the S. pneumoniae antigens described herein were identified by screening immune cells from mice either immunized with unencapsulated killed whole S. pneumoniae or infected with live S. pneumoniae, or from healthy human donors that elicit a T cell specific immune response. The human donors have almost certainly been exposed to S. pneumoniae at some point during their lifetimes, because S. pneumoniae is a very common disease and colonizing pathogen.
- the present disclosure contemplates immunogenic compositions of fusion proteins including S. pneumoniae antigens that elicit a strong immune response in all age groups that is long-lived in immunized or infected mice or humans for counteracting infection by S. pneumoniae.
- an immunogenic composition described herein induces a T H 17 cell response at least 1.5-fold greater than that induced by a control unrelated antigen (such as the HSV-2 protein ICP47 with the gene name US 12) after contacting TH17 cells.
- a control unrelated antigen such as the HSV-2 protein ICP47 with the gene name US 12
- an immunogenic composition described herein inhibits infection by S. pneumoniae in an uninfected subject.
- an immunogenic composition described herein reduces occurrence or duration of S. pneumoniae nasopharyngeal colonization in an individual colonized or infected by S. pneumoniae.
- an immunogenic composition described herein inhibits development of sepsis in an individual infected by S. pneumoniae.
- an immunogenic composition described herein inhibits development of invasive diseases such as pneumonia, meningitis, otitis media, sinusitis or infection of other sites or organs with S. pneumoniae.
- an immunogenic composition described herein may also comprise portions of said Streptococcus polypeptides, including fusion proteins, for example deletion mutants, truncation mutants, oligonucleotides, and peptide fragments.
- the portions of said polypeptides are immunogenic.
- immunogenicity of a portion of a protein is readily determined using the same assays that are used to determine the immunogenicity of the full-length protein.
- the portion of the polypeptide has substantially the same immunogenicity as the full-length proteins.
- the immunogenicity is no more than 10%, 20%, 30%, 40%, or 50% less than that of the full-length protein (e.g., polypeptides of Tables 1, 2 and 3).
- the peptide fragments may be, for example, linear, circular, or branched.
- polypeptides and fusion proteins described herein, and fragments and variants thereof are immunogenic. These polypeptides may be immunogenic in mammals, for example mice, guinea pigs, or humans.
- An immunogenic polypeptide is typically one capable of raising a significant immune response in an assay or in a subject.
- the immune response may be innate, humoral, cell-mediated, or mucosal (combining elements of innate, humoral and cell-mediated immunity).
- an immunogenic polypeptide may increase the amount of IL-17 produced by T cells.
- an immunogenic polypeptide may (i) induce production of antibodies, e.g., neutralizing antibodies, that bind to the polypeptide and/or the whole bacteria, (ii) induce TH1 immunity, (iii) activate the CD4 + T cell response, for example by increasing CD4 + T cells and/or increasing localization of CD4 + T cells to the site of infection or reinfection, (iv) activate the CD8 + CTL response, for example by increasing CD8 + T cells and/or increasing localization of CD8 + T cells to the site of infection or reinfection, (v) induce THI immunity, (vi) induce anti-microbial peptides, and/or (vii) activate innate immunity.
- an immunogenic polypeptide causes the production of a detectable amount of antibody specific to that antigen.
- polypeptides described herein have less than 20%
- human autoantigens and/or gut commensal bacteria e.g., certain Bacteroides, Clostridium, Fusobacterium, Eubacterium, Ruminococcus , Peptococcus, Peptostreptococcus , Bifidobacterium, Escherichia and Lactobacillus species.
- human autoantigens include insulin, proliferating cell nuclear antigen, cytochrome P450, and myelin basic protein.
- a polypeptide described herein may comprise one or more immunogenic portions and one or more non-immunogenic portions.
- the immunogenic portions may be identified by various methods, including protein microarrays, ELISPOT/ELISA techniques, and/or specific assays on different deletion mutants (e.g., fragments) of the polypeptide in question.
- Immunogenic portions may also be identified by computer algorithms. Some such algorithms, like
- EpiMatrix produced by EpiVax
- Other computational tools for identifying antigenic epitopes include PEPVAC (Promiscuous EPitope-based VACcine, hosted by Dana Farber Cancer Institute on the world wide web at
- MHCPred which uses a partial least squares approach and is hosted by The Jenner Institute on the world wide web at www.jenner.ac.uk/MHCPred
- Immune Epitope Database algorithms on the world wide web at www.jenner.ac.uk/MHCPred
- An immunogenic fragment of a polypeptide described herein comprises at least one immunogenic portion, as measured experimentally or identified by algorithm (for example, the SYFPEITHI algorithm found at www.syfpeithi.de).
- an immunogenic composition described herein (e.g., a vaccine composition) includes a fusion protein described herein and additionally one or more, or two or more, known S. pneumoniae antigens. In some instances, the known S.
- pneumoniae antigens are predominantly antibody targets shown in Table 3. In some instances, the known S. pneumoniae antigens are polysaccharides. In some instances, the known S. pneumoniae antigens protect from S. pneumoniae colonization, or from S.
- PspA Pneumococcal surface protein A (SEQ ID NO: 27) and derivatives of PspA.
- PspA include proline-rich segments with the non-proline block (PR+NPB, also referred to as PRN and further described below as well as in Daniels, C.C. et al. (2010) Infection and Immunity 78:2163-72) and related constructs comprising all or a fragment of the proline-rich region of PspA (e.g., regions containing one or more of the sequences PAPAP, PKP, PKEPEQ and PEKP and optionally including a non-proline block).
- fragments or variants of PspA comprise proline-rich segments with the non- proline block and 10, 20 30, 40 or more additional amino acids of PspA sequence.
- H70 is one exemplary sequence which includes the proline-rich region and non- proline-block encompassing amino acids 290-410 PspA.
- An example of the non-proline- block has the exemplary sequence EKSADQQAEEDYARRSEEEYNRLTQQQ (SEQ ID NO: 34), which generally has no proline residues in an otherwise proline-rich area of the non- coiled region of PspA.
- Other embodiments of non-proline block (NPB) sequences include SEQ ID NOs: 35 and 36 and PspA and its derivatives can include genes expressing similar proline-rich structures (i.e. PKP, PKEPEQ and PEKP), with or without the NPB.
- the amino acids at either end of the NPB mark the boundaries of the proline-rich region.
- the amino-terminal boundary to the PR-region is DLKKAVNE (SEQ ID NO: 72)
- the carboxy-terminal boundary is (K/G)TGW(K/G)QENGMW (SEQ ID NO: 73).
- Peptides containing the NPB are particularly immunogenic, suggesting that the NPB may be an important epitope.
- Exemplary immunogenic PspA polypeptide derivatives containing the coiled-coil structure include SEQ ID NOs: 28 and 31.
- Particular embodiments of the immunogenic PspA polypeptide derivatives lacking the coiled-coil structure have the amino acid sequences shown as SEQ ID NOs: 29, 30 and 32.
- Immunogenic PspA polypeptides SEQ ID NO: 28-30 include both PR and NPB sequences (PR+NPB).
- Immunogenic PspA polypeptides of SEQ ID NOs: 31 and 32 include only a PR sequence (PR only) and lack the NPB.
- Pneumolysoids have homology to the S. pneumoniae protein pneumolysin (PLY), but have reduced toxicity compared to pneumolysin. Pneumolysoids can be naturally occurring or engineered derivatives of pneumolysin. In some embodiments, a pneumolysoid has at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to pneumolysin.
- the pneumolysoid demonstrates less than 1/2, 1/5, 1/10, 1/20, 1/50, 1/100, 1/200, 1/500, or 1/1000 the toxicity of pneumolysin in an assay for one or both of hemolytic activity towards erythrocytes and inhibition of polymorphonuclear leukocytes. Both assays are described in Saunders F.K. et al. ("Pneumolysin, the thiol-activated toxin of
- Streptococcus pneumoniae does not require a thiol group for in vitro activity" Infect Immun. 1989 Aug;57(8):2547-52).
- Exemplary pneumolysoids include PdT (a triple mutant further described in Berry, A.M. et al. (1995) Infection and Immunity 63: 1969-74); Pd-A and Pd-B (Paton J.C. et al. "Purification and immunogenicity of genetically obtained pneumolysin toxoids and their conjugation to Streptococcus pneumoniae type 19F polysaccharide" Infect Immun. 1991 Jul;59(7):2297-304); rPd2 and rPd3 (Ferreira et al.
- DNA vaccines based on genetically detoxified derivatives of pneumolysin fail to protect mice against challenge with Streptococcus pneumoniae ' " FEMS Immunol Med Microbiol (2006) 46: 291-297); Ply8, A6PLY, L460D (see, e.g., US 2009/0285846 and L. Mitchell, Protective Immune Responses to Streptococcus pneumoniae Pneumolysoids, ASM2011 conference abstract, 201 1); or a variant thereof.
- the pneumolysin has a mutation in the catalytic center, such as at amino acid 428 or 433 or the vicinity.
- S. pneumoniae antigens include Choline-binding protein A
- CbpA and derivatives thereof (AD Ogunniyi et al., "Protection against Streptococcus pneumoniae elicited by immunization with pneumolysin and CbpA," Infect Immun. 2001 Oct;69(10):5997-6003); Pneumococcal surface adhesin A (PsaA); caseinolytic protease; sortase A (SrtA); pilus 1 RrgA adhesin; PpmA; PrtA; PavA; LytA; Stk-PR; PcsB; RrgB and derivatives thereof.
- CpbA derivatives include fusion proteins described in WO 2012/134975.
- Such fusion proteins may comprise one or more copies of the R2 domain, R2i and/or R3 ⁇ 4 subdomains of CpbA, or active variants and fragments thereof, or any combination thereof.
- Such fusion proteins may further comprise a pneumolysoid.
- the construct YLN for example, comprises CpbA polypeptides YPT and NEEK, and pneumolysoid L460D (SEQ ID NO: 55).
- the antigen is at least 70%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the corresponding wild-type S. pneumoniae protein.
