WO2012106469A2 - Methods for treating infections by targeting microbial h2s-producing enzymes - Google Patents
Methods for treating infections by targeting microbial h2s-producing enzymes Download PDFInfo
- Publication number
- WO2012106469A2 WO2012106469A2 PCT/US2012/023542 US2012023542W WO2012106469A2 WO 2012106469 A2 WO2012106469 A2 WO 2012106469A2 US 2012023542 W US2012023542 W US 2012023542W WO 2012106469 A2 WO2012106469 A2 WO 2012106469A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- inhibitor
- endogenous
- production
- microbial
- scavenger
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/13—Amines
- A61K31/133—Amines having hydroxy groups, e.g. sphingosine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/185—Acids; Anhydrides, halides or salts thereof, e.g. sulfur acids, imidic, hydrazonic or hydroximic acids
- A61K31/19—Carboxylic acids, e.g. valproic acid
- A61K31/195—Carboxylic acids, e.g. valproic acid having an amino group
- A61K31/197—Carboxylic acids, e.g. valproic acid having an amino group the amino and the carboxyl groups being attached to the same acyclic carbon chain, e.g. gamma-aminobutyric acid [GABA], beta-alanine, epsilon-aminocaproic acid or pantothenic acid
- A61K31/198—Alpha-amino acids, e.g. alanine or edetic acid [EDTA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/275—Nitriles; Isonitriles
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the invention relates to materials and methods for treating infections, and more particularly to materials and methods for reducing endogenous microbial H 2 S levels.
- H 2 S is a toxic gas that has been associated with beneficial functions in mammals, including vasorelaxation, cardioprotection, neurotransmission, and antiinflammatory action in the gastrointestinal (GI) tract (1-5).
- GI gastrointestinal
- H 2 S to Attorney Docket No. 27522-0196W01 function as a signaling molecule parallels the action of another established gasotransmitter, nitric oxide (NO) (6-8). Endogenous NO was demonstrated to protect certain Gram(+) bacteria against antibiotics and oxidative stress (10-12).
- H 2 S is produced enzymatically in various tissues (1, 4).
- Three H 2 S- generating enzymes have been characterized in mammals: cystathionine ⁇ -synthase (CBS), cystathionine ⁇ -lyase (CSE) and 3-mercaptopyruvate sulfurtransferase (3MST).
- CBS and CSE produce H 2 S predominantly from L-cysteine (Cys).
- 3MST does so via the intermediate synthesis of 3-mercaptopyruvate by cysteine aminotranferase (CAT), which is inhibited by aspartate (Asp) competition for Cys on CAT (9) (Fig. 1 A).
- bacteria-derived H 2 S has been known for centuries, but has been considered to be merely a byproduct of sulfur metabolism with no particular physiological function in non-sulfur microorganisms (it is used as energy source in purple and green sulfur bacteria). Further, little is known about the metabolic pathways involving H 2 S in mesophilic bacteria. Analysis of bacterial genomes, however, revealed that most, if not all, possess orthologs of mammalian CBS, CSE, or 3MST (Figs. 1A and 2A-C), suggesting an important cellular function(s) that preserved these genes throughout bacterial evolution.
- the present invention addresses these and other needs by providing methods and compositions for treating infections and enhancing effectiveness of antibiotics by reducing endogenous microbial H 2 S levels.
- the invention provides a method for treating a subject having a microbial infection, said method comprising administering to said subject a therapeutically effective amount of at least one inhibitor of endogenous H 2 S production by an organism causing the microbial infection.
- the method further comprises administering a second antimicrobial compound (e.g., a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a Attorney Docket No. 27522-0196W01 cephalosporin, a lactam, or any combination thereof).
- a second antimicrobial compound e.g., a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a Attorney Docket No. 27522-0196W01 cephalosporin, a lactam, or any combination thereof.
- the second antimicrobial compound is selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, josamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7- diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam, carbenicillin, and any combination thereof.
- the second antimicrobial compound is selected from the compounds disclosed in Tables 1 and 2 (below) and any combination thereof.
- the inhibitor of endogenous H 2 S production and the second antimicrobial compound can be administered simultaneously (within the same composition or in different compositions) or sequentially (with either the inhibitor of endogenous H 2 S production or the second antimicrobial compound administered first).
- the invention provides a method for enhancing efficacy of an antimicrobial treatment in a subject having a microbial infection, wherein said antimicrobial treatment comprises administering to the subject a first antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo, said method comprising co-administering said first compound with a therapeutically effective amount of a second compound which second compound is an inhibitor of endogenous H 2 S production by an organism causing the microbial infection.
- the first antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo can be without limitation, e.g., a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a cephalosporin, a lactam, or any combination thereof.
- the first antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo is selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, josamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7- Attorney Docket No.
- the first antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo is selected from the compounds disclosed in Tables 1 and 2 (below) and any combination thereof.
- the first antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo and the inhibitor of endogenous H 2 S production can be administered simultaneously (within the same composition or in different compositions) or sequentially.
- the invention provides a method for sensitizing a microbial pathogen to oxidative damage comprising administering to said pathogen an effective amount of at least one inhibitor of endogenous H 2 S production by said pathogen.
- the pathogen is in a subject and the inhibitor of endogenous H 2 S production is administered to the subject.
- the inhibitor of endogenous H 2 S production useful in the methods of the present invention inhibits an H 2 S-generating enzyme within the organism causing the microbial infection.
- the inhibitor of endogenous H 2 S production inhibits microbial cystathionine ⁇ -synthase (CBS) or paralogs thereof.
- CBS microbial cystathionine ⁇ -synthase
- such CBS inhibitor can be coadministered (simultaneously in the same or separate compositions or sequentially) with an inhibitor of microbial cystathionine ⁇ - lyase (CSE) or paralogs thereof.
- the inhibitor of endogenous H 2 S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof. In another embodiment, the inhibitor of endogenous H 2 S production inhibits microbial cystathionine ⁇ -lyase (CSE) or paralogs thereof.
- the inhibitor of endogenous H 2 S production is amino- oxyacetate (AOAA). In another embodiment, the inhibitor of endogenous H 2 S production is hydroxylamine. In yet another embodiment, the inhibitor of endogenous H 2 S production is D,L-propargylglycine (PAG). In a further embodiment, the inhibitor of endogenous H 2 S production is ⁇ -cyano-L-alanine. In another embodiment, the inhibitor of endogenous H 2 S production is aspartate or a Attorney Docket No. 27522-0196 WO 1 derivative thereof. In an additional embodiment, the inhibitor of endogenous H 2 S production is homocysteine.
- AOAA amino- oxyacetate
- the inhibitor of endogenous H 2 S production is hydroxylamine.
- the inhibitor of endogenous H 2 S production is D,L-propargylglycine (PAG).
- PAG D,L-propargylglycine
- the inhibitor of endogenous H 2 S production is ⁇ -cyano-L-a
- the inhibitors of endogenous H 2 S production useful in the methods of the present invention selectively inhibit H 2 S-generating enzyme(s) within the organism causing the microbial infection, but not H 2 S-generating enzyme(s) in the cells of the subject being treated.
- Such selective inhibitors can be identified using various screening methods known in the art, e.g., as described in International Application Publication No. WO 2011/130181.
- bacteria are useful for treating infections caused by various microorganisms, including, e.g., bacteria, fungi and protozoa.
- bacterial genera include, e.g., Bacillus, Brucella, Clostridium, Enterococcus, Escherichia, Francisella, Helicobacter, Klebsiella, Legionella, Listeria, Mycobacterium, Pseudomonas, Salmonella, Shigella, Staphylococcus, Streptococcus, Trypanosoma, Vibrio, and Yersinia.
- bacteria are from a species selected from the group consisting of E. coli, S. aureus, B, anthracis, and P. aeruginosa.
- Non-limiting examples of microbial infectious diseases which can be treated by the methods of the present invention include, e.g., pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis, malaria, trachoma, leishmaniasis, chagas disease, trichomoniasis, lyme disease, and leprosy.
- microbial infectious diseases include, e.g., pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis,
- the methods of the present invention can be used to treat infections in various animals, including, e.g., mammals, birds and fish. In one specific embodiment, the methods of the present invention are used to treat infections in humans.
- the methods of the present invention can further comprise administering an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
- NO microbial endogenous nitric oxide
- Such inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger can be administered simultaneously (within the same composition or in different compositions) or sequentially (in any order) with an inhibitor of endogenous
- Non-limiting examples Attorney Docket No. 27522-0196WO1 of useful inhibitors of endogenous NO production include, e.g., L-arginine, N G - monomethyl-L-arginine, N G-nitro-L-arginine methyl ester, N G -nitro-L-arginine, N G -amino-L-argiqine, N G ,N G-dimethylarginine (asymmetric dimethylarginine), L- thiocitrulline, S-methyl-L-thiocitrulline, diphenyleneiodonium chloride, 2-(4- carboxyphenyl)-4,4,5,5-tetramethylimidazoline-l-oxy 3-oxide, 7-nitroindazole, N(5)- (l-iminoethyl)-L-ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L- citrulline,
- the inhibitor of endogenous NO production is an iNOS-specific inhibitor.
- useful NO scavengers include, e.g., non-heme iron-containing peptides, non-heme iron-containing proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferrioxamine, pyridoxal isonicotinoyl hydrazone, l,2-dimethyl-3hydroxypyrid-4-one, [+] 1, 2-bis (3,5-dioxopiperazine- lyl)propane, and 2-(4-carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl- l-oxy-3-oxide.
- the NO scavenger is a perfluorocarbon e
- the invention provides a pharmaceutical composition comprising (i) an antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo and (ii) an inhibitor of microbial endogenous H2S production.
- this composition further comprises (iii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
- the invention provides a pharmaceutical composition comprising (i) an inhibitor of microbial endogenous H 2 S production and (ii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
- FIG. 1A is a schematic representation of basic metabolic pathways of H 2 S synthesis.
- CBS and CSE generate H 2 S with pyruvate and ammonia directly from Cys.
- 3MST generates H 2 S and pyruvate from 3-mercaptopyruvate (3MP), which is synthesized along with glutamate by CAT from Cys and a-ketoglutarate.
- the orthologs of corresponding mammalian genes are present in the majority of bacterial species whose genomes have been fully sequenced (Fig. 5). Chemicals that specifically inhibit CBS, CSE, and 3MST are indicated.
- a sample of clinically relevant pathogens carrying 3MST or CBS/CSE encoding genes is shown on the right.
- FIG. 2A-C are sample sequence alignments of H 2 S-producing enzymes.
- A 3MST from Homo sapiens (HS; SEQ ID NO: 21 ) and its orthologs from E. coli (EC; SEQ ID NO: 22), Y. pestis C092 (YP; SEQ ID NO: 23), S. typhimurium LT2 (ST; SEQ ID NO: 24), B. suis 23445 (BS; SEQ ID NO: 25), E. pyrifoliae Epl/96 (ER; SEQ ID NO: 26), P. luminescens laumondii TT01(PL; SEQ ID NO: 27), R. palustris CGA009 (RP; SEQ ID NO: 28), N.
- FIG. 3A-B show genome organization of 3MST and CBS/CSE in selected bacteria.
- A Localization of sseA (3MST) orthologs (black arrow block aligned in the middle) in selected genomes of pathogenic bacteria. Genes of same color are Attorney Docket No. 27522-0196WO1 from the same ortholog group. Light grey - no COG assignment; white - pseudo gene.
- B CBS (black arrow block aligned in the middle) and CSE (white arrow block aligned in the middle) orthologs in B. anthacis, S. aureus and P. aeruginosa genomes.
- FIG. 4A-B demonstrate that endogenous H 2 S protects bacteria against antibiotic toxicity.
- H 2 S production by B. anthracis, S. aureus, P. aeruginosa, and E. coli depends on CBS/CSE and 3MST, respectively.
- Lead acetate-soaked paper strips show a PbS brown or black stain as a result of reaction with H 2 S. strips were affixed to the inner wall of a culture tube, above the level of the liquid culture of wt or mutant bacteria, for 18 hours.
- Cysteine is a substrate for bacterial CBS/CSE and 3MST. Addition of Cys (25 mM for E. coli; 200 1 mM for other species) greatly stimulated. H 2 S synthesis in wt, but not in CBS/CSE- or 3MST-deficient strains. ,
- FIG. 4C is a Pb(Ac)2 analysis of individual strains harboring knockouts.
- FIG. 5 shows the results of Phenotype MicroArray.
- the growth curves for E.coli wt are shown in black, for AsseA in white and overlay in black. Data are shown as the means from two experiments.
- the relative values of growth inhibition (negative numbers) are presented in Table 1.
- FIG. 6 shows growth of wt and mutant E. coli, B. anthracis, and P. aeruginosa in LB.
- FIG. 7 demonstrates that H 2 S suppresses antibiotic-mediated bacterial killing.
- Representative survival curves show the effect of CBS/CSE ⁇ B. anthracis) and 3MST (E. coli) deletions or CBS/CSE inhibition (S. aureus and P. aeruginosa) by PAG/AOAA (inh) on Gm mediated (50 mg/ml) killing.
- NaHS 0.2 mM was added before the antibiotic challenge.
- the percentage of surviving cells was determined by counting colony- forming units (CFU) and is shown as the mean ⁇ SD from three experiments.
- FIG. 8A-C show that endogenous H 2 S protects various bacteria against diverse antibiotics.
- A Representative optical density (OD) growth curves of E. coli Attorney Docket No. 27522-0196W01
- MG1655 B. anthracis (Sterne) or P. aeruginosa (PA 14) (black squares) and their H 2 S-deficient counterparts (gray circles) in the presence of spectinomycin (Sp, 60 ⁇ / ⁇ 1), nalidixic acid (NA, 2.5 ⁇ g ml), erythromycin (Em, 1 ⁇ g/ml), or ampicillin (Amp, 125 ⁇ g/ml).
- Gray triangles show the growth of E. coli that overexpress 3MST. Cells were grown in triplicate at 37°C with aeration using a Bioscreen C automated growth analysis system. The curves represent averaged values from three parallel experiments with a margin of error of less than 5%.
- Inhibitors of CSE/CSB and 3MST increase antibiotic sensitivity.
- Panels show representative growth curves of methicillin-resistant S. aureus (MW2), E. coli, or P. aeruginosa (black squares) in the presence of chloramphenicol (Cm, 0.5 g/ml), vancomycin (Van, 0.5 ⁇ g/ml), acriflavine (Acr, 8 ⁇ g/ml), or pyocyanin (Pyo, 50 ⁇ ).
- Inverted gray triangles and gray circles represent cellular growth in the presence of CSE/CSB and 3MST inhibitors (inh) with or without antibiotics, respectively.
- FIG. 9 shows that H 2 S protects Gram(+) bacteria against chloramphenicol- mediated killing.
- Survival curves show the effect of CBS/CSE B. anthracis and P. aeruginosa) and 3MST (E.coli) deletions or CBS/CSE inhibition (S. aureus) by AOAA/PAG (inh) on chloramphenicol (Cm, 50 ⁇ g/ml)-mediated killing.
- This "bacteriostatic" antibiotic kills Gram(+) bacteria (S. aureus and B. anthracis) within a relatively short time period, but not Gram(-) E.coli and P. aeruginosa.
- Cm, and perhaps other bacteriostatic antibiotics exert oxidative damage in Gram(+) bacteria, against which H 2 S provides protection, thereby improving growth in the presence of these antibiotics in liquid culture (FIG. 8B).
- FIG. 10A-N show that H 2 S protects against antibiotic-inflicted oxidative damage.
- H 2 S acts by diminishing reactive oxygen species (ROS)-mediated antibiotic toxicity.
- E. coli cells were pretreated with the iron chelator, 2,2'-dipyridyl (0.05 mM) or the ROS scavenger thiourea (15 mM) for 3 min, followed by treatment with Gm.
- Cells were grown in triplicate at 37°C with aeration using a Bioscreen C Attorney Docket No. 27522-0196W01 automated growth analysis system. The curves represent averaged values from three parallel experiments with a margin of error of less than 5%.
- a paper disk saturated with 20 mg/ml NA was placed on wt or CBS/CSE- deficient B. anthracis lawns that were grown aerobically or anaerobically for the next 18 hours. Zone borders are marked with dashed lines.
- a paper disk saturated with 50 iM pyocyanin was placed on wt or CBS/SCE-deficient B. anthracis lawns that were grown aerobically or anaerobically for the next 20 hours.
- Zone borders are marked with dashed lines.
- D Endogenous H 2 S renders bacteria resistant to hydrogen peroxide. Agar plates seeded with the indicated bacteria were incubated overnight with a filter paper disk saturated with 0.125 or 0.45 M H 2 0 2 placed atop the bacterial lawn. CBS/CSE- or 3MST- deficient cells formed a clear 5- to 10-mm zone around the disk, whereas wt cells grew a complete lawn and so demonstrated strong H 2 S-dependent resistance to hydrogen peroxide.
- E 3MST-deficent cells exhibit a much greater sensitivity to hydrogen peroxide than other cysteine desulfurase mutants.
- the panel shows growth curves of methicillin-resistant S. aureus (MW2) pretreated with PAG and AOAA for 3 min, followed by the addition of H 2 0 2 (0.5 mM) (circles). NaSH was added to 100 ⁇ prior to challenge with H 2 0 2 (triangles).
- coli chromosomes I-Scel
- lanes 2 and 3 DNA from wt and DMST cells
- lanes 6 to 8 DNA from wt, 3MST-deficient, and 3MST-overproducing cells after treatment with 10 mg/ml Amp
- lanes 9 and 10 DNA from NaHS-treated cells after Amp treatment
- lane 1 1 concatemers from Attorney Docket No. 27522-0196W01
- % linear indicates the relative increase in linearized chromosomal DNA. The values are the average of three independent experiments (P ⁇ 0.1).
- 3 ⁇ 4S protects against H2O2- and antibiotic-inflicted DNA damage. Sub-lethal amounts of H2O2 and ampicillin (Amp) inflicted greater chromosome damage in CBS/CSE- deficient B. anthracis and P. aeruginosa and 3MST-deficient E. coli cells than in wt cells. The integrity of chromosomal DNA was monitored by PCR. Representative agarose gels show chromosomal fragments amplified from equal amounts of genomic DNA isolated from wild type (wt) or mutant ( ⁇ ) cells.
- M 1 kb DNA marker.
- "%” indicates the fraction of the full-length PCR products. Values are the averages from three experiments with a margin of error of less than 10%.
- (J) 3 ⁇ 4S suppresses antibiotic-induced SOS response.
- Gentamicin Gm, 20 ⁇ ⁇ 1
- Gentamicin induces fluorescence in recA' : :gfp E. coli (wt).
- SOS caused by Gm was greater in Asp-treated cells, but fully suppressed by exogenous NaHS.
- the genotoxic agent mitomycin (MMC, 0.2 ⁇ g/ml) was used as a positive control. In each case, the basal level of fluorescence before induction " was assigned a value of 1. Values are the mean ⁇ SD from three experiments.
- FIG. 11 shows that H 2 S-generating CBS/CSE becomes essential in the absence of bNOS.
- B. anthracis (34F2Anos cbs/sce: :Pspac) cells carrying the chromosomal copy of cbs/cse under the IPTG-inducible spac promoter were plated on LBA plates with or without 0.1 mM IPTG for overnight incubation at 37°C.
- FIG. 12A-F show synergistic action of H 2 S and NO in B. anthracis.
- A Compensatory induction of endogenous H 2 S and NO.
- Cells were grown in LB to OD 60 o of -0.5 followed by addition of freshly prepared CuFL (20 mM) and Cef. Fluorescence was measured in the total culture after 18 hours of incubation using a real-time fluorometer (PerkinElmer LS-55).
- H 2 S was measured using Pb(Ac) 2 as in Fig. 4A (right bars).
- B H 2 S induction in response to antibiotic (erythromycin) or H202 challenge.
- the plot shows ⁇ -galactosidase activity (Miller units) expressed by B. anthracis cells harboring a chromosomal transcriptional fusion of the cbs/cse promoter and leader region to a promoterless lacZ gene.
- Bacteria were grown in LB medium until OD 600 of -0.6 followed by the addition of 0.5 mg/ml erythromycin or 2 mM H 2 0 2 .
- the bottom panel shows PbS brown or black stain, which is proportional to the amount of H 2 S produced.
- anthracis cells were grown in 96-well plates in LB + Cys (200 mM) covered with lead acetate-soaked paper by using a Bioscreen C automated growth analysis system.
- C H 2 S induction in response to erythromycin or H 2 0 2 challenge.
- E.coli cells were grown in 96 wells plates in LB+Cys (25 or 200 ⁇ ) covered with lead acetate soaked paper at 37°C with aeration using a Bioscreen C automated growth analysis system.
- Em (2.5 ⁇ g/ml) or H 2 0 2 (1 mM) were added at Attorney Docket No. 27522-0196W01
- coli cells protect 3MST-deficient cells from antibiotic toxicity.
- WT and AsseA cells were grown in LB+Cys (0.5 mM) to OD600 -0.6. Then aliquots containing equal amounts of cells were mixed together, washed, resuspended in M9 minimal media supplemented with Gm ⁇ g/ml) and incubated for 30 min at 37°C. Cell survival was determined by counting CFU and is shown as the mean ⁇ SD from three independent experiments.
- F Protection of 3MST-deficient cells from Cys-mediated gentamicin toxicity by the thiol oxidizer diamide and NaHS.
- FIG. 13 shows that AOAA was able to potentiate the effects of various antibiotics on cultures of Enterococcus faecalis.
- Bacterial cultures were prepared at initial inoculums of ⁇ 5xl0 5 CFU/ml, and aliquots of 190 ⁇ per well were dispensed. Ten ⁇ of the indicated antibiotic solutions were added to each well. The starting concentration for ⁇ each antibiotic solution was 2X MIC, with serial 1 ⁇ 2 dilutions. Two sets of dilutions were prepared, and 0.1 mM AOAA was added to one set. The plates were kept at 37°C and 85% humidity for 20 hours.
- the present invention is based in part on the discovery that microbial H 2 S is cytoprotective.
- CBS bacterial cystathionine ⁇ -synthase
- CSE cystathionine ⁇ -lyase
- 3MST 3-mercaptopyruvate sulfurtransferase
- inhibition of this "gasoprotector” may be useful as an augmentation therapy against a broad range of microbial pathogens, including bacteria, fungi and protozoa.
- microbial CBS, CSE, and 3MST diverge significantly from their mammalian counterparts (see, e.g., Fig. 5A-C), it may be possible to design specific inhibitors that target these enzymes but not their mammalian orthologs.
- the invention provides a method for treating a subject having a microbial infection, said method comprising administering to said subject a therapeutically effective amount of at least one inhibitor of endogenous H 2 S production by an organism (e.g., pathogenic bacteria, fungi, protozoa) causing the microbial infection.
- the method further comprises administering a second antimicrobial compound.
- the invention provides a method for enhancing efficacy of an antimicrobial treatment in a subject having a microbial infection, wherein said antimicrobial treatment comprises administering to the subject a first antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo, said method comprising co-administering said first compound with a therapeutically effective amount of a second compound which second compound is an inhibitor of endogenous H 2 S production by an organism (e.g., pathogenic bacteria, fungi, protozoa) causing the microbial infection.
- an organism e.g., pathogenic bacteria, fungi, protozoa
- the invention provides a method for sensitizing a microbial pathogen (e.g., pathogenic bacteria, fungi, protozoa) to oxidative damage comprising administering to said pathogen an effective amount of at least one inhibitor of endogenous H 2 S production by said pathogen.
- a microbial pathogen e.g., pathogenic bacteria, fungi, protozoa
- the pathogen is in a subject and the inhibitor of endogenous H 2 S production is administered to the subject.
- Such sensitization can be important, for example, for facilitating mammal's own defense against infections.
- pathogens' H 2 S provides protection against the immune response.
- the inhibitor of endogenous H2S production useful in the methods of the present invention inhibits an H 2 S-generating enzyme within the organism causing the microbial infection.
- H 2 S-generating enzyme for example, AOAA and hydroxylamine can be used to inhibit CBS; PAG and ⁇ -cyano-L-alanine can be used to inhibit CSE; and aspartate and derivatives thereof can be used to inhibit 3MST.
- the inhibitor of endogenous H 2 S production inhibits microbial cystathionine ⁇ -synthase (CBS) or paralogs thereof.
- such CBS inhibitor can be co-administered (simultaneously in the same or separate compositions or sequentially) with an inhibitor of microbial cystathionine ⁇ - lyase (CSE) or paralogs thereof.
- CSE microbial cystathionine ⁇ - lyase
- the inhibitor of endogenous H 2 S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof.
- the inhibitor of endogenous H 2 S production inhibits microbial cystathionine ⁇ -lyase (CSE) or paralogs thereof.
- the inhibitor of endogenous H 2 S production is amino- oxyacetate (AOAA). In another embodiment, the inhibitor of endogenous H 2 S production is hydroxylamine. In yet another embodiment, the inhibitor of endogenous H 2 S production is D,L-propargylglycine (PAG). In a further embodiment, the inhibitor of endogenous H 2 S production is ⁇ -cyano-L-alanine. In another embodiment, the inhibitor of endogenous H 2 S production is aspartate or a derivative thereof. In an additional embodiment, the inhibitor of endogenous H 2 S production is homocysteine.
- AOAA amino- oxyacetate
- the inhibitor of endogenous H 2 S production is hydroxylamine.
- the inhibitor of endogenous H 2 S production is D,L-propargylglycine (PAG).
- PAG D,L-propargylglycine
- the inhibitor of endogenous H 2 S production is ⁇ -cyano-L-alanine.
- the inhibitors of endogenous H 2 S production useful in the methods of the present invention selectively inhibit H 2 S- generating enzynje(s) within the organism causing the microbial infection, but not H 2 S-generating enzyme(s) in the cells of the subject being treated.
- Such selective inhibitors can be identified using various screening methods known in the art, e.g., as described in International Application Publication No. WO 2011/130181.
- the methods of the present invention are useful for treating acute or chronic infections caused by various microorganisms, including, e.g., bacteria, fungi and protozoa.
- suitable bacterial genera include, e.g., Bacillus, Brucella, Clostridium, Enterococcus, Escherichia, Francisella, Helicobacter, Klebsiella, Legionella, Listeria, Mycobacterium, Pseudomonas, Salmonella, Shigella, Staphylococcus, Streptococcus, Trypanosoma, Vibrio, and Attorney Docket No. 27522-0196 WO 1
- bacteria are from a species selected from the group consisting of E. coli, S. aureus, B. anthracis, and P. aeruginosa.
- Non-limiting examples of microbial infectious diseases which can be treated by the methods of the present invention include, e.g., pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis, malaria, trachoma, leishmaniasis, chagas disease, trichomoniasis, lyme disease, and leprosy.
- microbial infectious diseases include, e.g., pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis,
- the methods of the present invention can be used to treat infections in various animals, including, e.g., mammals, birds and fish. In one specific embodiment, the methods of the present invention are used to treat infections in humans.
- antimicrobial compounds examples include, without limitation, quinolones, acridines, phenothiazines, aminoglycosides/' macrolides, amphenicols, steroids, ansamycins, antifolates, polymyxins, glycopeptides, cephalosporins, and lactams.
- a method as provided herein can include administration of an antimicrobial compounds selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, jbsamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7-diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam,
- the methods provided herein also can include further administering an inhibitor of endogenous microbial NO production or an NO scavenger.
- Non-limiting examples of useful inhibitors of endogenous NO production include L-arginine, N G -monomethyl-L-arginine (NMMA), N G -nitro-L-arginine methyl ester (NAME), N G -nitro-L-arginine (NNA), N G -amino-L-arginine (NAA), Attorney Docket No. 27522-0196WO1
- N G ,N G -dimethylarginine (asymmetric dimethylarginine, called ADMA), L- Thiocitrulline, S-methyl-L-Thiocitrulline, diphenyleneiodonium chloride, 2-(4- carboxyphenyl)-4,4,5,5-tetramethylimidazoline-l -oxy 3-oxide, 7-nitroindazole, N(5)- (l-iminoethyl)-L-ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L- citrulline, S-methylisourea, and 2-mercaptoethylguanidine. See, also, the inhibitors disclosed in Hobbs et al. (1999) Annu. Rev. Pharmacol. Toxicol. 39: 191-220; and Salard et al. (2006) J. Inorg. Biochem. 100:2024-2033. In some embodiments, iNOS- specific inhibitors can be particularly useful.
- NO scavengers include, without limitation, non-heme iron-containing peptides or proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferrioxamine, pyridoxal isonicotinoyl hydrazone (PIH) , 1,2- dimethyl-3hydroxypyrid-4-one (LI) , [+] 1, 2-bis (3,5-dioxopiperazine-lyl)propane (ICRF-187), 2-(4-carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl-l- oxy-3-oxide (Carboxy-PTIO), and the like.