- Sequences of the above-mentioned polypeptides, and nucleic acids that encode them, are known; see, for example, the S. pneumoniae ATCC 700669 complete genome sequence under GenBank accession number FM21 1187.1 and linked polypeptide sequences therein.
- an immunogenic composition (e.g., a vaccine composition) contains one or more fusion proteins described herein in combination with one or more, e.g., two, three, four, or more polypeptides from Table 1 or 3 or immunogenic fragments or variants thereof in a mixture.
- the mixture contains both full-length polypeptides and fragments resulting from processing, or partial processing, of signal sequences by an expression host, e.g. E. coli, an insect cell line (e.g., the baculovirus expression system), or a mammalian (e.g., human or Chinese Hamster Ovary) cell line.
- an immunogenic composition contains one or more fusion proteins of any of SEQ ID NOs: 47-54 in the absence of any other antigens. In some embodiments, an immunogenic composition contains one or more fusion proteins of any of SEQ ID NOs: 47- 54 in combination with one or more additional proteins of any of SEQ ID NOs: 1-36, in the absence of other antigens.
- polypeptides described in Tables 1 and 3 may be used without modification in conjunction with the fusion proteins described herein.
- modification may be useful in eliciting the desired immune response.
- the smaller polypeptides can be conjugated to an appropriate immunogenic carrier such as tetanus toxoid, keyhole limpet hemocyanin or the like.
- polypeptides described herein may be conjugated to S. pneumoniae polysaccharides. The conjugated polysaccharides may be, for example, as described in US Patent 5,623,057, US Patent 5,371, 197, or PCT/US2011/023526.
- immunogenic compositions described herein include an immunogenic polypeptide, including fusion proteins (e.g., a polypeptide of Table 1, 2 or 3) that contains a membrane translocating sequence (MTS), to facilitate introduction of the polypeptide into the mammalian cell and subsequent stimulation of the cell-mediated immune response.
- fusion proteins e.g., a polypeptide of Table 1, 2 or 3
- MTS membrane translocating sequence
- Exemplary membrane translocating sequences include hydrophobic region in the signal sequence of Kaposi fibroblast growth factor, the MTS of a-synuclein, ⁇ -synuclein, or ⁇ -synuclein, the third helix of the Antennapedia homeodomain, SN50, integrin ⁇ 3 h-region, HIV Tat, pAntp, PR-39, abaecin, apidaecin, Bac5, Bac7, P. berghei CS protein, and those MTSs described in US Patents 6,248,558, 6,432,680 and 6,248,558.
- an antigen e.g., a polypeptide of Table 1, 2 or 3
- an antigen is covalently bound to another molecule. This may, for example, increase the half-life, solubility, bioabailability, or immunogenicity of the antigen.
- Molecules that may be covalently bound to the antigen include a carbohydrate, biotin, poly(ethylene glycol) (PEG), polysialic acid, N-propionylated polysialic acid, nucleic acids, polysaccharides, and PLGA.
- PEG poly(ethylene glycol)
- PEG chains can be linear, branched, or with comb or star geometries.
- the naturally produced form of a protein is covalently bound to a moeity that stimulates the immune system.
- a moeity is a lipid moeity.
- lipid moieties are recognized by a Toll-like receptor (TLR) such as TLR-2 or TLR-4, and activate the innate immune system.
- TLR Toll-like receptor
- a fusion protein and one or more additional components described herein are mixed together using known methods to form a multi- component immunogenic composition.
- a fusion protein and one or more additional components described herein are nano-encapsulated using known methods.
- a fusion protein and one or more additional components described herein are molded into nano- or micro-particles using known methods.
- a fusion protein and one or more additional components described herein are conjugated through a covalent bond using known methods to form a multi-component immunogenic composition.
- a fusion protein and one or more additional components described herein are joined non-covalently using known methods to form a multi-component immunogenic composition. Additional methods of combining a fusion protein and one or more additional components are described in, e.g.,
- an immunogenic composition described herein comprises one or more of the following: an adjuvant, stabilizer, buffer, surfactant, controlled release component, salt, preservative, and/or an antibody specific to a polypeptide included in an immunogenic composition.
- an immunogenic composition may include an adjuvant.
- Adjuvants can be broadly separated into two classes, based on their principal mechanisms of action: vaccine delivery systems and immunostimulatory adjuvants (see, e.g., Singh et ah, Curr. HIV Res. 1 :309-20, 2003).
- the adjuvant provides a signal to the immune system so that it generates a response to the antigen, and the antigen is required for driving the specificity of the response to the pathogen.
- Vaccine delivery systems are often particulate formulations, e.g., emulsions, microparticles, immune-stimulating complexes (ISCOMs), nanoparticles, which may be, for example, particles and/or matrices, and liposomes.
- ISCOMs immune-stimulating complexes
- immunostimulatory adjuvants are sometimes derived from pathogens and can represent pathogen associated molecular patterns (PAMP), e.g., lipopolysaccharides (LPS), monophosphoryl lipid (MPL), or CpG-containing DNA, which activate cells of the innate immune system.
- PAMP pathogen associated molecular patterns
- LPS lipopolysaccharides
- MPL monophosphoryl lipid
- CpG-containing DNA which activate cells of the innate immune system.
- adjuvants may be classified as organic and inorganic.
- Inorganic adjuvants include alum salts such as aluminum phosphate, amorphous aluminum
- Organic adjuvants comprise organic molecules including macromolecules.
- An example of an organic adjuvant is cholera toxin.
- Adjuvants may also be classified by the response they induce.
- the adjuvant induces the activation of 3 ⁇ 41 cells or TH2 cells.
- the adjuvant induces the activation of B cells.
- the adjuvant induces the activation of antigen-presenting cells. These categories are not mutually exclusive; in some cases, an adjuvant activates more than one type of cell.
- the adjuvant induces the activation of TH17 cells. It may promote the CD4 + or CD8 + T cells to secrete IL-17.
- an adjuvant that induces the activation of TH17 cells is one that produces at least a 2-fold, and in some cases a 10-fold, experimental sample to control ratio in the following assay.
- an experimenter compares the IL-17 levels secreted by two populations of cells: (1) cells from animals immunized with the adjuvant and a polypeptide known to induce T H 17 activation, and (2) cells from animals treated with the adjuvant and an irrelevant (control) polypeptide.
- An adjuvant that induces the activation of TH17 cells may cause the cells of population (1) to produce more than 2-fold, or more than 10-fold more IL-17 than the cells of population (2).
- IL-17 may be measured, for example, by ELISA or ELISPOT.
- the adjuvant is a toxin.
- Cholera toxin was successfully used in the mouse model to induce protective immunity in conjunction with certain polypeptides from Table 1 (see Examples 1-2).
- One form of labile toxin is produced by Intercell. Mutant derivates of labile toxin that are active as adjuvants but significantly less toxic can be used as well.
- Exemplary detoxified mutant derivatives of labile toxin include mutants lacking ADP-ribosyltransferase activity.
- LTK7 Douce et ah, "Mutants of Escherichia coli heat-labile toxin lacking ADP-ribosyltransferase activity act as nontoxic, mucosal adjuvants" PNAS Vol. 92, pp. 1644-1648, February 1995
- LTK63 Woods et ah, "Innate Imprinting by the Modified Heat-Labile Toxin of Escherichia coli (LTK63) Provides Generic Protection against Lung Infectious Disease” The Journal of Immunology, 2004, 173: 7435-7443)
- LT- G192 Douce et al.
- the adjuvant comprises a VLP (virus-like particle).
- Alphavirus replicons induces the activation of T H 17 cells using alphavirus and is produced by Alphavax.
- alphavirus may be engineered to express an antigen of interest, a cytokine of interest (for example, IL-17 or a cytokine that stimulates IL-17 production), or both, and may be produced in a helper cell line. More detailed information may be found in U.S. Patent Nos. 5,643,576 and 6,783,939.
- a vaccine formulation is administered to a patient in combination with a nucleic acid encoding a cytokine.
- TLRs toll-like receptors
- MPL Monophosphoryl Lipid A
- MPL has been produced as a detoxified lipopolysaccharide (LPS) endotoxin obtained from gram negative bacteria, such as S. minnesota.
- LPS lipopolysaccharide
- sequential acid and base hydrolysis of LPS produces an immunoactive lipid A fraction (which is MPL), and lacks the saccharide groups and all but one of the phosphates present in LPS.
- TLR-4 agonists are disclosed in Evans JT et al.
- TLR-4 ligands MPL adjuvant and Ribi.529 activate the innate immune system via TLR.
- TLR agonist is a synthetic phospholipid dimer, for example E6020 (Ishizaka ST et al. "E6020: a synthetic Toll-like receptor 4 agonist as a vaccine adjuvant” Expert Rev. Vaccines. 2007 Oct;
- TLR agonists include TLR-4 agonists
- TLR-4 agonists have been produced and/or sold by, for example, the Infectious Disease Research Institute (IRDI), Corixa, Esai, Avanti Polar Lipids, Inc., and Sigma Aldrich.
- Another exemplary adjuvant that activates TLRs comprises a mixture of MPL, Trehalose Dicoynomycolate (TDM), and
- TLR-activating adjuvant is R848 (resiquimod).
- the adjuvant is or comprises a saponin.
- the saponin is a triterpene glycoside, such as those isolated from the bark of the Quillaja saponaria tree.
- a saponin extract from a biological source can be further fractionated (e.g., by chromatography) to isolate the portions of the extract with the best adjuvant activity and with acceptable toxicity.
- Typical fractions of extract from Quillaja saponaria tree used as adjuvants are known as fractions A and C.
- ISCOMs immunostimulating complexes
- lipids e.g., cholesterol and phospholipids such as phosphatidyl choline.
- an ISCOM is assembled together with a polypeptide or nucleic acid of interest.
- saponin fractions may be used in different ratios.
- the different saponin fractions may either exist together in the same particles or have substantially only one fraction per particle (such that the indicated ratio of fractions A and C are generated by mixing together particles with the different fractions).