- a particularly useful NO scavenger may be a perfluorocarbon emulsion, as disclosed in Rafikova et al. (2004) Circulation 110(23):3573-3580.
- the invention provides a pharmaceutical composition comprising (i) an antimicrobial compound that becomes compromised by H 2 S or natural products of H 2 S metabolism in vivo and (ii) an inhibitor of microbial endogenous H 2 S production.
- this composition further comprises (iii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
- the invention provides a pharmaceutical composition comprising (i) an inhibitor of microbial endogenous H 2 S production and (ii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
- the compounds described herein can be formulated into pharmaceutical compositions and formulations.
- Compounds therefore can be admixed, encapsulated, conjugated or otherwise associated with one or more pharmaceutically acceptable carriers and/or other molecules, molecular structures, or mixtures of compounds such as, for example, liposomes, polyethylene glycol, receptor targeted molecules, for oral, topical or other formulations, for assisting in uptake, distribution and/or absorption.
- Optimum dosages can vary depending on the relative potency of individual compounds, and can generally be estimated based on EC50 found to be effective in in vitro and in vivo animal models. Typically, dosage is from 0.01 ⁇ g to 100 g per kg of body weight, and may be given once or more daily, biweekly, weekly, monthly, or even less often. Following successful treatment, it may be desirable to have the patient undergo maintenance therapy to prevent the recurrence of the disease state.
- compositions can be administered by a number of methods, depending upon whether local or systemic treatment is desired and upon the area to be treated.
- Administration can be, for example, topical (e.g., transdermal, sublingual, ophthalmic, or intranasal); pulmonary (e.g., by inhalation or insufflation of powders or aerosols); oral; or parenteral (e.g., by subcutaneous, intrathecal, intraventricular, intramuscular, or intraperitoneal injection, or by intravenous drip).
- Administration can be rapid (e.g., by injection) or can occur over a period of time (e.g., by slow infusion or administration of slow release formulations).
- compounds can be administered by injection or infusion into the cerebrospinal fluid, typically with one or more agents capable of promoting penetration of the polypeptides across the blood-brain barrier.
- paralogs refers to homologous sequences within a microbial genome which result from a gene duplication event.
- the CBS, CSE, and 3MST paralogs encompassed by the present invention may have altered functional properties as compared to CBS, CSE, and 3MST, but are still involved in or affect the endogenous microbial H 2 S production.
- the term "compromised by H 2 S or natural products of H 2 S metabolism” refers to antimicrobial compounds which become less effective in the presence of H 2 S or natural products of H 2 S metabolism (i.e., any sulfur-containing organic [e.g. cysteine, glutathione] or inorganic [e.g., FeS, NaHS] products of H 2 S metabolism).
- This term encompasses complete and partial loss of antimicrobial activity of a given compound.
- the terms "treat,” “treatment,” and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition.
- administering or “administration” are intended to encompass all means for directly and indirectly delivering a compound to its intended site of action.
- the compounds of the present invention can be administered locally to the affected site (e.g., by direct injection into the affected tissue) or systemically.
- systemic as used herein includes parenteral, topical, oral, spray inhalation, rectal, nasal, and buccal administration.
- Parenteral administration includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional, and intracranial administration.
- the term "therapeutically effective” applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof.
- the term “therapeutically effective” refers to that quantity of a compound (e.g., an inhibitor of endogenous ⁇ H 2 S production or its Attorney Docket No. 27522-0196W01 combination with a second antimicrobial compound and/or an inhibitor of endogenous microbial NO production or an NO scavenger) or pharmaceutical composition containing such "" compound that is sufficient to delay manifestation, arrest the progression, relieve or alleviate at least one aspect of an infection. Note that when a combination of active ingredients is administered the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually.
- compositions of the invention refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to an animal (e.g., a human).
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
- subject refers to any animal, including, e.g., mammals, birds and fish, and, in particular, humans.
- E. coli, S. aureus, and P. aeruginosa strains were grown in Luria-Bertani (LB) broth or on LB plates supplemented with 1.5% Bacto agar at 37°C. -B. anthracis strains were grown in BHI media supplemented with glycerol at 37°C. Construction of sseA deletion and sseA overexpression strains of E. coli were produced according to Datsenko and Wanner (34).
- an attL- Km K -attR cassette (35) was amplified with primers 5'- atgcgtgagaatttacgttatgtaattcagtatcaccgctcaagttagtataaaaaagct-3' (SEQ ID NO: 1) and 5'-ttamcactggctcaaccggtaaatctgcccgcgtgaagccttttttatactaag-3' (SEQ ID NO: 2) and transformed into an MG1655 strain containing p D46.
- sseA mutants were selected on LB agar supplemented with Km and verified by PCR with primers 5'- attagcatgcaggcggctac-3' (SEQ ID NO: 3) and 5'-tgctggaaaggccgcgaa-3' (SEQ ID NO: 4).
- an attL-Cm R -attR cassette (35) was amplified with primers 5'-cgcagatcttgaagcctgcttttttatac-3' (SEQ ID NO: 5) and 5'-cgctcaagttagtataaaaaagct-3' (SEQ ID NO: 6) and ligated with Puet-oi obtained with primers 5'-cgcagatctcgagtccctatcagtg-3' (SEQ ID NO: 7) and 5'-aatttctcctctttccatgg-3' (SEQ ID NO: 8).
- a Puet-oi- attL-Cm R -attR cassette was then amplified with primers 5'-ccctgccacaatggcccgttagcaacgtcgaataacgctcaagttagtataaaaagct-3' (SEQ ID NO: 9) and 5'-gtgatactgaattacataacgtaaattctcacgcatggtacctttctcctcttttaatga-3' (SEQ ID NO: 10).
- the first primer contains the upstream region of sseA and sequence of attR, while the second primer contains the coding region of sseA and sequence of Puet-oi-
- the PCR fragment was transformed into MG1655 containing pKD46.
- CmR clones were tested in the presence of the P Ltet- oi-a#£-Cm R -ttR cassette by PCR with primers 5'- attagcatgcaggcggctac-3' (SEQ ID NO: 1 1) and 5'-gcaaaagaggctgatttggct-3' (SEQ ID Attorney Docket No. 27522-0196WO!
- E. coli metB, metC, malY, cysM, cysK, and tnaA deletion mutants were obtained from the E. coli Keio Knockout Collection (Thermo Scientific).
- the B.anthracis nos deletion strain Sterne 34F2 was described previously (28).
- the conditional KO (CO) of cbs/cse in B.anthracis 34F2 was made, using a protocol described in Fisher and Hanna, J. Bacteriol. 187, 8055 (2005).
- the 0.5 kb fragment of cbs from -20 to 480 with respect to the translational start site was amplified from 34F2 genomic DNA by using primers designed for use in the Gateway cloning system (Invitrogen).
- the upstream primer had the sequence 5'- ggggacaagtttgtacaaaaagcaggctAAGGGGGAGAACACGATGAATG-3' (SEQ ID NO: 19; RBS and start codon underlined), and the downstream primer had the sequence 5'-ggggaccactttgtacaagaaagctgggtgtgccgaccaaagttcaggac-3' (SEQ ID NO: 20).
- the resulting amplicon was transferred to pDONRtet using standard BP reaction conditions (Invitrogen), followed by transformation of competent DH10B E.coli and selection on LB plates containing 10 ⁇ g/ml of tetracycline.
- the P. aeruginosa PA- 14 wt and PA- 14 cbs mutant strains were obtained from Massachusetts General Hospital's P. aeruginosa mutants collection (Department of Molecular Biology, Richard B. Simches Research Center.
- H2S detection To monitor 3 ⁇ 4S production in wild type (wt) and mutant cells, a lead acetate detection method was used (7). Paper strips saturated with 2% Pb(Ac)2 were affixed to the inner wall of a culture tube, above the level of a liquid culture of wild type or mutant bacteria. Overnight cultures were diluted 1 :50 in LB or BHI without or with Cys (25 - 500 ⁇ ), and incubated 18-20 hours at 37°C with aeration. Stained paper strips were scanned and quantified with an Alphalmager (Imgen Technologies; Alexandria, VA). The results were normalized per ODs. Assay of chromosomal DNA damage: The assay was done as described previously (28).
- Total genomic DNA was isolated from the bacteria pellets with a QIAamp DNA Mini Kit (Qiagen; Valencia, CA) or according the GenElute Bacterial Genomic DNA Kit protocol for Gram Positive Bacteria (Sigma; St. Louis, MO). DNA was extracted with phenol/chloroform and quantified with the PicoGreen dsDNA quantitation reagent (Molecular Probes®; Invitrogen; Carlsbad, CA) and ⁇ phage DNA as a standard. An arbitrarily chosen 10-kb, 6-kb, and 5.8-kb fragments of E.coli, B. anthracis and P. aeruginose genomes, respectively, were used for qPCR. Primer sequences were as Attorney Docket No.
- 27522-0196W01 follows: E.coli 5'-ttccattgggatgtagatgctg-3' (forward; SEQ ID NO: 13) and 5'- ggtaaaagagtcaagggaagaacc-3' (reverse; SEQ ID NO: 14), B.anthracis 5'- acgctttgacttctctcacttcggt-3' (forward; SEQ ID NO: 15) and 5'-aaacatttgctcttgatgtcctgga-3' (reverse; SEQ ID NO: 16), P.aeruginose 5'-ctttgcaacctgtacatgccttg-3' (forward; SEQ ID NO: 17) and 5'- catcgtagtagttgatcggatggac-3' (reverse; SEQ ID NO: 18).
- PCR was performed with Phusion DNA polymerase (Finnenzymes).
- the 50- ⁇ 1 PCR mixture contained 0.5 ng of genomic DNA as a template, 1.5 ⁇ primers, 200 ⁇ dNTPs (Fermentas), 5 ⁇ 1 Phusion GC PCR buffer, and 0.5 ⁇ of DNA polymerase.
- DNA was subjected to 29 cycles of PCR (98°C for 30 seconds, 53°C for 30 seconds, and 72°C for 3 or 9 minutes). PCR products were separated by electrophoresis in a 0.8% or 1% agarose gel, stained with ethidium bromide, scanned, and quantified with an Alphalmager (Imgen Technologies).
- Electrophoresis Assay of DNA damage in vitro The nicking reaction mixture contained 0.1 ⁇ g pBR322 plasmid DNA in 20 mM Tris HC1 buffer, pH 8.0, 30 ⁇ FeCb, 4 mM Cys and 4 mM H2O2, in the presence or absence of 0.2 mM NaHS. After incubating the mixture at room temperature for 15 min the DNA samples were applied to an 0.8% agarose gel in a TAE buffer system, and electrophoresis was performed at 80 V for 30 min. Following electrophoresis, gels were stained with ethidium bromide for 30 min. After washing, the bands were visualized in a UV transilluminator.
- PFGE Field Gel Electrophoresis
- CBS/CSE expression assay B. anthracic Stern 34F2 cbs/cse::pNFdl3 cells (see above) carrying the lacZ reporter under the native cbs promoter were used.
- bacteria were grown overnight at 37°C in LB medium, washed and diluted 1 :25 in fresh medium containing erythromycin or H2O2 at the specified concentrations. Cultures were incubated for 2-2.5 hr at 37°C before measurement of ⁇ -galactosidase activity. Shown ⁇ - galactosidase activities correspond to mean values from at least three independent experiments. Error bars correspond to the standard deviation.
- Catalase Activity Assay Degradation of H2O2 was monitored in real time as a decrease in absorbance at 240 nm (37). Aliquots of extracts to be monitored or of pure catalase were mixed with 50 mM phosphate buffer (pH 7.0) and placed into a 1 ml quartz cuvette. 40 mM H2O2 solution was added and the kinetics of its degradation recorded. Total .H2O2 degrading activity was measured as the decrease of H2O2 concentration per milligram of total protein per second.
- NO sensor was provided by Dr. S. Lippard, MIT. See, Shatalin et al., Proc. Natl. Acad. Sci. U.S.A. 105, 1009 (2008).
- Example 2 Bacterial CBS. CSE. and 3MST generate H?S under normal growth conditions
- each enzyme was inactivated genetically or chemically in four clinically relevant and evolutionarily distant pathogenic species: Bacillus anthracis (Sterne), Pseudomonas aeruginosa (PA14 , Staphylococcus aureus (MSSA RN4220 and MRSA MW2), and Escherichia coli (MG1655).
- the first three species have the CBS/CSE operon, but not 3MST, whereas E. coli carries 3MST, but not CBS/CSE.
- the chromosomal organization of H2S genes Fig.
- H 2 S production was monitored in wild-type (wt) and mutant cells using lead acetate [Pb(Ac) 2 ], which reacts specifically with H2S to form a brown lead sulfide stain.
- Pb(Ac) 2 lead acetate
- the rate of change of staining on a Pb(Ac)2-soaked paper strip is directly proportional to the concentration of H 2 S (Forbes, Bailey and Scott's Diagnostic Microbiology (Mosby, St. Louis, MO, ed. 10, 1998)).
- Deletion of CBS/CSE in B. anthracis and P. aerugenosa or 3MST in E. coli greatly decreased or eliminated PbS staining (Fig. 4A).
- 3MST is the major source of H 2 S in E.coli.
- the E. coli genome encodes several other enzymes that could potentially generate 3 ⁇ 4S. These include cystathionine-y-synthase MetB, cystathionines-synthases MetC and MalY, and CysM, CysK, and TnaA, which all are cysteine desulfurases (27).
- Pb(Ac)2 analysis of individual strains harboring knockopts of each of these genes indicates that 3MST is the major source of H2S production under specified growth conditions (Fig. 4C).
- H 2 S-mediated cytoprotection resembles that of NO, which defends certain Gram-positive bacteria against some of the same antibiotics as does H 2 S (I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009)).
- NO-mediated protection relies, in part, on its ability to defend bacteria against oxidative stress imposed by antibiotics (I. Gusarov, E. Nudler, Proc. Natl. Acad. Sci. U.S.A. 102, 13855 (2005); K. Shatalin et al., Proc. Natl. Acad. Sci. U.S.A. 105,1009 (2008); and I. Gusarov, .