- Such adjuvants may comprise fraction A and fraction C mixed into a ratio of 70-95 A: 30-5 C, such as 70 A : 30 C to 75 A : 5 C, 75 A : 5 C to 80 A : 20 C, 80 A : 20 C to 85 A : 15 C, 85 A : 15 C to 90 A : 10 C, 90 A : 10 C to 95 A : 5 C, or 95 A : 5 C to 99 A : 1 C.
- combinations of adjuvants are used.
- Three exemplary combinations of adjuvants are MPL and alum, E6020 and alum, and MPL and an ISCOM.
- Adjuvants may be covalently bound to antigens.
- the adjuvant may comprise a protein which induces inflammatory responses through activation of antigen-presenting cells (APCs).
- APCs antigen-presenting cells
- one or more of these proteins can be recombinantly fused with an antigen of choice, such that the resultant fusion molecule promotes dendritic cell maturation, activates dendritic cells to produce cytokines and chemokines, and ultimately, enhances presentation of the antigen to T cells and initiation of T cell responses (see Wu et al, Cancer Res 2005; 65(1 1), pp 4947-4954).
- a polypeptide, including a fusion protein, described herein is presented in the context of the trivalent conjugate system, comprising a fusion protein of S. pneumoniae Pneumococcal surface adhesin A (PsaA) with the pneumolysoid PdT and a cell wall polysaccharide (PsaA:PdT-CPs), described in Lu et al. ("Protection against Pneumococcal colonization and fatal pneumonia by a trivalent conjugate of a fusion protein with the cell wall polysaccharide.” Infect Immun. 2009 May;77(5):2076-83).
- PdT carries three amino acid substitutions (W433F, D385N, and C428G) which render the molecule nontoxic but do not interfere with its TLR-4-mediated inflammatory properties. Conjugation of a
- polysaccharide to the fusion of a polypeptide to the TLR-4-agonist PdT enhances
- one or more polypeptides described herein are used in place of PsaA in the trivalent conjugate.
- the trivalent conjugate system typically includes alum and is usually administered parenterally.
- Other exemplary adjuvants that may be covalently bound to antigens comprise polysaccharides, pneumolysin, synthetic peptides, lipopeptides, and nucleic acids.
- the same adjuvant or mixture of adjuvants is present in each dose of a vaccine.
- an adjuvant may be administered with the first dose of vaccine and not with subsequent doses (i.e., booster shots).
- a strong adjuvant may be administered with the first dose of vaccine and a weaker adjuvant or lower dose of the strong adjuvant may be administered with subsequent doses.
- the adjuvant can be administered before the administration of the antigen, concurrent with the administration of the antigen or after the administration of the antigen to a subject (sometimes within 1, 2, 6, or 12 hours, and sometimes within 1, 2, or 5 days). Certain adjuvants are appropriate for human patients, non-human animals, or both.
- a vaccine formulation or immunogenic composition may include one or more additional components.
- the vaccine formulation or immunogenic composition may include one or more stabilizers such as sugars (such as sucrose, glucose, or fructose), phosphate (such as sodium phosphate dibasic, potassium phosphate monobasic, dibasic potassium phosphate, or monosodium phosphate), glutamate (such as monosodium L- glutamate), gelatin (such as processed gelatin, hydrolyzed gelatin, or porcine gelatin), amino acids (such as arginine, asparagine, histidine, L-histidine, alanine, valine, leucine, isoleucine, serine, threonine, lysine, phenylalanine, tyrosine, and the alkyl esters thereof), inosine, or sodium borate.
- stabilizers such as sugars (such as sucrose, glucose, or fructose), phosphate (such as sodium phosphate dibasic, potassium phosphate monobasic, dibasic potassium phosphate, or mono
- the vaccine formulation or immunogenic composition includes one or more buffers such as a mixture of sodium bicarbonate and ascorbic acid.
- the vaccine formulation may be administered in saline, such as phosphate buffered saline (PBS), or distilled water.
- PBS phosphate buffered saline
- the vaccine formulation or immunogenic composition includes one or more surfactants such as polysorbate 80 (Tween 80), Triton X-100,
- the vaccine formulation or immunogenic composition includes one or more salts such as sodium chloride, ammonium chloride, calcium chloride, or potassium chloride.
- a preservative is included in the vaccine or immunogenic composition. In other embodiments, no preservative is used. A preservative is most often used in multi-dose vaccine vials, and is less often needed in single-dose vaccine vials. In certain embodiments, the preservative is 2-phenoxyethanol, methyl and propyl parabens, benzyl alcohol, and/or sorbic acid.
- the vaccine formulation or immunogenic composition is a controlled release formulation.
- the S. pneumoniae vaccines described herein may be used for prophylactic and/or therapeutic treatment of S. pneumoniae. Accordingly, this application provides a method for treating a subject suffering from or susceptible to S. pneumoniae infection, comprising administering an effective amount of any of the vaccine formulations described herein. In some aspects, the method inhibits S. pneumoniae colonization in an individual. In some aspects, the method inhibits S. pneumoniae symptoms, invasive disease or sequelae, such as sepsis, pneumonia, meningitis, otitis media, sinusitis or infection of other sites or organs with 5 * . pneumoniae.
- the subject receiving the vaccination may be a male or a female, and may be a child or adult. In some embodiments, the subject being treated is a human. In other embodiments, the subject is a non-human animal.
- the vaccine is administered to a subject to induce an immune response that can help protect against the establishment of S. pneumoniae, for example by protecting against colonization, the first and necessary step in disease.
- the method inhibits infection by S. pneumoniae in a non-colonized or uninfected subject.
- the method may reduce the duration of colonization in an individual who is already colonized.
- the vaccine compositions of the invention confer protective immunity, allowing a vaccinated individual to exhibit delayed onset of symptoms or sequelae, or reduced severity of symptoms or sequelae, as the result of his or her exposure to the vaccine.
- the reduction in severity of symptoms or sequelae is at least 25%, 40%, 50%, 60%, 70%, 80% or even 90%.
- vaccinated individuals may display no symptoms or sequelae upon contact with S.
- Mucosal immunity is primarily the result of secretory IgA (sIGA) antibodies on mucosal surfaces of the respiratory, gastrointestinal, and genitourinary tracts.
- the sIGA antibodies are generated after a series of events mediated by antigen-processing cells, B and T lymphocytes, that result in sIGA production by B lymphocytes on mucosa- lined tissues of the body.
- Humoral immunity is typically the result of IgG antibodies and IgM antibodies in serum.
- Cellular immunity can be achieved through cytotoxic T lymphocytes or through delayed-type hypersensitivity that involves macrophages and T lymphocytes, as well as other mechanisms involving T cells without a requirement for antibodies.
- cellular immunity may be mediated by THI or TH17 cells.
- a vaccine formulation as described herein e.g., a composition comprising one or more polypeptides from Table 1 , 2 or 3, or nucleic acids encoding the polypeptides, or antibodies reactive with the polypeptides
- a vaccine formulation as described herein is administered to patients that are
- An immunocompromising condition arising from a medical treatment is likely to expose the individual in question to a higher risk of infection with S. pneumoniae. It is possible to treat an infection prophylactically in an individual having the
- an antigenic composition e.g., two or more antigens from Table 1 or 2, or an antigen from Table 3, or nucleic acids encoding the antigens
- an antigenic composition e.g., two or more antigens from Table 1 or 2, or an antigen from Table 3, or nucleic acids encoding the antigens
- antibodies reactive to two or more antigens from Table 1 or 2, or to an antigen from Table 3, before or during a treatment known to compromise immune function it is possible to prevent a subsequent S. pneumoniae infection or to reduce the risk of the individual contracting an infection due to the immunocompromised condition.
- an 5 * . pneumoniae infection e.g., following a treatment leading to an immunocompromised condition it is also possible to treat the infection by administering to the individual an antigen composition.
- the following groups are at increased risk of pneumococcal disease or its complications, and therefore it is advantageous for subjects falling into one or more of these groups to receive a vaccine formulation described herein: children, especially those from 1 month to 5 years old or 2 months to 2 years old; children who are at least 2 years of age with asplenia, splenic dysfunction or sickle-cell disease; children who are at least 2 years of age with nephrotic syndrome, chronic cerebrospinal fluid leak, HIV infection or other conditions associated with immunosuppression.
- At least one dose of the pneumococcal antigen composition is given to adults in the following groups at increased risk of pneumococcal disease or its complications: all persons 65 years of age; adults with asplenia, splenic dysfunction or sickle-cell disease; adults with the following conditions: chronic
- cardiorespiratory disease cirrhosis, alcoholism, chronic renal disease, nephrotic syndrome, diabetes mellitus, chronic cerebrospinal fluid leak, HIV infection, AIDS and other conditions associated with immunosuppression (Hodgkin's disease, lymphoma, multiple myeloma, immunosuppression for organ transplantation), individuals with cochlear implants;
- the vaccine may be administered to a patient suffering from 5 * . pneumoniae infection, in an amount sufficient to treat the patient.
- Treating the patient in this case, refers to reducing S. pneumoniae symptoms and/or bacterial load and/or sequelae bin an infected individual.
- treating the patient refers to reducing the duration of symptoms or sequelae, or reducing the intensity of symptoms or sequelae.
- the vaccine reduces transmissibility of S. pneumoniae from the vaccinated patient. In certain embodiments, the reductions described above are at least 25%, 30%, 40%, 50%, 60%, 70%, 80% or even 90%.
- the vaccine is administered to an individual postinfection.
- the vaccine may be administered shortly after infection, e.g. before symptoms or sequelae manifest, or may be administered during or after manifestation of symptoms or sequelae.
- a therapeutic S. pneumoniae vaccine can reduce the intensity and/or duration of the various symptoms or sequelae of S. pneumoniae infection. Symptoms or sequelae of S. pneumoniae infection can take many forms. In some cases, an infected patient develops pneumonia, acute sinusitis, otitis media (ear infection), meningitis, bacteremia, sepsis, osteomyelitis, septic arthritis, endocarditis, peritonitis, pericarditis, cellulitis, or brain abscess.
- Sepsis is a rare but life-threatening complication of S. pneumoniae infection, where the bacterium invades the bloodstream and systemic inflammation results. Typically, fever is observed and white blood cell count increases.
- Goldstein, B. et al. International pediatric sepsis consensus conference: definitions for sepsis and organ dysfunction in pediatrics.” Pediatr Crit Care Med. Jan 2005;6(l):2-8.
- the efficacy of vaccination with the vaccines disclosed herein may be determined in a number of ways, in addition to the clinical outcomes described above.
- IL-17 levels particularly IL-17A
- the IL-17 levels may be compared to IL-17 levels in the same subject before vaccination.
- Increased IL-17 (e.g., IL-17A) levels such as a 1.5 fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold or 100-fold or more increase, would indicate an increased response to the vaccine.
- IL-17 e.g., IL-17A
- neutrophils in the presence of T cells or antibodies from the patient for pneumococcal killing.
- Increased pneumococcal killing such as a 1.5 fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold or 100-fold or more increase, would indicate an increased response to the vaccine.
- T H 17 cell activation such as a 1.5 fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold or 100-fold or more increase, correlates with an increased response to the vaccine.
- levels of an antibody specific to the vaccine such as a 1.5 fold, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold or 100-fold or more increase, are correlated with increased vaccine efficacy.
- two or more of these assays are used. For example, one may measure IL-17 levels and the levels of vaccine-specific antibody. Alternatively, one may follow epidemiological markers such as incidence of, severity of, or duration of pneumococcal infection in vaccinated individuals compared to unvaccinated individuals.
- Vaccine efficacy may also be assayed in various model systems such as the mouse model. For instance, BALB/c or C57BL/6 strains of mice may be used. After administering the test vaccine to a subject (as a single dose or multiple doses), the experimenter administers a challenge dose of S. pneumoniae. In some cases, a challenge dose administered intranasally is sufficient to cause S. pneumoniae colonization (especially nasal colonization) in an unvaccinated animal, and in some cases a challenge dose administered via aspiration is sufficient to cause sepsis and a high rate of lethality in unvaccinated animals. One can then measure the reduction in colonization or the reduction in lethality in vaccinated animals.
- Examples 1-2 and 4 show the efficacy of polypeptides of Table 1 in inhibiting 5 * . pneumoniae nasal colonization following intranasal challenge in the mouse model.
- Examples 5 and 6 show the efficacy of polypeptides of Table 1 in protecting against sepsis and death following infection with 5 * . pneumoniae via aspiration in the mouse model.
- compositions described herein may stimulate an antibody response or a cell-mediated immune response, or both, in the mammal to which it is administered.
- the composition stimulates a T H 1 -biased CD4 + T cell response, a T H 17-biased CD4 + T cell response and/or a CD8 + T cell response.
- the composition stimulates an antibody response.
- the composition stimulates a 3 ⁇ 41 -biased CD4 + T cell response, T H 17-biased CD4 + T cell response and/or a CD8 + T cell response, and an antibody response.
- the composition (e.g., one comprising one or more polypeptides of Table 1, 2 or 3, or nucleic acids encoding the polypeptides, or antibodies reactive with the peptides) includes a cytokine or nucleotide coding region encoding a cytokine such as IL- 17, to provide additional stimulation to the immune system of the mammal.
- the composition comprises a cytokine such as IL-17.
- a T H 17 cell response is desirable in mounting an immune response to the compositions disclosed herein, e.g., ones comprising one or more polypeptides of Table 1, 2 or 3.
- an active TH17 response is beneficial in clearing a pneumococcal infection. For instance, mice lacking the IL-17A receptor show decreased whole cell vaccine-based protection from a pneumococcal challenge (Lu et ah, "Interleukin-17A mediates acquired immunity to pneumococcal colonization.” PLoS Pathog. 2008 Sep 19;4(9)).
- a method of increasing IL-17 production by administering the compositions described herein (e.g., ones comprising one or more polypeptides of Table 1, 2 or 3) to a subject.
- this application provides a method of activating 3 ⁇ 417 cells by administering said compositions to a subject.
- increased IL-17A levels result in increased pneumococcal killing by neutrophils or neutrophil-like cells, for instance by inducing recruitment and activation of neutrophils of neutrophil-like cells.
- this pneumococcal killing is independent of antibodies and complement.
- specific antibody production and complement activation may be useful additional mechanisms that contribute to clearing of a pneumococcal infection.
- Immunogenic compositions containing immunogenic polypeptides or polynucleotides encoding immunogenic polypeptides together with a pharmaceutical carrier are also provided.
- the immunogenic composition comprises one or more nucleic acids encoding one or more polypeptides of SEQ ID NOs: 1-26 and 47-54, such as one or more polypeptides selected from SEQ ID NOs: 47-54. In some embodiments these nucleic acids are expressed in the immunized individual, producing the encoded S.
- pneumoniae antigens and the S. pneumoniae antigens so produced can produce an immunostimulatory effect in the immunized individual.
- Such a nucleic acid-containing immunostimulatory composition may comprise, for example, an origin of replication, and a promoter that drives expression of one or more nucleic acids encoding one or more polypeptides of SEQ ID NOs: 47-54.
- Such a composition may also comprise a bacterial plasmid vector into which is inserted a promoter (sometimes a strong viral promoter), one or more nucleic acids encoding one or more polypeptides of SEQ ID NOs: 47-54, and a polyadenylation/transcriptional termination sequence.
- the nucleic acid is DNA.
- the amount of antigen in each vaccine or immunogenic composition dose is selected as an effective amount, which induces a prophylactic or therapeutic response, as described above, in either a single dose or over multiple doses.
- the dose is without significant adverse side effects in typical vaccines.
- Such amount will vary depending upon which specific antigen is employed.
- a dose will comprise 1-1000 ⁇ g of each protein, in some instances 2-100 ⁇ g, for instance 4-40 ⁇ g.
- the vaccine formulation comprises 1-1000 ⁇ g of the polypeptide and 1-250 ⁇ g of the adjuvant.
- the appropriate amount of antigen to be delivered will depend on the age, weight, and health (e.g. immunocompromised status) of a subject. When present, typically an adjuvant will be present in amounts from 1 ⁇ g - 250 ⁇ g per dose, for example 50-150 ⁇ g, 75-125 ⁇ g or 100 ⁇ g.
- only one dose of the vaccine is administered to achieve the results described above.
- subjects receive one or more boost vaccinations, for a total of two, three, four or five vaccinations.
- the number is three or fewer.
- a boost vaccination may be administered, for example, about 1 month, 2 months, 4 months, 6 months, or 12 months after the initial vaccination, such that one vaccination regimen involves administration at 0, 0.5-2 and 4-8 months. It may be advantageous to administer split doses of vaccines which may be administered by the same or different routes.
- the vaccines and immunogenic compositions described herein may take on a variety of dosage forms.
- the composition is provided in solid or powdered (e.g., lyophilized) form; it also may be provided in solution form.
- a dosage form is provided as a dose of lyophilized composition and at least one separate sterile container of diluent.
- compositions will be administered in a dose escalation manner, such that successive administrations of the composition contain a higher concentration of composition than previous administrations. In some embodiments, the composition will be administered in a manner such that successive administrations of the composition contain a lower concentration of composition than previous administrations.
- compositions are administered to a patient suffering from a disease in an amount sufficient to treat the patient.
- Therapeutic applications of a composition described herein include reducing transmissibility, slowing disease progression, reducing bacterial viability or replication, or inhibiting the expression of proteins required for toxicity, such as by 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20% or 10% of the levels at which they would occur in individuals who are not treated with the composition.
- compositions are administered to a human or other mammal to induce an immune response that can inhibit the establishment of an infectious disease or other condition.
- a composition may partially block the bacterium from establishing an infection.
- the compositions are administered in combination with antibiotics.
- antibiotics are used to treat pneumococcal infections, including penicillin, amoxicillin, amoxicillin/clavulanate, cefuroxime, cefotaxime, ceftriaxone, and vancomycin.
- the appropriate antibiotic may be selected based on the type and severity of the infection, as well as any known antibiotic resistance of the infection (Jacobs MR "Drug-resistant Streptococcus pneumoniae: rational antibiotic choices" Am J Med. 1999 May 3;106(5A): 19S-25S).
- the vaccine formulations and pharmaceutical compositions herein can be delivered by administration to an individual, typically by systemic administration (e.g., intravenous, intraperitoneal, intramuscular, intradermal, subcutaneous, subdermal, transdermal, intracranial, intranasal, mucosal, anal, vaginal, oral, buccal route or they can be inhaled) or they can be administered by topical application.
- systemic administration e.g., intravenous, intraperitoneal, intramuscular, intradermal, subcutaneous, subdermal, transdermal, intracranial, intranasal, mucosal, anal, vaginal, oral, buccal route or they can be inhaled
- the route of administration is intramuscular.
- the route of administration is subcutaneous.
- the route of administration is mucosal.
- the route of administration is transdermal or intradermal.
- transdermal administration is one suitable route of administration for 5 * .
- pneumoniae vaccines comprising toxins (e.g. cholera toxin or labile toxin); in other embodiments, the administration is intranasal.
- Vaccines formulated with Alphavirus replicons may be administered, for example, by the intramuscular or the subcutaneous route.
- Vaccines comprising Monophosphory Lipid A (MPL), Trehalose Dicoynomycolate (TDM), and dioctadecyldimethylammonium bromide (DDA) are suitable (inter alia) for intramuscular and subcutaneous administration.
- a vaccine comprising resiquimod may be administered topically or subcutaneously, for example.
- the vaccine formulation or immunogenic composition may be suitable for administration to a human patient, and vaccine or immunogenic composition preparation may conform to USFDA guidelines.
- the vaccine formulation or immunogenic composition is suitable for administration to a non-human animal.
- the vaccine or immunogenic composition is substantially free of either endotoxins or exotoxins. Endotoxins may include pyrogens, such as lipopolysaccharide (LPS) molecules.
- LPS lipopolysaccharide
- the vaccine or immunogenic composition may also be substantially free of inactive protein fragments which may cause a fever or other side effects.
- the composition contains less than 1%, less than 0.1%, less than 0.01%, less than 0.001%, or less than 0.0001% of endotoxins, exotoxins, and/or inactive protein fragments.