- FIG. 10A Wild type and H2S-deficient cells became equally resistant to Gm in the presence of dipyridyl or thiourea (Fig. 10A). Moreover, the H 2 S donor added together with Gm was as effective as dipyridyl or thiourea in protecting against antibiotics, but failed to further protect cells that had already been pretreated with antioxidants (Fig. 10A). Thus, H 2 S, like NO, acts by suppressing the oxidative component of antibiotic toxicity.
- H 2 S-generating enzymes provided protection against antibiotics only under aerobic conditions.
- nalidixic acids (NA) and pyocyanin were considerably less potent against CBS/CSE- deficient B. anthracis in anaerobic growth conditions than in aerobic conditions.
- oxidative stress I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009); M. A. Kohanski, D. J. Dwyer, B. Hayete, C. A. Lawrence, J. J.
- Hayete, C. A. Lawrence, J. J. Collins, Cell 130, 797 (2007) would be compromised during infections caused by anaerobic bacteria such as Bacteroides or Clostridium. It remains to be determined to what extent H 2 S production by bacteria during aerobic and anaerobic infection contributes to antibiotic resistance.
- anaerobic bacteria such as Bacteroides or Clostridium.
- Fig. 12 the parallels between NO and H 2 S production by bacteria (Fig. 12) and the essential role of bacterial NO in survival of germinating B. anthracis in macrophages
- H 2 S-mediated protection against oxidative stress contributes to bacterial infection and antibiotic resistance as well.
- H 2 S bolsters the antioxidant capacity of bacterial cells.
- H 2 S-deficient B. anthracis, E. coli, S. aureus, and P. Attorney Docket No. 27522-0196WO1 aeruginosa displayed higher susceptibility to peroxide than their wt counterparts, whereas NaHS rendered them more resistant to the peroxide (Figs. 10D-10G).
- DSBs double-strandDNAbreaks
- peroxide O. I. Aruoma, B. Halliwell, E. Gajewski, M. Dizdaroglu, J. Biol. Chem. 264, 20509 (1989); and S. I. Liochev, I. Fridovich, IUBMB Life 48, 157 (1999)
- These DSBs result from the Fenton reaction (J. A. Imlay, Annu. Rev. Microbiol. 57, 395 (2003)), which also can be triggered by antibiotics (I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009); M. A.
- the antioxidant effect of endogenous H 2 S can also be explained, in part, by its ability to augment the activities of catalase and superoxide dismutase (SOD) (Fig. 10 ).
- SOD superoxide dismutase
- the rate of H2O2 degradation in crude extracts of wt E. coli cells was > 1.5 times that of 3MST-deficient cells and was increased further in cells that Attorney Docket No. 27522-0196W01 overexpressed 3MST (Fig. 10K). SOD activity also was proportional to the level of 3MST expression (Fig. 1 OK).
- the extenj of genomic DSBs can be assessed by PCR of an arbitrarily chosen segment of the bacterial chromosome (I. Gusarov, E. Nudler, Proc. Natl. Acad. Sci. U.S.A. 102, 13855 (2005)).
- this assay equal amounts of genomic DNA from wt and mutant cells grown with or without antibiotics or H2O2 were isolated for PCR. The number of reaction cycles was selected so that DSBs influenced the yield of the final PCR product.
- the yield of the PCR product from exponentially growing, 3 ⁇ 4S- deficient B. anthrflcis, E. coli, or P. aeruginosa treated with H2O2 or antibiotics was substantially lower than that from similarly treated wt cells (Fig. 101).
- H 2 S increases bacteria resistance to oxidative stress and antibiotics by a dual mechanism (Fig. 10L) of suppressing the DNA-damaging Fenton reaction via Fe 2+ sequestration (Figs. 10A, 10F, and 10M) and stimulating the major antioxidant enzymes catalase and SOD (Fig. 10K).
- the latter is essential for long-term protection but is less important during the first moments of oxidative stress.
- katE and sodA E. coli mutants are well protected by NaHS during the first minutes of H2O2 exposure but then quickly lose viability (Fig. 10N).
- anthracis Anos cells containing an isopropylb-D-thiogalactopyranoside (IPTG)-inducible CBS/CSE conditional knockout could grow only in the presence of IPTG (Fig. 1 1).
- IPTG isopropylb-D-thiogalactopyranoside
- the amount of NO produced in H 2 S-deficient cells or the amount of H 2 S produced in NO-deficient cells was greater than that produced in wt cells (Fig. 12A), which indicated that one gas compensates for the lack of the other.
- the activity of both CBS/CSE and bNOS was stimulated in response to antibiotics (Fig. ⁇ 12 A).
- H 2 O2 and antibiotics substantially induced CBS/CSE gene expression (Fig.
- H 2 S enzymes are essentially universal (Fig. 1A). Because H 2 S equilibrates rapidly across cell membranes, a fraction of cells that generate this gas in culture or in biofilms could, in principle, defend the entire population. Indeed, wt E. coli cells * effectively protect 3MST-deficient cells from Gm toxicity in exponentially growing coculture (Fig. 12E).
- 3MST protects E. coli against different classes of antibiotics
- Fig. 10L The results presented herein suggest several non-mutually exclusive mechanisms that could explain the H2S-mediated defense against oxidative stress (Fig. 10L): (i) stimulation of the major antioxidative enzymes, catalase and SOD (Fig. 10 ); (ii) direct neutralization of peroxide (3 ⁇ 4S + H2O2 - ⁇ S + 2H2O); (iii) transient depletion of free cysteine, a reducing agent that fuels the Fenton reaction (S. Park, J. A. Imlay,. J. Bacteriol. 185, 1942 (2003)), and (iv) depletion of ferrous iron, a catalytic agent of the Fenton reaction.
- E. faecalis ATCC 29212 cultures were prepared at initial inoculums of ⁇ 5xl 0 5 CFU/ml in Mueller-Hinton II Broth (cation-adjusted). Aliquots of 190 ⁇ were dispensed to each well of a fresh set of plates, and 10 ⁇ of an antibiotic solution (levofloxacin, meropenem, gentamicin, piperacillin, linezolid, cefepime, daptomycin, vancomycin, or chloramphemicol) were transferred to the corresponding wells in each bacterial plate (Fig. 13).
- an antibiotic solution levofloxacin, meropenem, gentamicin, piperacillin, linezolid, cefepime, daptomycin, vancomycin, or chloramphemicol
- the starting concentration was 2X MIC (minimum inhibitory concentration) with serial 1 ⁇ 2 dilutions. Two sets of dilutions were prepared, arid to one of them 0.1 mM AOAA was added. The resulting plates were kept at 37°C and 85% humidity for 20 hours. All nine antibiotics tested were potentiated by AOAA, with respective MICs dropped from 8-fold to 32-fold (Fig. 13). Thus, this study demonstrated that the activities of the antibiotics tested were potentiated by AOAA.
- Example 8 Comparison of antibiotic potentiation by AOAA and PAG
- MIC Minimum inhibitory concentration
- VLTLALYRLGARGSALYDGSWSEWGLVEGPPIATGPA SEQ ID NO: 29
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
The invention provides materials and methods for treating infections by reducing endogenous microbial H2S levels.
Description
Attorney Docket No. 27522-0196WO1
METHODS FOR TREATING INFECTIONS BY TARGETING MICROBIAL H2S-PRODUCING ENZYMES
CROSS REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of U.S. Provisional Patent Application No. 61/438,524, filed February 1 , 201 1, which is incorporated herein by reference in its entirety.
STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
This invention was made with government support under grant No. 5DP1OD000799, awarded by the National Institutes of Health. The government has certain rights in the invention.
TECHNICAL FIELD OF THE INVENTION
The invention relates to materials and methods for treating infections, and more particularly to materials and methods for reducing endogenous microbial H2S levels. BACKGROUND OF THE INVENTION
Despite the phenomenal success of antibiotics, infectious diseases remain the second leading cause of death worldwide. About two million Americans are infected in hospitals each year (with 90,000 deaths as a result), and more than half of these infections resist at least one antibiotic. For example, pathogens can alarmingly become fully resistant to last resort antibiotics, such as vancomycin. The emergence of multidrug-resistant bacteria has created a situation in which there are few or no options for treating certain infections. Natural antibiotics and their derivatives are intrinsically prone to become obsolete because of preexisting genes that render pathogens resistant to them. Bacterial species share these genes, thus rapidly spreading resistance from hospitals and farms to surrounding communities.
H2S is a toxic gas that has been associated with beneficial functions in mammals, including vasorelaxation, cardioprotection, neurotransmission, and antiinflammatory action in the gastrointestinal (GI) tract (1-5). The ability of H2S to
Attorney Docket No. 27522-0196W01 function as a signaling molecule parallels the action of another established gasotransmitter, nitric oxide (NO) (6-8). Endogenous NO was demonstrated to protect certain Gram(+) bacteria against antibiotics and oxidative stress (10-12).
Like NO, H2S is produced enzymatically in various tissues (1, 4). Three H2S- generating enzymes have been characterized in mammals: cystathionine β-synthase (CBS), cystathionine γ-lyase (CSE) and 3-mercaptopyruvate sulfurtransferase (3MST). CBS and CSE produce H2S predominantly from L-cysteine (Cys). 3MST does so via the intermediate synthesis of 3-mercaptopyruvate by cysteine aminotranferase (CAT), which is inhibited by aspartate (Asp) competition for Cys on CAT (9) (Fig. 1 A). In contrast to mammals, bacteria-derived H2S has been known for centuries, but has been considered to be merely a byproduct of sulfur metabolism with no particular physiological function in non-sulfur microorganisms (it is used as energy source in purple and green sulfur bacteria). Further, little is known about the metabolic pathways involving H2S in mesophilic bacteria. Analysis of bacterial genomes, however, revealed that most, if not all, possess orthologs of mammalian CBS, CSE, or 3MST (Figs. 1A and 2A-C), suggesting an important cellular function(s) that preserved these genes throughout bacterial evolution.
SUMMARY OF THE INVENTION
As indicated in the Background section, above, there is a great need in the art to develop new effective treatments for microbial infections and to fight antibiotic resistance.
The present invention addresses these and other needs by providing methods and compositions for treating infections and enhancing effectiveness of antibiotics by reducing endogenous microbial H2S levels. In one aspect, the invention provides a method for treating a subject having a microbial infection, said method comprising administering to said subject a therapeutically effective amount of at least one inhibitor of endogenous H2S production by an organism causing the microbial infection. In one embodiment, the method further comprises administering a second antimicrobial compound (e.g., a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a
Attorney Docket No. 27522-0196W01 cephalosporin, a lactam, or any combination thereof). In one specific embodiment, the second antimicrobial compound is selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, josamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7- diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam, carbenicillin, and any combination thereof. In another specific embodiment, the second antimicrobial compound is selected from the compounds disclosed in Tables 1 and 2 (below) and any combination thereof. The inhibitor of endogenous H2S production and the second antimicrobial compound can be administered simultaneously (within the same composition or in different compositions) or sequentially (with either the inhibitor of endogenous H2S production or the second antimicrobial compound administered first).
In another aspect, the invention provides a method for enhancing efficacy of an antimicrobial treatment in a subject having a microbial infection, wherein said antimicrobial treatment comprises administering to the subject a first antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo, said method comprising co-administering said first compound with a therapeutically effective amount of a second compound which second compound is an inhibitor of endogenous H2S production by an organism causing the microbial infection. The first antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo can be without limitation, e.g., a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a cephalosporin, a lactam, or any combination thereof. In one specific embodiment, the first antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo is selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, josamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7-
Attorney Docket No. 27522-0196WO1 diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam, carbenicillin, and any combination thereof. In another specific embodiment, the first antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo is selected from the compounds disclosed in Tables 1 and 2 (below) and any combination thereof. The first antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo and the inhibitor of endogenous H2S production can be administered simultaneously (within the same composition or in different compositions) or sequentially.
In yet another aspect, the invention provides a method for sensitizing a microbial pathogen to oxidative damage comprising administering to said pathogen an effective amount of at least one inhibitor of endogenous H2S production by said pathogen. In one embodiment, the pathogen is in a subject and the inhibitor of endogenous H2S production is administered to the subject.
In one embodiment, the inhibitor of endogenous H2S production useful in the methods of the present invention inhibits an H2S-generating enzyme within the organism causing the microbial infection. In one embodiment, the inhibitor of endogenous H2S production inhibits microbial cystathionine β-synthase (CBS) or paralogs thereof. In a specific embodiment, such CBS inhibitor can be coadministered (simultaneously in the same or separate compositions or sequentially) with an inhibitor of microbial cystathionine γ- lyase (CSE) or paralogs thereof. In a separate embodiment, the inhibitor of endogenous H2S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof. In another embodiment, the inhibitor of endogenous H2S production inhibits microbial cystathionine γ-lyase (CSE) or paralogs thereof.
In one embodiment, the inhibitor of endogenous H2S production is amino- oxyacetate (AOAA). In another embodiment, the inhibitor of endogenous H2S production is hydroxylamine. In yet another embodiment, the inhibitor of endogenous H2S production is D,L-propargylglycine (PAG). In a further embodiment, the inhibitor of endogenous H2S production is β-cyano-L-alanine. In another embodiment, the inhibitor of endogenous H2S production is aspartate or a
Attorney Docket No. 27522-0196 WO 1 derivative thereof. In an additional embodiment, the inhibitor of endogenous H2S production is homocysteine.
In one embodiment, the inhibitors of endogenous H2S production useful in the methods of the present invention selectively inhibit H2S-generating enzyme(s) within the organism causing the microbial infection, but not H2S-generating enzyme(s) in the cells of the subject being treated. Such selective inhibitors can be identified using various screening methods known in the art, e.g., as described in International Application Publication No. WO 2011/130181.
The methods of the present invention are useful for treating infections caused by various microorganisms, including, e.g., bacteria, fungi and protozoa. Non- limiting examples of encompassed bacterial genera include, e.g., Bacillus, Brucella, Clostridium, Enterococcus, Escherichia, Francisella, Helicobacter, Klebsiella, Legionella, Listeria, Mycobacterium, Pseudomonas, Salmonella, Shigella, Staphylococcus, Streptococcus, Trypanosoma, Vibrio, and Yersinia. In one specific embodiment, bacteria are from a species selected from the group consisting of E. coli, S. aureus, B, anthracis, and P. aeruginosa.
Non-limiting examples of microbial infectious diseases which can be treated by the methods of the present invention include, e.g., pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis, malaria, trachoma, leishmaniasis, chagas disease, trichomoniasis, lyme disease, and leprosy.
The methods of the present invention can be used to treat infections in various animals, including, e.g., mammals, birds and fish. In one specific embodiment, the methods of the present invention are used to treat infections in humans.