- the vaccine or immunogenic composition has lower levels of pyrogens than industrial water, tap water, or distilled water. Other vaccine or
- immunogenic composition components may be purified using methods known in the art, such as ion-exchange chromatography, ultrafiltration, or distillation.
- the pyrogens may be inactivated or destroyed prior to administration to a patient.
- Raw materials for vaccines such as water, buffers, salts and other chemicals may also be screened and depyrogenated. All materials in the vaccine may be sterile, and each lot of the vaccine may be tested for sterility.
- the endotoxin levels in the vaccine fall below the levels set by the USFDA, for example 0.2 endotoxin (EU)/kg of product for an intrathecal injectable composition; 5 EU kg of product for a non- intrathecal injectable composition, and 0.25-0.5 EU/mL for sterile water.
- EU endotoxin
- the preparation comprises less than 50%, 20%, 10%, or 5% (by dry weight) contaminating protein.
- the desired molecule is present in the substantial absence of other biological macromolecules, such as other proteins (particularly other proteins which may substantially mask, diminish, confuse or alter the characteristics of the component proteins either as purified preparations or in their function in the subject reconstituted mixture).
- the immunogenic composition comprising purified subunit proteins contains less than 5%, 2%, 1%, 0.5%, 0.2%, 0.1% of protein from host cells in which the subunit proteins were expressed, relative to the amount of purified subunit.
- the desired polypeptides are substantially free of nucleic acids and/or carbohydrates.
- the vaccine or immunogenic composition contains less than 5%, less than 2%, less than 1%, less than 0.5%, less than 0.2%, or less than 0.1% host cell DNA and/or RNA.
- At least 80%, 90%, 95%, 99%, or 99.8% (by dry weight) of biological macromolecules of the same type are present in the preparation (but water, buffers, and other small molecules, especially molecules having a molecular weight of less than 5000, can be present).
- the vaccine or immunogenic composition has low or no toxicity, within a reasonable risk-benefit ratio.
- the vaccine or immunogenic composition comprises ingredients at concentrations that are less than LD5 0 measurements for the animal being vaccinated. LD5 0 measurements may be obtained in mice or other experimental model systems, and extrapolated to humans and other animals.
- a vaccine formulation or immunogenic composition might have an LD5 0 value in rats of greater than 100 g/kg, greater than 50g/kg, greater than 20 g/kg, greater than 10 g/kg, greater than 5 g/kg, greater than 2 g/kg, greater than 1 g/kg, greater than 500 mg/kg, greater than 200 mg/kg, greater than 100 mg/kg, greater than 50 mg/kg, greater than 20 mg/kg, or greater than 10 mg/kg.
- a vaccine formulation or immunogenic composition that comprises a toxin such as botulinum toxin (which can be used as an adjuvant) should contain significantly less than the LD5 0 of botulinum toxin.
- formulations suitable for introduction of the vaccine formulations or pharmaceutical composition vary according to route of administration.
- Formulations suitable for parenteral administration such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal, intraperitoneal, intranasal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives.
- the formulations can be presented in unit-dose or multi-dose sealed containers, such as ampoules and vials.
- Injection solutions and suspensions can be prepared from sterile powders, granules, and tablets of the kind previously described.
- the cells can be administered intravenously or parenterally.
- Formulations suitable for oral administration can consist of (a) liquid solutions, such as an effective amount of the polypeptides or packaged nucleic acids suspended in diluents, such as water, saline or PEG 400; (b) capsules, sachets or tablets, each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin; (c) suspensions in an appropriate liquid; and (d) suitable emulsions.
- liquid solutions such as an effective amount of the polypeptides or packaged nucleic acids suspended in diluents, such as water, saline or PEG 400
- capsules, sachets or tablets each containing a predetermined amount of the active ingredient, as liquids, solids, granules or gelatin
- suspensions in an appropriate liquid and (d) suitable emulsions.
- Tablet forms can include one or more of lactose, sucrose, mannitol, sorbitol, calcium phosphates, corn starch, potato starch, tragacanth, microcrystalline cellulose, acacia, gelatin, colloidal silicon dioxide, croscarmellose sodium, talc, magnesium stearate, stearic acid, and other excipients, colorants, fillers, binders, diluents, buffering agents, moistening agents, preservatives, flavoring agents, dyes, disintegrating agents, and pharmaceutically compatible carriers.
- Lozenge forms can comprise the active ingredient in a flavor, usually sucrose and acacia or tragacanth, as well as pastilles comprising the active ingredient in an inert base, such as gelatin and glycerin or sucrose and acacia emulsions, gels, and the like containing, in addition to the active ingredient, carriers known in the art.
- the pharmaceutical compositions can be encapsulated, e.g., in liposomes, or in a formulation that provides for slow release of the active ingredient.
- the antigens can be made into aerosol formulations (e.g., they can be "nebulized") to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like. Aerosol formulations can be delivered orally or nasally.
- Suitable formulations for vaginal or rectal administration include, for example, suppositories, which consist of the polypeptides or packaged nucleic acids with a suppository base.
- Suitable suppository bases include natural or synthetic triglycerides or paraffin hydrocarbons.
- gelatin rectal capsules which consist of a combination of the polypeptides or packaged nucleic acids with a base, including, for example, liquid triglycerides, polyethylene glycols, and paraffin hydrocarbons.
- the S. pneumoniae vaccines and immunogenic compositions described herein may be produced using a variety of techniques.
- a polypeptide may be produced using recombinant DNA technology in a suitable host cell.
- a suitable host cell may be bacterial, yeast, mammalian, or other type of cell.
- the host cell may be modified to express an exogenous copy of one of the relevant polypeptide genes.
- the gene is operably linked to appropriate regulatory sequences such as a strong promoter and a polyadenylation sequence.
- the promoter is inducible or repressible.
- the gene may be present on an extrachromosomal plasmid, or may be integrated into the host genome.
- One of skill in the art will recognize that it is not necessary to use a nucleic acid 100% identical to the naturally-occurring sequence. Rather, some alterations to these sequences are tolerated and may be desirable.
- the nucleic acid may be altered to take advantage of the degeneracy of the genetic code such that the encoded polypeptide remains the same.
- the gene is codon- optimized to improve expression in a particular host.
- the nucleic acid may be produced, for example, by PCR or by chemical synthesis.
- a polypeptide may be isolated from it.
- the isolation may be accomplished, for example, by affinity purification techniques or by physical separation techniques (e.g., a size column).
- a method of manufacture comprising mixing one or more polypeptides or an immunogenic fragment or variant thereof with a carrier and/or an adjuvant.
- antigens for inclusion the vaccine formulations and immunogenic compositions may be produced in cell culture.
- One method comprises providing one or more expression vectors and cloning nucleotides encoding one or more polypeptides selected from polypeptides having an amino acid sequence of Table 1, 2 or 3, such as SEQ ID NO: 47-54, then expressing and isolating the polypeptides.
- compositions that express the polypeptides can be packaged in packs, dispenser devices, and kits for administering nucleic acid compositions to a mammal.
- packs or dispenser devices that contain one or more unit dosage forms are provided.
- instructions for administration of the compounds will be provided with the packaging, along with a suitable indication on the label that the compound is suitable for treatment of an indicated condition, such as those disclosed herein.
- SP2108 polypeptide SEQ ID NO: 6
- SP0148 polypeptide SEQ ID NO: 6
- results of the IL-17 immunogenicity assay are shown in FIGS. 1 and 2, where the left panels show data in scatter format, and the right panels show data as averages with standard deviations.
- the subjects were allowed to rest an additional 2 weeks, at which time they were challenged with intranasal administration of live, encapsulated S. pneumoniae.
- the subjects were sacrificed a week later, and the number of colony-forming units (CFU) was counted from nasal washes. Results of the colonization assay are shown in FIG. 3.
- Vaccine compositions comprised the polypeptides SP0148 (SEQ ID NO: 2), SP0314 (SEQ ID NO: 26), SP0882 (SEQ ID NO: 17) or SP2108 (SEQ ID NO: 6), and cholera toxin adjuvant (CT).
- CT cholera toxin adjuvant
- SP1912, SP2108 and SP0148 polypeptides IL-17A immunogenicity assay
- polypeptides SP1912 SEQ ID NO: 9
- SP2108 SEQ ID NO: 6
- SP0148 (SEQ ID NO: 2) were formulated as vaccine compositions with cholera toxin adjuvant (CT).
- CT cholera toxin adjuvant
- the vaccine compositions were administered to mice two times, one week apart.
- the positive control was killed, unencapsulated whole cell S. pneumoniae + CT (WCB), and the negative controls were CT alone or recombinant proteins without CT (with the exception of SP1912).
- peripheral blood was collected from the retroorbital sinus and evaluated in a whole blood assay. Briefly, the heparizined whole blood was diluted in media and then cultured in duplicate with A) the protein of immunization, or B) the whole cell vaccine for six days. The supernatants were harvested and IL-17A levels measured by ELISA. Results of the IL-17A immunogenicity assay are shown in FIG. 5. Each symbol in the graph represents responses from individual mice, and the line indicates the median response of the group.
- SP1912, SP2108 and SP0148 polypeptides colonization assay
- SP1912 polypeptide aspiration challenge (sepsis assay)
- Polypeptide SP1912 was evaluated for its ability to protect mice from sepsis.
- mice Groups of ten mice were subcutaneously immunized three times, two weeks apart with vaccine compositions comprising either the SP1912 polypeptide (SEQ ID NO: 9) or pneumolysoid (PdT) adsorbed to alum.
- the positive control was killed, unencapsulated whole cell S. pneumoniae + alum (WCB), and the negative control was alum alone.
- WB unencapsulated whole cell S. pneumoniae + alum
- the negative control was alum alone.
- blood was collected for evaluation of IL-17A response and antibody levels, and then one week later, the mice underwent aspiration challenge with 10 7 live strain 0603 (type 6B) 5 * . pneumoniae. Animals were monitored for survival for eight days. Results of the aspiration challenge are shown in FIG. 7 as survival curves for each immunized group.