The methods of the present invention can further comprise administering an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
Such inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger can be administered simultaneously (within the same composition or in different compositions) or sequentially (in any order) with an inhibitor of endogenous
H2S production and/or the second antimicrobial compound. Non-limiting examples
Attorney Docket No. 27522-0196WO1 of useful inhibitors of endogenous NO production include, e.g., L-arginine, N G - monomethyl-L-arginine, N G-nitro-L-arginine methyl ester, N G -nitro-L-arginine, N G -amino-L-argiqine, N G ,N G-dimethylarginine (asymmetric dimethylarginine), L- thiocitrulline, S-methyl-L-thiocitrulline, diphenyleneiodonium chloride, 2-(4- carboxyphenyl)-4,4,5,5-tetramethylimidazoline-l-oxy 3-oxide, 7-nitroindazole, N(5)- (l-iminoethyl)-L-ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L- citrulline, S-methylisourea, and 2-mercaptoethylguanidine. In one specific embodiment (wherein the microbial infection is caused by Gram (+) bacteria), the inhibitor of endogenous NO production is an iNOS-specific inhibitor. Non-limiting examples of useful NO scavengers include, e.g., non-heme iron-containing peptides, non-heme iron-containing proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferrioxamine, pyridoxal isonicotinoyl hydrazone, l,2-dimethyl-3hydroxypyrid-4-one, [+] 1, 2-bis (3,5-dioxopiperazine- lyl)propane, and 2-(4-carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl- l-oxy-3-oxide. In one specific embodiment, the NO scavenger is a perfluorocarbon emulsion.
In conjunction with the methods of the present invention, provided herein are various combination pharmaceutical compositions. In.one embodiment, the invention provides a pharmaceutical composition comprising (i) an antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo and (ii) an inhibitor of microbial endogenous H2S production. In a specific embodiment, this composition further comprises (iii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger. In a separate embodiment, the invention provides a pharmaceutical composition comprising (i) an inhibitor of microbial endogenous H2S production and (ii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
Attorney Docket No. 27522-0196W01
The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims. BRIEF DESCRIPTION OF THE FIGURES
FIG. 1A is a schematic representation of basic metabolic pathways of H2S synthesis. CBS and CSE generate H2S with pyruvate and ammonia directly from Cys. 3MST generates H2S and pyruvate from 3-mercaptopyruvate (3MP), which is synthesized along with glutamate by CAT from Cys and a-ketoglutarate. The orthologs of corresponding mammalian genes are present in the majority of bacterial species whose genomes have been fully sequenced (Fig. 5). Chemicals that specifically inhibit CBS, CSE, and 3MST are indicated. A sample of clinically relevant pathogens carrying 3MST or CBS/CSE encoding genes is shown on the right.
FIG. 2A-C are sample sequence alignments of H2S-producing enzymes. (A) 3MST from Homo sapiens (HS; SEQ ID NO: 21 ) and its orthologs from E. coli (EC; SEQ ID NO: 22), Y. pestis C092 (YP; SEQ ID NO: 23), S. typhimurium LT2 (ST; SEQ ID NO: 24), B. suis 23445 (BS; SEQ ID NO: 25), E. pyrifoliae Epl/96 (ER; SEQ ID NO: 26), P. luminescens laumondii TT01(PL; SEQ ID NO: 27), R. palustris CGA009 (RP; SEQ ID NO: 28), N. winogradskyi Nb-255 (NW; SEQ ID NO: 29), S. boydii Sb227 (SB; SEQ ID NO: 30), and Jannaschia sp. CCS l (JS; SEQ ID NO: 31) (S9, S 10). (B) CBS from Homo sapiens (HS; SEQ ID NO: 32) and their homologs from B. anthracis Sterne (BA; SEQ ID NO: 33), P. aeruginosa PA01 (PA; SEQ ID NO: 34) and S. aureus N315 (SA; SEQ ID NO: 35). (C) CSE from Homo sapiens (HS; SEQ ID NO: 36) and their homologs from B. anthracis Sterne (BA; SEQ ID NO: 37), P. aeruginosa PA01 (PA; SEQ ID NO: 38) and S. aureus N315 (SA; SEQ ID NO: 39). Conserved amino acids are highlighted. Active-site loop residues of HS 3MST and CBS are shown in bold (S I 1 -13). Asterisks indicate key active-site residues of CSE (S I 4).
FIG. 3A-B show genome organization of 3MST and CBS/CSE in selected bacteria. (A) Localization of sseA (3MST) orthologs (black arrow block aligned in the middle) in selected genomes of pathogenic bacteria. Genes of same color are
Attorney Docket No. 27522-0196WO1 from the same ortholog group. Light grey - no COG assignment; white - pseudo gene. (B) CBS (black arrow block aligned in the middle) and CSE (white arrow block aligned in the middle) orthologs in B. anthacis, S. aureus and P. aeruginosa genomes.
FIG. 4A-B demonstrate that endogenous H2S protects bacteria against antibiotic toxicity. (A) H2S production by B. anthracis, S. aureus, P. aeruginosa, and E. coli depends on CBS/CSE and 3MST, respectively. Lead acetate-soaked paper strips show a PbS brown or black stain as a result of reaction with H2S. Strips were affixed to the inner wall of a culture tube, above the level of the liquid culture of wt or mutant bacteria, for 18 hours. CBS/CSE and 3MST inhibitors PAG/AOAA (inh) and aspartate (Asp, 3.2 mM), respectively, were added as indicated. Numbers (%) show the relative decrease in H2S production due to chemical or genetic inhibition of CBS/CSE and 3MST. pMST indicates the E. coli strain that expresses an extra copy of the 3MST gene under a strong pLtetO-1 promoter. (B) Cysteine (Cys) is a substrate for bacterial CBS/CSE and 3MST. Addition of Cys (25 mM for E. coli; 2001mM for other species) greatly stimulated. H2S synthesis in wt, but not in CBS/CSE- or 3MST-deficient strains. ,
FIG. 4C is a Pb(Ac)2 analysis of individual strains harboring knockouts.
FIG. 5 shows the results of Phenotype MicroArray. The growth curves for E.coli wt are shown in black, for AsseA in white and overlay in black. Data are shown as the means from two experiments. The relative values of growth inhibition (negative numbers) are presented in Table 1.
FIG. 6 shows growth of wt and mutant E. coli, B. anthracis, and P. aeruginosa in LB.
FIG. 7 demonstrates that H2S suppresses antibiotic-mediated bacterial killing. Representative survival curves show the effect of CBS/CSE {B. anthracis) and 3MST (E. coli) deletions or CBS/CSE inhibition (S. aureus and P. aeruginosa) by PAG/AOAA (inh) on Gm mediated (50 mg/ml) killing. Where indicated, NaHS (0.2 mM) was added before the antibiotic challenge. The percentage of surviving cells was determined by counting colony- forming units (CFU) and is shown as the mean ± SD from three experiments.
FIG. 8A-C show that endogenous H2S protects various bacteria against diverse antibiotics. (A) Representative optical density (OD) growth curves of E. coli
Attorney Docket No. 27522-0196W01
(MG1655), B. anthracis (Sterne) or P. aeruginosa (PA 14) (black squares) and their H2S-deficient counterparts (gray circles) in the presence of spectinomycin (Sp, 60 μ /ηι1), nalidixic acid (NA, 2.5 μg ml), erythromycin (Em, 1 μg/ml), or ampicillin (Amp, 125 μg/ml). Gray triangles show the growth of E. coli that overexpress 3MST. Cells were grown in triplicate at 37°C with aeration using a Bioscreen C automated growth analysis system. The curves represent averaged values from three parallel experiments with a margin of error of less than 5%. (B) Inhibitors of CSE/CSB and 3MST increase antibiotic sensitivity. Panels show representative growth curves of methicillin-resistant S. aureus (MW2), E. coli, or P. aeruginosa (black squares) in the presence of chloramphenicol (Cm, 0.5 g/ml), vancomycin (Van, 0.5 μg/ml), acriflavine (Acr, 8 μg/ml), or pyocyanin (Pyo, 50 μΜ). Inverted gray triangles and gray circles represent cellular growth in the presence of CSE/CSB and 3MST inhibitors (inh) with or without antibiotics, respectively. (C) Exogenous ¾S restores antibiotic resistance in H2S-deficient bacteria. Panels show representative growth curves of wt E. coli or B. anthracis (black squares) or H2S-deficient strains (gray circles) in the presence of gentamicin (Gm, 1 μg/ml), NA (2.5 μg/ml), cefuroxime (Cef, 20 μg/ml), and Pyo (50 μΜ). Gray triangles show growth of cells pretreated with the H2S donor (NaHS) in the presence of the indicated antibiotic.
FIG. 9 shows that H2S protects Gram(+) bacteria against chloramphenicol- mediated killing. Survival curves show the effect of CBS/CSE B. anthracis and P. aeruginosa) and 3MST (E.coli) deletions or CBS/CSE inhibition (S. aureus) by AOAA/PAG (inh) on chloramphenicol (Cm, 50 μg/ml)-mediated killing. This "bacteriostatic" antibiotic kills Gram(+) bacteria (S. aureus and B. anthracis) within a relatively short time period, but not Gram(-) E.coli and P. aeruginosa. The data suggest that Cm, and perhaps other bacteriostatic antibiotics, exert oxidative damage in Gram(+) bacteria, against which H2S provides protection, thereby improving growth in the presence of these antibiotics in liquid culture (FIG. 8B).
FIG. 10A-N show that H2S protects against antibiotic-inflicted oxidative damage. (A) H2S acts by diminishing reactive oxygen species (ROS)-mediated antibiotic toxicity. E. coli cells were pretreated with the iron chelator, 2,2'-dipyridyl (0.05 mM) or the ROS scavenger thiourea (15 mM) for 3 min, followed by treatment with Gm. Cells were grown in triplicate at 37°C with aeration using a Bioscreen C
Attorney Docket No. 27522-0196W01 automated growth analysis system. The curves represent averaged values from three parallel experiments with a margin of error of less than 5%. (B) Endogenous H2S enders cells more resistant to NA in aerobic conditions, but fails to do so in anaerobic conditions. A paper disk saturated with 20 mg/ml NA was placed on wt or CBS/CSE- deficient B. anthracis lawns that were grown aerobically or anaerobically for the next 18 hours. Zone borders are marked with dashed lines. (C) Endogenous H2S renders B. anthracis more resistant to pyocyanin in aerobic conditions, but fails to do so in anaerobic conditions. A paper disk saturated with 50 iM pyocyanin was placed on wt or CBS/SCE-deficient B. anthracis lawns that were grown aerobically or anaerobically for the next 20 hours. Zone borders are marked with dashed lines. (D) Endogenous H2S renders bacteria resistant to hydrogen peroxide. Agar plates seeded with the indicated bacteria were incubated overnight with a filter paper disk saturated with 0.125 or 0.45 M H202 placed atop the bacterial lawn. CBS/CSE- or 3MST- deficient cells formed a clear 5- to 10-mm zone around the disk, whereas wt cells grew a complete lawn and so demonstrated strong H2S-dependent resistance to hydrogen peroxide. (E) 3MST-deficent cells exhibit a much greater sensitivity to hydrogen peroxide than other cysteine desulfurase mutants. Overnight cultures of indicated E.coli strains were diluted with fresh LB 1 :50 and grown to OD600 ~1 · H202 was added to 2.5 mM for 10 min. Cell survival was determined by counting CFU and is shown as the mean ±SD from three independent experiments. (F) Rapid protective effect of H2S against oxidative stress. Wt E.coli cells were grown in LB to OD600 -1.0, treated with NaHS (200 μΜ), or the iron chelator dipyridyl (0.5 mM), or both for 1 min, followed by the addition of H202 (2 mM) for 10 min. Cell survival was determined by counting CFU and is shown as the mean ±SD from three independent experiments. (G) Inhibitors of CBS/CSE render S. aureus sensitive to hydrogen peroxide, whereas an H2S donor reverses this sensitivity. The panel shows growth curves of methicillin-resistant S. aureus (MW2) pretreated with PAG and AOAA for 3 min, followed by the addition of H202 (0.5 mM) (circles). NaSH was added to 100 μΜ prior to challenge with H202 (triangles). (H) Pulsed-field gel analysis of chromosomal DSBs. Lane 1 : 4.6 Mb linearized E. coli chromosomes (I-Scel); lanes 2 and 3: DNA from wt and DMST cells; lanes 6 to 8: DNA from wt, 3MST-deficient, and 3MST-overproducing cells after treatment with 10 mg/ml Amp; lanes 9 and 10: DNA from NaHS-treated cells after Amp treatment; and lane 1 1 : concatemers from
Attorney Docket No. 27522-0196W01
0.05 to 1.0 Mb. "% linear" indicates the relative increase in linearized chromosomal DNA. The values are the average of three independent experiments (P < 0.1). (I) ¾S protects against H2O2- and antibiotic-inflicted DNA damage. Sub-lethal amounts of H2O2 and ampicillin (Amp) inflicted greater chromosome damage in CBS/CSE- deficient B. anthracis and P. aeruginosa and 3MST-deficient E. coli cells than in wt cells. The integrity of chromosomal DNA was monitored by PCR. Representative agarose gels show chromosomal fragments amplified from equal amounts of genomic DNA isolated from wild type (wt) or mutant (Δ) cells. M, 1 kb DNA marker. "%" indicates the fraction of the full-length PCR products. Values are the averages from three experiments with a margin of error of less than 10%. (J) ¾S suppresses antibiotic-induced SOS response. Gentamicin (Gm, 20 μ§ πι1) induces fluorescence in recA' : :gfp E. coli (wt). SOS caused by Gm was greater in Asp-treated cells, but fully suppressed by exogenous NaHS. The genotoxic agent mitomycin (MMC, 0.2 μg/ml) was used as a positive control. In each case, the basal level of fluorescence before induction "was assigned a value of 1. Values are the mean ±SD from three experiments. (*) p<0.05, (**) p<0.01 . (K) Stimulating effect of H2S on H202 degrading activity and SOD activity in crude extracts of wt and 3MSTdeficient E. coli cells. Total H2O2 degrading activity was measured as described in Shatalin et al., Proc. Natl. Acad. Sci. U.S.A. 105, 1009 (2008). Catalase activity at 100% is 30 mM H2O2 min_1«mg_1. Values shown are the means ± SEM from three experiments. SOD activity was measured using a tetrazolium-based assay kit. (L) The proposed mechanism of H2S-mediated defense against antibiotics. Despite having different primary targets, many antibiotics kill bacteria by generating ROS (Asad and Leitao, J. Bacteriol. 173, 2562 (1991); Aruoma et al., J. Biol. Chem. 264, 20509 (1989)). The ability of H2S-producing enzymes (CBS, CSE, and 3MST) to alleviate oxidative stress is achieved by several mechanisms: (i) depletion of free cysteine (Cys), which fuels the Fenton reaction; (ii) inhibition of the Fenton reaction by H2S, which reacts with H2O2 and diminishes free Fe2+; (iii) stimulation of catalase and superoxide dismutase activities. Antibiotics stimulate the activities of CBS, CSE, and 3MST, thereby ensuring their specific defensive responses. (M) Effect of Cys and NaHS on Fenton-mediated DNA damage in vitro. As indicated, the supercoiled pBR322 plasmid (0.5 μg) was treated with 30 μΜ FeCl3, 4 mM Cys, 200 μΜ NaHS, or 4 mM H2O2 in 20 mM Tris-HCl buffer (pH 8). After a 30-min incubation at room
Attorney Docket No. 27522-0196WO1 temperature, the reaction was stopped and separated in a 1% agarose gel. RF, relaxed form; SF, supercoiled form. (N) Dual protective effect of H2S against oxidative stress: Catalase and SOD are required for prolonged defense against H202 toxicity mediated by NaHS but not for immediate protection. Wt, katE, and sodA E. coli cells were grown in Luria-Bertani broth (LB) to absorbance (optical density) OD600 of -1.0, treated with NaHS (200 mM) for the indicated time intervals (min), followed by the addition of H202 (2 mM) for 10 min. Cell survival was determined by counting CFU and is shown as the mean TSD from three independent experiments.
1 FIG. 11 "shows that H2S-generating CBS/CSE becomes essential in the absence of bNOS. B. anthracis (34F2Anos cbs/sce: :Pspac) cells carrying the chromosomal copy of cbs/cse under the IPTG-inducible spac promoter were plated on LBA plates with or without 0.1 mM IPTG for overnight incubation at 37°C.
FIG. 12A-F show synergistic action of H2S and NO in B. anthracis. (A) Compensatory induction of endogenous H2S and NO. In vivo production of NO in response to deletion of CBS/CSE or cefuroxime (Cef) (20 mg/ml) challenge was detected using the Cu(II)-based NO fluorescent sensor (CuFL) (Lim et al, Nat. Chem. Biol. 2, 375 (2006)) (left bars). Cells were grown in LB to OD60o of -0.5 followed by addition of freshly prepared CuFL (20 mM) and Cef. Fluorescence was measured in the total culture after 18 hours of incubation using a real-time fluorometer (PerkinElmer LS-55). H2S was measured using Pb(Ac)2 as in Fig. 4A (right bars). (B) H2S induction in response to antibiotic (erythromycin) or H202 challenge. The plot shows β-galactosidase activity (Miller units) expressed by B. anthracis cells harboring a chromosomal transcriptional fusion of the cbs/cse promoter and leader region to a promoterless lacZ gene. Bacteria were grown in LB medium until OD600 of -0.6 followed by the addition of 0.5 mg/ml erythromycin or 2 mM H202. The bottom panel shows PbS brown or black stain, which is proportional to the amount of H2S produced. B. anthracis cells were grown in 96-well plates in LB + Cys (200 mM) covered with lead acetate-soaked paper by using a Bioscreen C automated growth analysis system. (C) H2S induction in response to erythromycin or H202 challenge. E.coli cells were grown in 96 wells plates in LB+Cys (25 or 200 μΜ) covered with lead acetate soaked paper at 37°C with aeration using a Bioscreen C automated growth analysis system. Em (2.5 μg/ml) or H202 (1 mM) were added at
Attorney Docket No. 27522-0196W01
GDeoo ~0.6 for 12 hours. PbS brown/black stain is proportional to the amount of H2S. (D) Representative OD growth curves of wt (black curves), CBS/CSE-deficient (circles) or bNOS deficient (triangles) B. anthracis (Sterne) cells. Acriflavine, PAG/AOAA, NaSH, and the NOS inhibitor N-nitro-L-arginine methyl ester (L- NAME) were added as indicated. Cells were grown in triplicate at 37°C with aeration using a Bioscreeh C automated growth analysis system. The curves represent the averaged values (P < 0.05). (E) Wild type E. coli cells protect 3MST-deficient cells from antibiotic toxicity. WT and AsseA cells were grown in LB+Cys (0.5 mM) to OD600 -0.6. Then aliquots containing equal amounts of cells were mixed together, washed, resuspended in M9 minimal media supplemented with Gm ^g/ml) and incubated for 30 min at 37°C. Cell survival was determined by counting CFU and is shown as the mean ±SD from three independent experiments. (F) Protection of 3MST-deficient cells from Cys-mediated gentamicin toxicity by the thiol oxidizer diamide and NaHS. Cells grown in LB or LB+Cys (0.5 mM) to ODeoo -1 0 were washed in M9 minimal media supplemented with the thiol oxidizer diamide (25 μΜ) or NaHS (0.2 mM) or Cys (0.5 mM). After 3 min of incubation gentamicin (50 μg/ml) was added for 5 min. Cell survival was determined by counting CFU and is shown as the mean ±SD from three independent experiments.
FIG. 13 shows that AOAA was able to potentiate the effects of various antibiotics on cultures of Enterococcus faecalis. Bacterial cultures were prepared at initial inoculums of ~5xl05 CFU/ml, and aliquots of 190 μΐ per well were dispensed. Ten μΐ of the indicated antibiotic solutions were added to each well. The starting concentration for<each antibiotic solution was 2X MIC, with serial ½ dilutions. Two sets of dilutions were prepared, and 0.1 mM AOAA was added to one set. The plates were kept at 37°C and 85% humidity for 20 hours.
DETAILED DESCRIPTION OF THE INVENTION
The present invention is based in part on the discovery that microbial H2S is cytoprotective. As described in the Examples below, the present inventors have discovered that (1) bacterial cystathionine β-synthase (CBS), cystathionine γ-lyase (CSE) and 3-mercaptopyruvate sulfurtransferase (3MST) generate H2S under normal growth conditions and protect bacteria against a broad range of antibiotics, and (2) that the mechanism of H2S-mediated defense against antibiotics relies on protection
Attorney Docket No. 27522-0196W01 against oxidative stress and the DNA-damaging Fenton reaction. As described herein, endogenous microbial H2S can diminish the effectiveness of clinically used antibiotics. Thus inhibition of this "gasoprotector" may be useful as an augmentation therapy against a broad range of microbial pathogens, including bacteria, fungi and protozoa. As microbial CBS, CSE, and 3MST diverge significantly from their mammalian counterparts (see, e.g., Fig. 5A-C), it may be possible to design specific inhibitors that target these enzymes but not their mammalian orthologs.
In one aspect, the invention provides a method for treating a subject having a microbial infection, said method comprising administering to said subject a therapeutically effective amount of at least one inhibitor of endogenous H2S production by an organism (e.g., pathogenic bacteria, fungi, protozoa) causing the microbial infection. In one embodiment, the method further comprises administering a second antimicrobial compound.
In another aspect, the invention provides a method for enhancing efficacy of an antimicrobial treatment in a subject having a microbial infection, wherein said antimicrobial treatment comprises administering to the subject a first antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo, said method comprising co-administering said first compound with a therapeutically effective amount of a second compound which second compound is an inhibitor of endogenous H2S production by an organism (e.g., pathogenic bacteria, fungi, protozoa) causing the microbial infection.
In a separate aspect, the invention provides a method for sensitizing a microbial pathogen (e.g., pathogenic bacteria, fungi, protozoa) to oxidative damage comprising administering to said pathogen an effective amount of at least one inhibitor of endogenous H2S production by said pathogen. In one embodiment, the pathogen is in a subject and the inhibitor of endogenous H2S production is administered to the subject. Such sensitization can be important, for example, for facilitating mammal's own defense against infections. When mammalian immune system attempts to kill pathogens via oxidative stress, pathogens' H2S provides protection against the immune response.
14
«
Attorney Docket No. 27522-0196W01
In one embodiment, the inhibitor of endogenous H2S production useful in the methods of the present invention inhibits an H2S-generating enzyme within the organism causing the microbial infection. For example, AOAA and hydroxylamine can be used to inhibit CBS; PAG and β-cyano-L-alanine can be used to inhibit CSE; and aspartate and derivatives thereof can be used to inhibit 3MST. .: In one embodiment, the inhibitor of endogenous H2S production inhibits microbial cystathionine β-synthase (CBS) or paralogs thereof. In a specific embodiment, such CBS inhibitor can be co-administered (simultaneously in the same or separate compositions or sequentially) with an inhibitor of microbial cystathionine γ- lyase (CSE) or paralogs thereof. In a separate embodiment, the inhibitor of endogenous H2S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof. In another embodiment, the inhibitor of endogenous H2S production inhibits microbial cystathionine γ-lyase (CSE) or paralogs thereof.
In one embodiment, the inhibitor of endogenous H2S production is amino- oxyacetate (AOAA). In another embodiment, the inhibitor of endogenous H2S production is hydroxylamine. In yet another embodiment, the inhibitor of endogenous H2S production is D,L-propargylglycine (PAG). In a further embodiment, the inhibitor of endogenous H2S production is β-cyano-L-alanine. In another embodiment, the inhibitor of endogenous H2S production is aspartate or a derivative thereof. In an additional embodiment, the inhibitor of endogenous H2S production is homocysteine. In one embodiment, the inhibitors of endogenous H2S production useful in the methods of the present invention selectively inhibit H2S- generating enzynje(s) within the organism causing the microbial infection, but not H2S-generating enzyme(s) in the cells of the subject being treated. Such selective inhibitors can be identified using various screening methods known in the art, e.g., as described in International Application Publication No. WO 2011/130181.
The methods of the present invention are useful for treating acute or chronic infections caused by various microorganisms, including, e.g., bacteria, fungi and protozoa. Non-limiting examples of encompassed bacterial genera include, e.g., Bacillus, Brucella, Clostridium, Enterococcus, Escherichia, Francisella, Helicobacter, Klebsiella, Legionella, Listeria, Mycobacterium, Pseudomonas, Salmonella, Shigella, Staphylococcus, Streptococcus, Trypanosoma, Vibrio, and
Attorney Docket No. 27522-0196 WO 1
Yersinia. In one specific embodiment, bacteria are from a species selected from the group consisting of E. coli, S. aureus, B. anthracis, and P. aeruginosa.
Non-limiting examples of microbial infectious diseases which can be treated by the methods of the present invention include, e.g., pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis, malaria, trachoma, leishmaniasis, chagas disease, trichomoniasis, lyme disease, and leprosy.
The methods of the present invention can be used to treat infections in various animals, including, e.g., mammals, birds and fish. In one specific embodiment, the methods of the present invention are used to treat infections in humans.
Examples of antimicrobial compounds that can be used in the methods provided herein include, without limitation, quinolones, acridines, phenothiazines, aminoglycosides/' macrolides, amphenicols, steroids, ansamycins, antifolates, polymyxins, glycopeptides, cephalosporins, and lactams. For example, a method as provided herein can include administration of an antimicrobial compounds selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, jbsamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7-diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam, and carbenicillin. Other antimicrobial compounds that can be used include, for example, those listed in Tables 1 and 2, below.
In some embodiments, the methods provided herein also can include further administering an inhibitor of endogenous microbial NO production or an NO scavenger.
Non-limiting examples of useful inhibitors of endogenous NO production include L-arginine, N G -monomethyl-L-arginine (NMMA), N G -nitro-L-arginine methyl ester (NAME), N G -nitro-L-arginine (NNA), N G -amino-L-arginine (NAA),
Attorney Docket No. 27522-0196WO1
N G ,N G -dimethylarginine (asymmetric dimethylarginine, called ADMA), L- Thiocitrulline, S-methyl-L-Thiocitrulline, diphenyleneiodonium chloride, 2-(4- carboxyphenyl)-4,4,5,5-tetramethylimidazoline-l -oxy 3-oxide, 7-nitroindazole, N(5)- (l-iminoethyl)-L-ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L- citrulline, S-methylisourea, and 2-mercaptoethylguanidine. See, also, the inhibitors disclosed in Hobbs et al. (1999) Annu. Rev. Pharmacol. Toxicol. 39: 191-220; and Salard et al. (2006) J. Inorg. Biochem. 100:2024-2033. In some embodiments, iNOS- specific inhibitors can be particularly useful.
NO scavengers include, without limitation, non-heme iron-containing peptides or proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferrioxamine, pyridoxal isonicotinoyl hydrazone (PIH) , 1,2- dimethyl-3hydroxypyrid-4-one (LI) , [+] 1, 2-bis (3,5-dioxopiperazine-lyl)propane (ICRF-187), 2-(4-carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl-l- oxy-3-oxide (Carboxy-PTIO), and the like. A particularly useful NO scavenger may be a perfluorocarbon emulsion, as disclosed in Rafikova et al. (2004) Circulation 110(23):3573-3580.
In conjunction with the methods of the present invention, provided herein are various combination pharmaceutical compositions. In one embodiment, the invention provides a pharmaceutical composition comprising (i) an antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo and (ii) an inhibitor of microbial endogenous H2S production. In a specific embodiment, this composition further comprises (iii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger. In a separate embodiment, the invention provides a pharmaceutical composition comprising (i) an inhibitor of microbial endogenous H2S production and (ii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
The compounds described herein can be formulated into pharmaceutical compositions and formulations. Compounds therefore can be admixed, encapsulated, conjugated or otherwise associated with one or more pharmaceutically acceptable carriers and/or other molecules, molecular structures, or mixtures of compounds such as, for example, liposomes, polyethylene glycol, receptor targeted molecules, for oral, topical or other formulations, for assisting in uptake, distribution and/or absorption.
Attorney Docket No. 27522-0196W01
Methods for formulating and subsequently administering therapeutic compositions are well known to those skilled in the art. Dosing generally is dependent on th&. severity and responsiveness of the disease state to be treated, with the course of treatment lasting from several days to several months, or until a cure is effected or a diminution of the disease state is achieved. Persons of ordinary skill in the art routinely determine optimum dosages, dosing methodologies and repetition rates. Optimum dosages can vary depending on the relative potency of individual compounds, and can generally be estimated based on EC50 found to be effective in in vitro and in vivo animal models. Typically, dosage is from 0.01 μg to 100 g per kg of body weight, and may be given once or more daily, biweekly, weekly, monthly, or even less often. Following successful treatment, it may be desirable to have the patient undergo maintenance therapy to prevent the recurrence of the disease state.