- Pneumolysoid PdT, SP0148 and SP0641N polypeptides aspiration challenge (sepsis assay)
- Polypeptide SP0148 was evaluated for its ability to protect mice from sepsis when immunized singly or in combination with SP0641N and/or pneumolysoid (PdT).
- mice were subcutaneously immunized three times, two weeks apart with vaccine compositions comprising polypeptide SP0148 (SEQ ID NO: 2), singly or in combination with polypeptide SP0641N (SEQ ID NO: 13) and/or PdT, adsorbed to alum.
- the positive control was killed, unencapsulated whole cell S. pneumoniae + alum (WCB), and the negative control was alum alone.
- WB unencapsulated whole cell S. pneumoniae + alum
- the negative control was alum alone.
- blood was collected for evaluation of IL- 17 and antibody, and then one week later, the mice underwent aspiration challenge with 10 7 live strain 0603 (type 6B) S. pneumoniae. Animals were monitored for survival for eight days. The data are shown in FIG. 8 as survival curves for each immunized group.
- SP1912, SP2108 and SP0148 polypeptides colonization assay
- Example 4 Additional studies were performed essentially as described in Example 4, for a total of four separate studies. Briefly, animals were immunized with vaccine formulations comprising the polypeptides SP 1912 (SEQ ID NO: 9), SP2108 (SEQ ID NO: 6), SP0148 (SEQ ID NO: 2), or additionally SP2108 plus SP0148, and cholera toxin adjuvant (CT) as described in Example 3. Control animals were immunized with killed, unencapsulated whole cell S. pneumoniae plus CT (WCV), or CT alone. Immunized animals were challenged intranasally with 10 7 live type 6B 5 * . pneumoniae four weeks after the last immunization.
- vaccine formulations comprising the polypeptides SP 1912 (SEQ ID NO: 9), SP2108 (SEQ ID NO: 6), SP0148 (SEQ ID NO: 2), or additionally SP2108 plus SP0148, and cholera toxin adjuvant (CT) as described in Example 3. Control animals were immunized with killed, unencapsulated whole
- SP1912 and SP0148 polypeptides IL-17A immunogenicity assay
- mice Groups of ten mice were subcutaneously immunized twice, two weeks apart with vaccine compositions comprising either SP 1912 polypeptide (SEQ ID NO: 9), SP0148 polypeptide (SEQ ID NO: 2), or both adsorbed to alum. Control animals were immunized with alum alone.
- heparinized blood was collected by cardiac puncture and evaluated for IL-17A levels in a whole blood assay. Briefly, the heparizined whole blood was diluted in media and then cultured for six days with the protein(s) of immunization. The supernatants were harvested and IL-17A levels measured by ELISA. Results of the IL-17A immunogenicity assay are shown in FIG. 10. Each symbol in the graph represents responses from individual mice, and the line indicates the median response of the group.
- CFU colony forming units of bacteria
- SP1912, SP0148, and SP2108 polypeptides colonization assay
- mice were subcutaneous ly immunized three times, two weeks apart with vaccine formulations comprising the polypeptides SP0148 (SEQ ID NO: 2) and SP0148 plus SP1912 (SEQ ID NO: 9), or additionally with SP2108 (SEQ ID NO: 6), SP2108 plus SP0148, and SP2108 plus SP 1912, adsorbed to alum.
- Control animals were immunized with killed, unencapsulated whole cell S. pneumoniae plus alum (WCV), or alum alone. Immunized animals were challenged intranasally with 10 7 live type 6B 5 * . pneumoniae four weeks after the last immunization.
- Pneumolysoid L460D PspA derivative CD2, SP1912, SP0148, and SP2108 polypeptides: colonization assay
- PspA, SP0148 and SP2108 passive antibody transfer and aspiration challenge (sepsis assay)
- mice were injected with monoclonal antibodies specific for
- FIG. 15 shows the percent of animals protected from sepsis in six separate aspiration challenge studies, two of which are described in more detail in Examples 6 and 12.
- SP0148, SP2108, and SP1912 fusion proteins IL-17A immunogenicity assay
- mice were subcutaneously immunized three times, two weeks apart with vaccine compositions comprising the fusion proteins SP2108/0148/1912 (SEQ ID NO: 53), SP0148/2108 (SEQ ID NO: 48), SP0148/1912 (SEQ ID NO: 50) or the comparable combinations of the single antigens SP2108 (SEQ ID NO: 6), SP0148 (SEQ ID NO: 2) and SP1912 (SEQ ID NO: 9), adsorbed to alum. Control animals were immunized with alum alone. Two weeks after the last immunization, peripheral blood was collected from the retroorbital sinus and evaluated for IL-17A levels in a whole blood assay.
- vaccine compositions comprising the fusion proteins SP2108/0148/1912 (SEQ ID NO: 53), SP0148/2108 (SEQ ID NO: 48), SP0148/1912 (SEQ ID NO: 50) or the comparable combinations of the single antigens SP2108 (SEQ ID NO: 6), SP0148 (SEQ ID NO: 2) and SP
- SP0148, SP2108, and SP1912 fusion proteins IL-17A immunogenicity assay
- mice Groups of four to eight mice were subcutaneously immunized three times, two weeks apart, with vaccine compositions comprising the fusion proteins SP0148/1912/2108 (SEQ ID NO: 52) or SP2108/1912 (SEQ ID NO: 49), adsorbed to alum.
- Control animals were immunized with alum alone.
- peripheral blood was collected from the retroorbital sinus and evaluated for IL-17A levels in a whole blood assay. Briefly, the heparizined whole blood was diluted in media and then cultured for six days with the protein of immunization, a control protein, or media alone. The cell-free supernatants were harvested and IL-17A concentrations measured by ELISA. Results of the IL-17A immunogenicity assay are shown in FIG. 17, Panels A and B. Each symbol represents the IL-17A response of an individual mouse, and the line indicates the median response of the group.
- Example 15 Example 15
- Spleens were collected at the same time as peripheral blood from mice, shown in Example 14, that were immunized with the vaccine composition comprising fusion protein SP2108/1912 (SEQ ID NO: 49), or alum alone.
- Single cell suspensions were prepared from the spleens. Erythrocytes were lysed, and splenocytes were plated onto ELISpot plates coated with anti-IL-17A capture antibody at 200-800 cells per well and stimulated with overlapping peptides (OLP) spanning SP2108 or SP1912, killed unencapsulated whole-cell S. pneumoniae (WCA), or media alone.
- OLP overlapping peptides
- mice were subcutaneously immunized three times, two weeks apart, with vaccine compositions comprising 30, 100, or 300 pmol of the fusion proteins SP0148/1912/2108 (SEQ ID NO: 52), SP0148/2108/1912 (SEQ ID NO: 54),
- SP2108/0148/1912 SEQ ID NO: 53
- SP0148/1912 SEQ ID NO: 50
- SP2108/1912 SEQ ID NO: 49
- indicated admixtures of SP0148 SEQ ID NO: 2
- SP2108 SEQ ID NO: 6
- SP 1912 SEQ ID NO: 9
- the heparizined whole blood was diluted in media and then cultured for six days with overlapping peptides (OLP) spanning SP0148, SP1912 or SP2108, killed unencapsulated whole-cell 5". pneumoniae (WCA), or media alone.
- OHP overlapping peptides
- WCA killed unencapsulated whole-cell 5". pneumoniae
- the cell-free supernatants were harvested and IL-17A concentrations measured by ELISA. Results of the IL-17A dose response assays are shown in FIG. 19, Panels A and B. Each bar represents the mean specific IL-17A response of a group of mice with the media- induced (non-specific) background subtracted.
- SP0148, SP2108, SP1912, and fusion proteins IL-17A immunogenicity assay
- Groups of ten mice were subcutaneously immunized three times, two weeks apart, with vaccine compositions comprising the fusion proteins SP2108/1912 (SEQ ID NO: 49) or SP0148/1912/2108 (SEQ ID NO: 52), or indicated admixtures of SP0148 (SEQ ID NO: 2), SP2108 (SEQ ID NO: 6), and SP1912 (SEQ ID NO: 9), adsorbed to alum.
- Control animals were immunized with alum alone.
- peripheral blood was collected from the retroorbital sinus and evaluated for IL-17A levels in a whole blood assay.
- heparizined whole blood was diluted in media and then cultured for six days with killed unencapsulated whole-cell S. pneumoniae (WCA).
- WCA killed unencapsulated whole-cell S. pneumoniae
- the cell- free supernatants were harvested and IL-17A levels measured by ELISA.
- Results of the IL- 17A immunogenicity assay are shown in FIG. 20. Each symbol represents the IL-17A response of an individual mouse, and the line indicates the median response of the group.
- SP0148, SP2108, and SP1912 fusion proteins intranasal challenge and colonization assay
- SP0148, SP2108, and SP1912 fusion proteins aspiration challenge and sepsis assay
- Groups of ten mice are subcutaneously immunized three times, two weeks apart with vaccine compositions comprising the fusion proteins SP2108/0148 (SEQ ID NO: 47), SP0148/2108 (SEQ ID NO: 48), SP2108/1912 (SEQ ID NO: 49), SP0148/1912 (SEQ ID NO: 50), SP2108/1912/0148 (SEQ ID NO: 51), SP0148/1912/2108 (SEQ ID NO: 52), SP2108/0148/1912 (SEQ ID NO: 53), or SP0148/2108/1912 (SEQ ID NO: 54), adsorbed to alum.
- Control animals are immunized with killed, unencapsulated whole cell S. pneumoniae plus alum (WCV), or alum alone.
- WV whole cell S. pneumoniae plus alum
- alum alone.
- blood is collected for evaluation of IL-17A and antibody, and then one week later, the mice undergo aspiration challenge with 10 7 live strain WU-2 (serotype 3) 5. pneumoniae. Animals are monitored for survival for eight days. Results are reported as survival curves for each immunized group.