Pharmaceutical compositions can be administered by a number of methods, depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration can be, for example, topical (e.g., transdermal, sublingual, ophthalmic, or intranasal); pulmonary (e.g., by inhalation or insufflation of powders or aerosols); oral; or parenteral (e.g., by subcutaneous, intrathecal, intraventricular, intramuscular, or intraperitoneal injection, or by intravenous drip). Administration can be rapid (e.g., by injection) or can occur over a period of time (e.g., by slow infusion or administration of slow release formulations). For treating tissues in the central nervous system, compounds can be administered by injection or infusion into the cerebrospinal fluid, typically with one or more agents capable of promoting penetration of the polypeptides across the blood-brain barrier.
Definitions ,.. The term .-"about" means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, "about" can mean within an acceptable standard deviation, per the practice in the art. Alternatively, "about" can mean a range of up to ±20%, preferably up to ±10%, more preferably up to ±5%, and more preferably still up to ±1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 2-fold,
Attorney Docket No. 27522-0196WO 1 of a value. Where particular values are described in the application and claims, unless otherwise stated, the term "about" is implicit and in this context means within an acceptable error range for the particular value.
As used herein, the term "paralogs" (of CBS, CSE, and 3MST) refers to homologous sequences within a microbial genome which result from a gene duplication event. The CBS, CSE, and 3MST paralogs encompassed by the present invention may have altered functional properties as compared to CBS, CSE, and 3MST, but are still involved in or affect the endogenous microbial H2S production.
As used herein, the term "compromised by H2S or natural products of H2S metabolism" refers to antimicrobial compounds which become less effective in the presence of H2S or natural products of H2S metabolism (i.e., any sulfur-containing organic [e.g. cysteine, glutathione] or inorganic [e.g., FeS, NaHS] products of H2S metabolism). This term encompasses complete and partial loss of antimicrobial activity of a given compound. In the context of the present invention insofar as it relates to any of the disease conditions recited herein (e.g., infection), the terms "treat," "treatment," and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition.
The terms "administering" or "administration" are intended to encompass all means for directly and indirectly delivering a compound to its intended site of action. The compounds of the present invention can be administered locally to the affected site (e.g., by direct injection into the affected tissue) or systemically. The term "systemic" as used herein includes parenteral, topical, oral, spray inhalation, rectal, nasal, and buccal administration. Parenteral administration includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional, and intracranial administration.
As used herein, the term "therapeutically effective" applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Within the context of the present invention, the term "therapeutically effective" refers to that quantity of a compound (e.g., an inhibitor of endogenous · H2S production or its
Attorney Docket No. 27522-0196W01 combination with a second antimicrobial compound and/or an inhibitor of endogenous microbial NO production or an NO scavenger) or pharmaceutical composition containing such ""compound that is sufficient to delay manifestation, arrest the progression, relieve or alleviate at least one aspect of an infection. Note that when a combination of active ingredients is administered the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually.
:: The phrase "pharmaceutically acceptable," as used in connection with compositions of the invention, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to an animal (e.g., a human). Preferably, as used herein, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
The term "subject" refers to any animal, including, e.g., mammals, birds and fish, and, in particular, humans.
As used in this specification and the appended claims, the singular forms "a," "an," and "the" include plural references unless the context clearly dictates otherwise. In accordance with the present invention, there may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art. See, e.g., Sambrook, Fritsch and Maniatis, Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989; DNA Cloning: A Practical Approach, Volumes I and II (Glover ed. 1985); Oligonucleotide Synthesis (Gait ed. 1984); Nucleic Acid Hybridization (Hames and Higgins eds. 1985); Transcription and Translation (Hames and Higgins eds. 1984); Animal Cell Culture (Freshney ed. 1986); Immobilized Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide To Molecular Cloning (1984); and Ausubel et al. eds., Current Protocols in Molecular Biology, John Wiley and Sons, Inc. 1994, among others.
Attorney Docket No. 27522-0196W01
The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.
EXAMPLES Example 1 - Materials and methods
Strains and growth conditions: E. coli, S. aureus, and P. aeruginosa strains were grown in Luria-Bertani (LB) broth or on LB plates supplemented with 1.5% Bacto agar at 37°C. -B. anthracis strains were grown in BHI media supplemented with glycerol at 37°C. Construction of sseA deletion and sseA overexpression strains of E. coli were produced according to Datsenko and Wanner (34). Briefly, an attL- KmK-attR cassette (35) was amplified with primers 5'- atgcgtgagaatttacgttatgtaattcagtatcaccgctcaagttagtataaaaaagct-3' (SEQ ID NO: 1) and 5'-ttamcactggctcaaccggtaaatctgcccgcgtgaagcctgcttttttatactaag-3' (SEQ ID NO: 2) and transformed into an MG1655 strain containing p D46. sseA mutants were selected on LB agar supplemented with Km and verified by PCR with primers 5'- attagcatgcaggcggctac-3' (SEQ ID NO: 3) and 5'-tgctggaaaggccgcgaa-3' (SEQ ID NO: 4).
To construct an sseA overexpression strain, the sseA promoter was substituted for Puet-oi (24). Briefly, an attL-CmR-attR cassette (35) was amplified with primers 5'-cgcagatcttgaagcctgcttttttatac-3' (SEQ ID NO: 5) and 5'-cgctcaagttagtataaaaaagct-3' (SEQ ID NO: 6) and ligated with Puet-oi obtained with primers 5'-cgcagatctcgagtccctatcagtg-3' (SEQ ID NO: 7) and 5'-aatttctcctctttccatgg-3' (SEQ ID NO: 8). A Puet-oi- attL-CmR-attR cassette was then amplified with primers 5'-ccctgccacaatggcccgttagcaacgtcgaataacgctcaagttagtataaaaaagct-3' (SEQ ID NO: 9) and 5'-gtgatactgaattacataacgtaaattctcacgcatggtacctttctcctctttaatga-3' (SEQ ID NO: 10). The first primer contains the upstream region of sseA and sequence of attR, while the second primer contains the coding region of sseA and sequence of Puet-oi- The PCR fragment was transformed into MG1655 containing pKD46. CmR clones were tested in the presence of the PLtet-oi-a#£-CmR-ttR cassette by PCR with primers 5'- attagcatgcaggcggctac-3' (SEQ ID NO: 1 1) and 5'-gcaaaagaggctgatttggct-3' (SEQ ID
Attorney Docket No. 27522-0196WO!
NO: 12).
E. coli metB, metC, malY, cysM, cysK, and tnaA deletion mutants were obtained from the E. coli Keio Knockout Collection (Thermo Scientific).
The B.anthracis nos deletion strain Sterne 34F2 was described previously (28). The conditional KO (CO) of cbs/cse in B.anthracis 34F2 was made, using a protocol described in Fisher and Hanna, J. Bacteriol. 187, 8055 (2005). The 0.5 kb fragment of cbs from -20 to 480 with respect to the translational start site was amplified from 34F2 genomic DNA by using primers designed for use in the Gateway cloning system (Invitrogen). The upstream primer had the sequence 5'- ggggacaagtttgtacaaaaaagcaggctAAGGGGGAGAACACGATGAATG-3' (SEQ ID NO: 19; RBS and start codon underlined), and the downstream primer had the sequence 5'-ggggaccactttgtacaagaaagctgggtgtgccgaccaaagttcaggac-3' (SEQ ID NO: 20). The resulting amplicon was transferred to pDONRtet using standard BP reaction conditions (Invitrogen), followed by transformation of competent DH10B E.coli and selection on LB plates containing 10 μg/ml of tetracycline. Cloned amplicons were transferred to pNFdl 3 (Ts pE194 ori) under the spac promoter using the standard LR reaction (Invitrogen), followed by transformation of DH10B E. coli and selection on LB plates containing 50 μg/ml Km. Integration of the plasmid into the targeted B. anthracis locus was done at 39°C essentially as described in Fisher and Hanna, J. Bacteriol. 187, 8055 (2005). The nos deletion in the resulting 34F2 cbs/cse: :pNFd 13 strain was obtained as described in Shatalin et al., Proc. Natl. Acad. Sci. U.S.A. 105, 1009 (2008), except that a spectinomycin cassette was used instead of Km.
The P. aeruginosa PA- 14 wt and PA- 14 cbs mutant strains were obtained from Massachusetts General Hospital's P. aeruginosa mutants collection (Department of Molecular Biology, Richard B. Simches Research Center.
Generation of growth curves: Growth curves were obtained on a Bioscreen C automated growth analysis system (Oy Growth Curves Ab Ltd.). Subcultures of specified strains "were grown overnight at 30°C, diluted 1 : 100 in fresh media and grown to OD600 ~0.8 at 37°C. Cultures were then diluted 1 : 100 in LB or BHI media with appropriate antibiotics or reagents as described in the text or figure legends. 300 μΐ of each mixture was inoculated into honeycomb wells in triplicate and grown at
Attorney Docket No. 27522-0196W01
37°C with maximum shaking on the platform of the Bioscreen C instrument. ODeoo values determined were recorded automatically at different times and the means of the triplicate cultures^were plotted.
Generation of survival curves: Overnight cultures were inoculated into LB supplemented with 0.5 mM Cys and grown at 37°C to ~ 2x107 cells per ml. Then cells were diluted 100 times in sterile 0.9% NaCl and treated by Gm (50 μg/ml) or Km (250 μg/ml) or Cm (70 μg/ml for P. aeruginosa strains and 35 μg/ml for other strains) at room temperature in. the presence or absence of 0.2 mM of NaHS. CBS/CSE inhibitors, 0.5 mM PAG and 50 μΜ AOAA, were used in experiments with WT S. aureus and P. aeruginosa. At different times samples of cells were placed on LB agar and incubated at 37°C for 16-18 hours. Cell survival was determined by counting CFU and is shown as the mean ± SD from three independent experiments.
H2S detection: To monitor ¾S production in wild type (wt) and mutant cells, a lead acetate detection method was used (7). Paper strips saturated with 2% Pb(Ac)2 were affixed to the inner wall of a culture tube, above the level of a liquid culture of wild type or mutant bacteria. Overnight cultures were diluted 1 :50 in LB or BHI without or with Cys (25 - 500 μΜ), and incubated 18-20 hours at 37°C with aeration. Stained paper strips were scanned and quantified with an Alphalmager (Imgen Technologies; Alexandria, VA). The results were normalized per ODs. Assay of chromosomal DNA damage: The assay was done as described previously (28). Cells were grown to OD6oo = 1.0 in LB media and treated with H2O2 (1 mM - E. coli; 2 mM - B. anthracis; 2.5 mM - P. aeruginosa) or antibiotics Em ( 1 g/ml - B. anthracis); Ap (10 g/ml - E. coli; 125 g/ml - P. aeruginosa) for 4 hours. Cells were equalized to OD6oo= 0 by addition of fresh media and the cells from 2 ml of the equalized cultures were harvested by centrifugation. Total genomic DNA was isolated from the bacteria pellets with a QIAamp DNA Mini Kit (Qiagen; Valencia, CA) or according the GenElute Bacterial Genomic DNA Kit protocol for Gram Positive Bacteria (Sigma; St. Louis, MO). DNA was extracted with phenol/chloroform and quantified with the PicoGreen dsDNA quantitation reagent (Molecular Probes®; Invitrogen; Carlsbad, CA) and λ phage DNA as a standard. An arbitrarily chosen 10-kb, 6-kb, and 5.8-kb fragments of E.coli, B. anthracis and P. aeruginose genomes, respectively, were used for qPCR. Primer sequences were as
Attorney Docket No. 27522-0196W01 follows: E.coli 5'-ttccattgggatgtagatgctg-3' (forward; SEQ ID NO: 13) and 5'- ggtaaaagagtcaagggaagaacc-3' (reverse; SEQ ID NO: 14), B.anthracis 5'- acgctttgacttctctcacttcggt-3' (forward; SEQ ID NO: 15) and 5'-aaacatttgctcttgatgtcctgga-3' (reverse; SEQ ID NO: 16), P.aeruginose 5'-ctttgcaacctgtacatgccttg-3' (forward; SEQ ID NO: 17) and 5'- catcgtagtagttgatcggatggac-3' (reverse; SEQ ID NO: 18). PCR was performed with Phusion DNA polymerase (Finnenzymes). The 50-μ1 PCR mixture contained 0.5 ng of genomic DNA as a template, 1.5 μΜ primers, 200 μΜ dNTPs (Fermentas), 5μ1 Phusion GC PCR buffer, and 0.5 μΐ of DNA polymerase. DNA was subjected to 29 cycles of PCR (98°C for 30 seconds, 53°C for 30 seconds, and 72°C for 3 or 9 minutes). PCR products were separated by electrophoresis in a 0.8% or 1% agarose gel, stained with ethidium bromide, scanned, and quantified with an Alphalmager (Imgen Technologies).
Electrophoresis Assay of DNA damage in vitro (Fenton reaction): The nicking reaction mixture contained 0.1 μg pBR322 plasmid DNA in 20 mM Tris HC1 buffer, pH 8.0, 30 μΜ FeCb, 4 mM Cys and 4 mM H2O2, in the presence or absence of 0.2 mM NaHS. After incubating the mixture at room temperature for 15 min the DNA samples were applied to an 0.8% agarose gel in a TAE buffer system, and electrophoresis was performed at 80 V for 30 min. Following electrophoresis, gels were stained with ethidium bromide for 30 min. After washing, the bands were visualized in a UV transilluminator. The modification of the fluorescence intensity of the bands is due to DNA strand breakage that leads to a decrease in the proportion of the supercoiled form and to an increase in the relaxed form produced by a nick in one strand. w/se Field Gel Electrophoresis (PFGE): E. coli cells were grown to OD6oo~0.8 at 32°C. 200 μΜ of NaHS, 10 μg/ml of Ap, or ImM of peroxide were added as indicated and cells were allowed to grow at 37°C for 4 more hours. Agarose plugs were prepared using 3xl08 cells/plug and treated with lysozyme and Proteinase K according to the BioRad CHEF protocol (Bio-Rad Laboratories; Hercules, CA). Linearized 4.6 Mb E. coli chromosomal DNA marker was made by digesting the genomic DNA plug of SMR8476 strain with I-Scel endonuclease. DNA fragments were separated on a 1 % agarose gel in 0.5x TBE at 14°C for 24 hours at 6 V/cm using a Bio-Rad CHEF-DR II angle system with a 2.8-26.3 second linear switch time ramp.