- Fusion protein SP2108/1912 plus B cell antigens IL-17A immunogenicity assay
- mice were subcutaneously immunized three times, two weeks apart with vaccine compositions comprising the fusion protein SP2108/1912 (SEQ ID NO: 49) plus either the B cell antigens YLN and H70 (SEQ ID NO: 33), or the B cell antigen PRN-L460D, adsorbed to alum. Control animals were immunized with killed,
- Fusion protein SP2108/1912 plus B cell antigens intranasal challenge followed by colonization assay
- mice were subcutaneously immunized three times, two weeks apart with vaccine compositions comprising killed, unencapsulated whole cell S. pneumoniae (WCB), fusion protein SP2108/1912 (SEQ ID NO: 49) plus either the B cell antigens YLN and H70 (SEQ ID NO: 33), or the B cell antigen PRN-L460D, adsorbed to alum.
- WB unencapsulated whole cell S. pneumoniae
- fusion protein SP2108/1912 SEQ ID NO: 49
- B cell antigens YLN and H70 SEQ ID NO: 33
- B cell antigen PRN-L460D B cell antigen PRN-L460D
- Results of the colonization assays are shown in FIG. 23, Panels A and B (duplicate experiments), as colony forming units of bacteria (CFU) per nasal wash. Each symbol represents the colonization density from an individual mouse, and the horizontal line represents the median of the group.
- Fusion protein SP2108/1912 plus B cell antigens intravenous challenge followed by sepsis assay
- mice were subcutaneously immunized three times, two weeks apart with vaccine compositions comprising B cell antigens YLN plus H70 (SEQ ID NO: 33), fusion protein SP2108/1912 (SEQ ID NO: 49) plus B cell antigens YLN and H70 (SEQ ID NO: 33), or fusion protein SP2108/1912 (SEQ ID NO: 49) plus B cell antigen PRN- L460D, adsorbed to alum.
- Control animals were immunized with alum alone.
- Immunized animals with injected intravenously with 3.6 x 10 6 live strain DBL6A 5 * . pneumoniae three weeks after last immunization. Animals were monitored for survival for twenty-one days. Results are shown in FIG. 24, Panels A and B (duplicate experiments), as hours elapsed until each mouse reaches a moribund state or death. Each symbol represents the response of an individual mouse, and the line indicates the median response of the group.
- SP0148 including signal sequence (277 amino acids with N-terminal E) MKKIVKYSSLAALALVAAGVLAACSGGAKKEGEAASKKEI IVATNGSPKPFIYEENGELTGYEIEVVRAIFKDSD KYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSSIKSLDDIGGKSTEV VQATTSAKQLEAYNAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPSDQQ PYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAEADIKE
- Immunogenic PspA/PspC polypeptides including the coiled-coil structure (PR + NPB)
- NPB Non-proline Block
- NPB Non-proline Block
- NPB Non-proline Block
- SP0148 including signal sequence (nucleotides)
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Molecular Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Pulmonology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (5)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP13738798.1A EP2804627B1 (en) | 2012-01-20 | 2013-01-18 | Fused antigen vaccines and compositions against streptococcus pneumoniae |
| CA2897020A CA2897020A1 (en) | 2012-01-20 | 2013-01-18 | Fused antigen vaccines and compositions against streptococcus pneumoniae |
| AU2013209513A AU2013209513B2 (en) | 2012-01-20 | 2013-01-18 | Fused antigen vaccines and compositions against Streptococcus pneumoniae |
| JP2014553490A JP6379041B2 (ja) | 2012-01-20 | 2013-01-18 | ストレプトコッカス・ニューモニエ(Streptococcuspneumoniae)に対する融合抗原ワクチンおよび組成物 |
| US14/373,179 US9765125B2 (en) | 2012-01-20 | 2013-01-18 | Fused antigen vaccines and compositions against Streptococcus pneumoniae |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201261589267P | 2012-01-20 | 2012-01-20 | |
| US61/589,267 | 2012-01-20 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2013109995A2 true WO2013109995A2 (en) | 2013-07-25 |
| WO2013109995A9 WO2013109995A9 (en) | 2014-09-12 |
| WO2013109995A3 WO2013109995A3 (en) | 2015-02-05 |
Family
ID=48799816
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2013/022309 Ceased WO2013109995A2 (en) | 2012-01-20 | 2013-01-18 | Fused antigen vaccines and compositions against streptococcus pneumoniae |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US9765125B2 (https=) |
| EP (1) | EP2804627B1 (https=) |
| JP (2) | JP6379041B2 (https=) |
| AU (1) | AU2013209513B2 (https=) |
| CA (1) | CA2897020A1 (https=) |
| WO (1) | WO2013109995A2 (https=) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106822885A (zh) * | 2017-02-16 | 2017-06-13 | 清华大学 | 肺炎链球菌疫苗 |
| EP4272750A2 (en) | 2013-02-07 | 2023-11-08 | Children's Medical Center, Corp. | Protein antigens that provide protection against pneumococcal colonization and/or disease |
| WO2025012364A1 (en) * | 2023-07-12 | 2025-01-16 | Virometix Ag | Compositions of pneumococcal antigens |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN108884134A (zh) * | 2015-12-10 | 2018-11-23 | 加拿大全国研究委员会 | 脂化肺炎链球菌抗原组合物、制备方法和用途 |
| US10738338B2 (en) | 2016-10-18 | 2020-08-11 | The Research Foundation for the State University | Method and composition for biocatalytic protein-oligonucleotide conjugation and protein-oligonucleotide conjugate |
| ES3016535T3 (en) * | 2018-11-23 | 2025-05-09 | Strike Pharma Ab | Bi-specific conjugates |
Citations (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5371197A (en) | 1991-09-24 | 1994-12-06 | Merck & Co., Inc. | Protein-dimeric polysaccharide conjugate vaccine |
| US5623057A (en) | 1991-01-28 | 1997-04-22 | Merck & Co., Inc. | Pneumococcal polysaccharide conjugate vaccine |
| US5643576A (en) | 1994-05-27 | 1997-07-01 | The University Of North Carolina At Chapel Hill | Method of inducing an immune response with a live Venezuelan Equine Encephalitis virus expressing a heterologous immunogen |
| US6248558B1 (en) | 1998-03-31 | 2001-06-19 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
| US6783939B2 (en) | 2000-07-07 | 2004-08-31 | Alphavax, Inc. | Alphavirus vectors and virosomes with modified HIV genes for use in vaccines |
| US20050020813A1 (en) | 2001-03-27 | 2005-01-27 | Vega Masignani | Streptococcus pneumoniae proteins and nucleic acids |
| EP1572868A2 (en) | 2001-04-16 | 2005-09-14 | Wyeth Holdings Corporation | Novel streptococcus pneumoniae open reading frames encoding polypeptide antigens and uses thereof |
| EP1855717A1 (en) | 2005-02-11 | 2007-11-21 | Ace Biosciences A/S | Surface-located streptococcus pneumoniae polypeptides |
| US7378514B2 (en) | 1997-07-02 | 2008-05-27 | sanofi pasteur limited/sanofi pasteur limitée | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US7504110B2 (en) | 2002-04-02 | 2009-03-17 | Ben-Gurion University Of The Negev Research And Development Authority | Protein-based Streptococcus pneumoniae vaccines |
| US20090285846A1 (en) | 2007-04-13 | 2009-11-19 | Tweten Rodney K | Mutants of cholesterol-dependent cytolysins and uses thereof |
| WO2011008548A1 (en) | 2009-06-29 | 2011-01-20 | Genocea Biosciences, Inc. | Vaccines and compositions against streptococcus pneumoniae |
| WO2012134975A1 (en) | 2011-03-28 | 2012-10-04 | St. Jude Children's Research Hospital | Methods and compositions employing immunogenic fusion proteins |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PT2054431E (pt) | 2006-06-09 | 2011-11-03 | Novartis Ag | Confórmeros de adesinas bacterianas |
| WO2012100233A1 (en) * | 2011-01-20 | 2012-07-26 | Genocea Biosciences, Inc. | Vaccines and compositions against streptococcus pneumoniae |
| WO2013134656A1 (en) * | 2012-03-09 | 2013-09-12 | Genocea Biosciences, Inc. | Induction of th17 immune response |
-
2013
- 2013-01-18 CA CA2897020A patent/CA2897020A1/en not_active Abandoned
- 2013-01-18 EP EP13738798.1A patent/EP2804627B1/en active Active
- 2013-01-18 JP JP2014553490A patent/JP6379041B2/ja not_active Expired - Fee Related
- 2013-01-18 WO PCT/US2013/022309 patent/WO2013109995A2/en not_active Ceased
- 2013-01-18 US US14/373,179 patent/US9765125B2/en not_active Expired - Fee Related
- 2013-01-18 AU AU2013209513A patent/AU2013209513B2/en not_active Ceased
-
2017
- 2017-05-01 JP JP2017091198A patent/JP2017160238A/ja active Pending
Patent Citations (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5623057A (en) | 1991-01-28 | 1997-04-22 | Merck & Co., Inc. | Pneumococcal polysaccharide conjugate vaccine |
| US5371197A (en) | 1991-09-24 | 1994-12-06 | Merck & Co., Inc. | Protein-dimeric polysaccharide conjugate vaccine |
| US5643576A (en) | 1994-05-27 | 1997-07-01 | The University Of North Carolina At Chapel Hill | Method of inducing an immune response with a live Venezuelan Equine Encephalitis virus expressing a heterologous immunogen |
| US7378514B2 (en) | 1997-07-02 | 2008-05-27 | sanofi pasteur limited/sanofi pasteur limitée | Nucleic acid and amino acid sequences relating to Streptococcus pneumoniae for diagnostics and therapeutics |
| US6248558B1 (en) | 1998-03-31 | 2001-06-19 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
| US6432680B1 (en) | 1998-03-31 | 2002-08-13 | Vanderbilt University | Sequence and method for genetic engineering of proteins with cell membrane translocating activity |
| US6783939B2 (en) | 2000-07-07 | 2004-08-31 | Alphavax, Inc. | Alphavirus vectors and virosomes with modified HIV genes for use in vaccines |
| US20050020813A1 (en) | 2001-03-27 | 2005-01-27 | Vega Masignani | Streptococcus pneumoniae proteins and nucleic acids |
| EP1572868A2 (en) | 2001-04-16 | 2005-09-14 | Wyeth Holdings Corporation | Novel streptococcus pneumoniae open reading frames encoding polypeptide antigens and uses thereof |
| US7504110B2 (en) | 2002-04-02 | 2009-03-17 | Ben-Gurion University Of The Negev Research And Development Authority | Protein-based Streptococcus pneumoniae vaccines |
| EP1855717A1 (en) | 2005-02-11 | 2007-11-21 | Ace Biosciences A/S | Surface-located streptococcus pneumoniae polypeptides |
| US20090285846A1 (en) | 2007-04-13 | 2009-11-19 | Tweten Rodney K | Mutants of cholesterol-dependent cytolysins and uses thereof |
| WO2011008548A1 (en) | 2009-06-29 | 2011-01-20 | Genocea Biosciences, Inc. | Vaccines and compositions against streptococcus pneumoniae |
| WO2012134975A1 (en) | 2011-03-28 | 2012-10-04 | St. Jude Children's Research Hospital | Methods and compositions employing immunogenic fusion proteins |
Non-Patent Citations (30)
| Title |
|---|
| "Mucosal adjuvanticity and immunogenicity of LTR72, a novel mutant of Escherichia coli heat-labile enterotoxin with partial knockout of ADP-ribosyltransferase activity", J EXP MED., vol. 187, no. 7, 6 April 1998 (1998-04-06), pages 1123 - 32 |
| AD OGUNNIYI ET AL.: "Protection against Streptococcus pneumoniae elicited by immunization with pneumolysin and CbpA", INFECT IMMUN, vol. 69, no. 10, October 2001 (2001-10-01), pages 5997 - 6003, XP002407391, DOI: doi:10.1128/IAI.69.10.5997-6003.2001 |
| AUSUBEL, F. M. ET AL.: "Current Protocols in Molecular Biology", 1995, JOHN WILEY & SONS |
| BASSFORD, P.J.: "Use of gene fusion to study secretion of maltose-binding protein into Escherichia coli periplasm", J BACTERIOL., vol. 139, no. 1, July 1979 (1979-07-01), pages 19 - 31 |
| BERRY, A.M. ET AL., INFECTION AND IMMUNITY, vol. 63, 1995, pages 1969 - 74 |
| COLIGAN, J. E. ET AL.: "Current Protocols in Protein Science", JOHN WILEY & SONS, INC. |
| CULLEN, P.A. ET AL.: "Construction and evaluation of a plasmid vector for the expression of recombinant lipoproteins in Escherichia coli", PLASMID, vol. 49, no. l, January 2003 (2003-01-01), pages 18 - 29 |
| DANIELS, C.C. ET AL., INFECTION AND IMMUNITY, vol. 78, 2010, pages 2163 - 72 |
| DAVIS ET AL.: "Basic Methods in Molecular Biology", 1986, ELSEVIR SCIENCES PUBLISHING,, INC. |
| DOUCE ET AL.: "Genetically detoxified mutants of heat-labile toxin from Escherichia coli are able to act as oral adjuvants", INFECT IMMUN, vol. 67, no. 9, September 1999 (1999-09-01), pages 4400 - 6 |
| DOUCE ET AL.: "Mutants of Escherichia coli heat-labile toxin lacking ADP-ribosyltransferase activity act as nontoxic, mucosal adjuvants", PNAS, vol. 92, February 1995 (1995-02-01), pages 1644 - 1648, XP002918833, DOI: doi:10.1073/pnas.92.5.1644 |
| DRACOPOLI, N.C. ET AL.: "Current Protocols in Human Genetics", JOHN WILEY & SONS, INC. |
| EMR, S.D. ET AL.: "Mutations altering the cellular localization of the phage lambda receptor, an Escherichia coli outer membrane protein", PROC NATL ACAD SCI USA., vol. 75, no. 12, pages 5802 - 6 |
| EVANS JT ET AL.: "Enhancement of antigen-specific immunity via the TLR-4 ligands MPL adjuvant and Ribi.529", EXPERT REV VACCINES, vol. 2, no. 2, April 2003 (2003-04-01), pages 219 - 29 |
| FERREIRA ET AL.: "DNA vaccines based on genetically detoxified derivatives of pneumolysin fail to protect mice against challenge with Streptococcus pneumoniae", FEMS IMMUNOL MED MICROBIOL, vol. 46, 2006, pages 291 - 297 |
| GOLDSTEIN, B. ET AL.: "International pediatric sepsis consensus conference: definitions for sepsis and organ dysfunction in pediatrics", PEDIATR CRIT CARE MED., vol. 6, no. 1, January 2005 (2005-01-01), pages 2 - 8 |
| HAMES ET AL.: "Nucleic Acid Hybridization", 1985, IL PRESS |
| ISHIZAKA ST ET AL.: "E6020: a synthetic Toll-like receptor 4 agonist as a vaccine adjuvant", EXPERT REV. VACCINES, vol. 6, no. 5, October 2007 (2007-10-01), pages 773 - 84, XP008101056, DOI: doi:10.1586/14760584.6.5.773 |
| JACOBS MR: "Drug-resistant Streptococcus pneumoniae: rational antibiotic choices", AM J MED, vol. 106, no. 5A, 3 May 1999 (1999-05-03), pages 19S - 25S |
| LEGRAIN, M. ET AL.: "Production of lipidated meningococcal transferrin binding protein 2 in Escherichia coli", PROTEIN EXPR PURIF, vol. 6, no. 5, October 1995 (1995-10-01), pages 570 - 8, XP002615466, DOI: doi:10.1006/prep.1995.1075 |
| LIN, J.J. ET AL.: "An Escherichia coli mutant with an amino acid alteration within the signal sequence of outer membrane prolipoprotein", PROC NATL ACAD SCI USA., vol. 75, no. 10, October 1978 (1978-10-01), pages 4891 - 5 |
| LU ET AL.: "Interleukin-17A mediates acquired immunity to pneumococcal colonization", PLOS PATHOG, vol. 4, no. 9, 19 September 2008 (2008-09-19), XP055189295, DOI: doi:10.1371/journal.ppat.1000159 |
| LU ET AL.: "Protection against Pneumococcal colonization and fatal pneumonia by a trivalent conjugate of a fusion protein with the cell wall polysaccharide", INFECT IMMUN, vol. 77, no. 5, May 2009 (2009-05-01), pages 2076 - 83, XP002691754, DOI: doi:10.1128/IAI.01554-08 |
| PATON J.C. ET AL.: "Purification and immunogenicity of genetically obtained pneumolysin toxoids and their conjugation to Streptococcus pneumoniae type 19F polysaccharide", INFECT IMMUN, vol. 59, no. 7, July 1991 (1991-07-01), pages 2297 - 304, XP002357595 |
| SAMBROOK, J. ET AL.: "Molecular Cloning, a Laboratory Manual", 1989, COLD HARBOR LABORATORY PRESS |
| SAUNDERS F.K. ET AL.: "Pneumolysin, the thiol-activated toxin of Streptococcus pneumoniae, does not require a thiol group for in vitro activity", INFECT IMMUN, vol. 57, no. 8, August 1989 (1989-08-01), pages 2547 - 52 |
| See also references of EP2804627A4 |
| SINGH ET AL., CURR. HIV RES., vol. 1, 2003, pages 309 - 20 |
| WILLIAMS ET AL.: "Innate Imprinting by the Modified Heat-Labile Toxin of Escherichia coli (LTK63) Provides Generic Protection against Lung Infectious Disease", THE JOURNAL OF IMMUNOLOGY, vol. 173, 2004, pages 7435 - 7443, XP002426599 |
| WU ET AL., CANCER RES, vol. 65, no. 11, 2005, pages 4947 - 4954 |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4272750A2 (en) | 2013-02-07 | 2023-11-08 | Children's Medical Center, Corp. | Protein antigens that provide protection against pneumococcal colonization and/or disease |
| CN106822885A (zh) * | 2017-02-16 | 2017-06-13 | 清华大学 | 肺炎链球菌疫苗 |
| CN106822885B (zh) * | 2017-02-16 | 2020-06-30 | 清华大学 | 肺炎链球菌疫苗 |
| WO2025012364A1 (en) * | 2023-07-12 | 2025-01-16 | Virometix Ag | Compositions of pneumococcal antigens |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2013209513B2 (en) | 2017-10-05 |
| JP6379041B2 (ja) | 2018-08-22 |
| EP2804627A2 (en) | 2014-11-26 |
| US9765125B2 (en) | 2017-09-19 |
| CA2897020A1 (en) | 2013-07-25 |
| JP2017160238A (ja) | 2017-09-14 |
| EP2804627B1 (en) | 2019-08-14 |
| WO2013109995A9 (en) | 2014-09-12 |
| WO2013109995A3 (en) | 2015-02-05 |
| AU2013209513A1 (en) | 2014-07-24 |
| JP2015513314A (ja) | 2015-05-07 |
| EP2804627A4 (en) | 2015-12-30 |
| US20150056239A1 (en) | 2015-02-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11207375B2 (en) | Vaccines and compositions against Streptococcus pneumoniae | |
| US10188717B2 (en) | Vaccines and compositions against Streptococcus pneumoniae | |
| WO2014018904A1 (en) | Fused antigen vaccines and compositions against streptococcus pneumoniae | |
| US9765125B2 (en) | Fused antigen vaccines and compositions against Streptococcus pneumoniae | |
| US20150079132A1 (en) | Evoking protection against streptotoccus pneumoniae incorporating b-cell and t-cell pneumococcal protein antigens and pneumococcal polysaccharides delivered concomitantly | |
| HK1192166A (en) | Vaccines and compositions against streptococcus pneumoniae | |
| NZ614460B2 (en) | Vaccines and compositions against streptococcus pneumoniae | |
| HK1172254A (en) | Vaccines and compositions against streptococcus pneumoniae |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 13738798 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 14373179 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2014553490 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2013209513 Country of ref document: AU Date of ref document: 20130118 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2013738798 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2897020 Country of ref document: CA |