Attorney Docket No. 27522-0196WO1
Gels were stained with EtBr and visualized with UV-trans-illumination. DNA was quantified (integrated density of the linear products) using ImageJ software.
CBS/CSE expression assay: B. anthracic Stern 34F2 cbs/cse::pNFdl3 cells (see above) carrying the lacZ reporter under the native cbs promoter were used. To monitor expression of cbs-lacZ fusions, bacteria were grown overnight at 37°C in LB medium, washed and diluted 1 :25 in fresh medium containing erythromycin or H2O2 at the specified concentrations. Cultures were incubated for 2-2.5 hr at 37°C
before measurement of β-galactosidase activity. Shown β- galactosidase activities correspond to mean values from at least three independent experiments. Error bars correspond to the standard deviation. ε Assays of4he SOS response: Overnight cultures of strain 10973 harboring a recA '-gfp chromosomal fusion (18) was grown in Luria broth with kanamycin (20 g/ml). The cultures were diluted in LB to OD600 = 0.1 and grown at 37°C to an OD6oo ~1.0. Asp (3 mM), Gm (5 Mg/ml) and NaHS (200 μΜ) were added at OD600 = 0.5. Fluorescence was measured (Ex. wave length: 480 nm and Em. wavelength: 520 nm) in a Perkin Elmer LS55 spectrofluorometer (Perkin Elmer; Waltham, MA). Fluorescence values were normalized to OD600 values and plotted.
Catalase Activity Assay: Degradation of H2O2 was monitored in real time as a decrease in absorbance at 240 nm (37). Aliquots of extracts to be monitored or of pure catalase were mixed with 50 mM phosphate buffer (pH 7.0) and placed into a 1 ml quartz cuvette. 40 mM H2O2 solution was added and the kinetics of its degradation recorded. Total .H2O2 degrading activity was measured as the decrease of H2O2 concentration per milligram of total protein per second. OD240 was converted to the concentration of H2O2 according to the calibration curve (10 mM H202 = 0.36 OD24o)- Superoxide Dismutase (SOD) Activity Assay: Superoxide dismutase activity of cell extracts was determined using the Cayman Chemical Company Superoxide Dismutase Assay Kit (Cat#706002; Cayman Chemical Co.; Ann Arbor, MI) according to the manufacture's recommendations.
Chemicals and reagents: All chemicals were from Sigma, except PYO and the Superoxide dismutase assay kit, which were purchased from Cayman. The CuFL
Attorney Docket No. 27522-0196 WO 1
NO sensor was provided by Dr. S. Lippard, MIT. See, Shatalin et al., Proc. Natl. Acad. Sci. U.S.A. 105, 1009 (2008).
Example 2 - Bacterial CBS. CSE. and 3MST generate H?S under normal growth conditions To determine whether CBS, CSE, or 3MST produces H2S in bacteria, each enzyme was inactivated genetically or chemically in four clinically relevant and evolutionarily distant pathogenic species: Bacillus anthracis (Sterne), Pseudomonas aeruginosa (PA14 , Staphylococcus aureus (MSSA RN4220 and MRSA MW2), and Escherichia coli (MG1655). The first three species have the CBS/CSE operon, but not 3MST, whereas E. coli carries 3MST, but not CBS/CSE. The chromosomal organization of H2S genes (Fig. 3) and the strategy used for their replacement prevented any polar effects. H2S production was monitored in wild-type (wt) and mutant cells using lead acetate [Pb(Ac)2], which reacts specifically with H2S to form a brown lead sulfide stain. The rate of change of staining on a Pb(Ac)2-soaked paper strip is directly proportional to the concentration of H2S (Forbes, Bailey and Scott's Diagnostic Microbiology (Mosby, St. Louis, MO, ed. 10, 1998)). Deletion of CBS/CSE in B. anthracis and P. aerugenosa or 3MST in E. coli greatly decreased or eliminated PbS staining (Fig. 4A). Similar results were obtained when DL- propargylglycine (PAG), aminooxyacetate (AOAA), or Asp were used, respectively, as specific inhibitors of CSE, CBS, or 3MST (Fig. 4 A). Addition of Cys markedly increased PbS staining for all wt, but not CSE-CBS- or 3MST-deficient bacteria (Fig. 4B). In addition, overexpression of the chromosomal 3MST gene from a strong pLtetO-1 promoter in E. coli resulted in increased production of H2S (Fig. 4A). Based on the above data, it can be concluded that all three enzymes produce H2S endogenously from Cys during exponential growth of bacteria in rich media.
Further experiments demonstrated that 3MST is the major source of H2S in E.coli. In addition to 3MST (sseA), the E. coli genome encodes several other enzymes that could potentially generate ¾S. These include cystathionine-y-synthase MetB, cystathionines-synthases MetC and MalY, and CysM, CysK, and TnaA, which all are cysteine desulfurases (27). Pb(Ac)2 analysis of individual strains harboring knockopts of each of these genes indicates that 3MST is the major source of H2S production under specified growth conditions (Fig. 4C).
Attorney Docket No. 27522-0196 WO 1
Example 3 - Endogenous H?S protects bacteria against a broad range of antibiotics
To elucidate the physiological role of H2S, wt and 3MST-deficient E. coli were compared in a phenotype microarray (P A) (Fig. 5 and Table 1). Whereas these strains showed little or no growth defects (Fig. 6), a large number of antibiotics, highly diverse in structure and function, preferentially suppressed growth of 3MST- deficient cells (Tables 1 and 2). The killing and growth curves obtained for wt and 3MSTand CBS/CSE mutant E. coli, P. aerugenosa, S. aureus, and B. anthracis in the presence of several representative antibiotics confirmed the results of the screen and generalized them to both Gram-positive and -negative species (Figs. 7-9). 3MST overexpression resulted in increased resistance to spectinomycin (Fig. 8A), whereas chemical inhibition of CBS, CSE, or 3MST rendered bacteria more sensitive to different antibiotics (Fig. 7 and 8B). An H2S donor, NaHS, suppressed the antibiotic sensitivity of CBS-CSE- and 3MST-deficient cells (Fig. 7, 8C and 9). Taken together, these results establish that endogenously produced H2S confers antibiotic resistance. Example 4 - FbS protects bacteria against oxidative stress and antibiotic-inflicted oxidative damage
H2S-mediated cytoprotection resembles that of NO, which defends certain Gram-positive bacteria against some of the same antibiotics as does H2S (I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009)). NO-mediated protection relies, in part, on its ability to defend bacteria against oxidative stress imposed by antibiotics (I. Gusarov, E. Nudler, Proc. Natl. Acad. Sci. U.S.A. 102, 13855 (2005); K. Shatalin et al., Proc. Natl. Acad. Sci. U.S.A. 105,1009 (2008); and I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009)). To examine whether H2S acts by a similar mechanism, detailed analyses of its effect on bacterial killing by representative antibiotics (gentamicin (Gm), ampicillin (Ap), and nalidixic acid (NA)) were conducted (Fig. 10). All three antibiotics have been shown to exert their bactericidal effect via oxidative stress (I. Gusarov, K. Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009); and M. A. ohanski, D. J. bwyer, B. Hayete, C. A. Lawrence, J. J. Collins, Cell 130, 797 (2007)). Indeed, pretreatment of cells with 2,2'-dipyridyl, an iron chelator that suppresses the damaging Fenton reaction (N. R. Asad, A. C. Leitao, J. Bacterid. 173, 2562 (1991 )), or the hydroxyl radical scavenger thiourea, substantially decreased the toxicity of Gm
Attorney Docket No. 27522-0196WO1
(Fig. 10A). Wild type and H2S-deficient cells became equally resistant to Gm in the presence of dipyridyl or thiourea (Fig. 10A). Moreover, the H2S donor added together with Gm was as effective as dipyridyl or thiourea in protecting against antibiotics, but failed to further protect cells that had already been pretreated with antioxidants (Fig. 10A). Thus, H2S, like NO, acts by suppressing the oxidative component of antibiotic toxicity.
Consistently, H2S-generating enzymes provided protection against antibiotics only under aerobic conditions. As shown in Figs. 10B and I OC, nalidixic acids (NA) and pyocyanin, respectively, were considerably less potent against CBS/CSE- deficient B. anthracis in anaerobic growth conditions than in aerobic conditions. Such a substantial difference supports the notion that these antibiotics kill bacteria in large part by causing oxidative stress (I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009); M. A. Kohanski, D. J. Dwyer, B. Hayete, C. A. Lawrence, J. J. Collins, Cell 130, 797 (2007); and M. A. Kohanski, D. J. Dwyer, J. J. Collins, Nat. Rev. Microbiol. 8, 423 (2010)). Because H2S completely fails to protect against NA in anaerobic conditions, it can be concluded that, at least in the case of this quinolone, all the protective effect of H2S can be attributed to its ability to mitigate the oxidative damage caused by the antibiotic. These results also suggest that the effectiveness of many antibiotics whose potencies have been associated with oxidative stress (I. Gusarov, K. Shatalin, M. Starodubtseva, E. Nudler, Science 325, , 1380 (2009); and M. A. Kohanski, D. J. Dwyer, B. Hayete, C. A. Lawrence, J. J. Collins, Cell 130, 797 (2007)) would be compromised during infections caused by anaerobic bacteria such as Bacteroides or Clostridium. It remains to be determined to what extent H2S production by bacteria during aerobic and anaerobic infection contributes to antibiotic resistance. However, considering the parallels between NO and H2S production by bacteria (Fig. 12) and the essential role of bacterial NO in survival of germinating B. anthracis in macrophages (K. Shatalin et al., Proc. Natl. Acad. Sci. U.S.A. 105, 1009 (2008)), it is possible that H2S-mediated protection against oxidative stress contributes to bacterial infection and antibiotic resistance as well.
The above results suggested that H2S bolsters the antioxidant capacity of bacterial cells. Indeed, H2S-deficient B. anthracis, E. coli, S. aureus, and P.
Attorney Docket No. 27522-0196WO1 aeruginosa displayed higher susceptibility to peroxide than their wt counterparts, whereas NaHS rendered them more resistant to the peroxide (Figs. 10D-10G).
Formation1 of double-strandDNAbreaks (DSBs) is the primary cause of bacterial death from peroxide (O. I. Aruoma, B. Halliwell, E. Gajewski, M. Dizdaroglu, J. Biol. Chem. 264, 20509 (1989); and S. I. Liochev, I. Fridovich, IUBMB Life 48, 157 (1999)). These DSBs result from the Fenton reaction (J. A. Imlay, Annu. Rev. Microbiol. 57, 395 (2003)), which also can be triggered by antibiotics (I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009); M. A. Konanski, D. J. Dwyer, B. Hayete, C. A. Lawrence, J. J. Collins, Cell 130, 797 (2007); M. A. Kohanski, D J. Dwyer, J. J. Collins, Nat. Rev. Microbiol. 8, 423 (2010); and B. W. Davies et al., Mol. Cell 36, 845 (2009)). To examine whether ¾S protects bacteria from the damaging Fenton reaction, chromosomal DNA integrity was monitored by pulsed-field gel electrophoresis (PFGE) (Fig. 10H). The intact E. coli chromosome does not migrate into the agarose gel but remains at the origin (B. Birren, E. Lai, Pulsed-Field Gel Electrophoresis: A Practical Guide (Academic Press, New York, 1993)), whereas linear chromosomes containing a single DSB migrate as a 4.6-Mb species (Fig. 10H, lane 1). Absent antibiotic or H2O2, DNA isolated from wt or FtS-deficient cells was retained almost entirely at the origin (lanes 2 and 3). However, treatment of cells with a sublethal dose of H2O2 or ampicillin resulted in a greater linearization (DSBs) of the chromosome in 3MST- deficient cells (lanes 4 and 6). Overexpression of 3MST suppressed this linearization (lane 8), as did treatment with NaHS (lanes 9 and 10). These results were corroborated by polymerase chain reaction (PCR) analysis of B. anthracis, E. coli, and P. aeruginosa genomic DSBs as a function of H2S production (Fig. 101) and further supported by the ability of H2S to suppress the Gm-induced SOS response (Fig. 10J). Taken together, these results directly implicate endogenous ¾S in the mitigation of chromosomal damage inflicted by antibiotics.
The antioxidant effect of endogenous H2S can also be explained, in part, by its ability to augment the activities of catalase and superoxide dismutase (SOD) (Fig. 10 ). The rate of H2O2 degradation in crude extracts of wt E. coli cells was > 1.5 times that of 3MST-deficient cells and was increased further in cells that
Attorney Docket No. 27522-0196W01 overexpressed 3MST (Fig. 10K). SOD activity also was proportional to the level of 3MST expression (Fig. 1 OK).
The extenj of genomic DSBs can be assessed by PCR of an arbitrarily chosen segment of the bacterial chromosome (I. Gusarov, E. Nudler, Proc. Natl. Acad. Sci. U.S.A. 102, 13855 (2005)). In this assay, equal amounts of genomic DNA from wt and mutant cells grown with or without antibiotics or H2O2 were isolated for PCR. The number of reaction cycles was selected so that DSBs influenced the yield of the final PCR product. The yield of the PCR product from exponentially growing, ¾S- deficient B. anthrflcis, E. coli, or P. aeruginosa treated with H2O2 or antibiotics was substantially lower than that from similarly treated wt cells (Fig. 101).
To further implicate H2S in genome maintenance, its effect on the SOS response was monitored using a chromosomal recA-gfp gene fusion (M. ostrzynska, K. T. Leung, H. Lee, J. T. Trevors, J. Microbiol. Methods 48, 43 (2002)). Addition of a sub-lethal amount of gentamicin induced significant GFP fluorescence (Fig. 10J). However, induction of RecA by the antibiotic was more pronounced in aspartate- treated (3MST-compromised) cells than in untreated cells (Fig. 10J). NaHS completely suppressed the hyper-induction of SOS by gentamicin.
Thus, H2S increases bacteria resistance to oxidative stress and antibiotics by a dual mechanism (Fig. 10L) of suppressing the DNA-damaging Fenton reaction via Fe2+ sequestration (Figs. 10A, 10F, and 10M) and stimulating the major antioxidant enzymes catalase and SOD (Fig. 10K). The latter is essential for long-term protection but is less important during the first moments of oxidative stress. Indeed, katE and sodA E. coli mutants are well protected by NaHS during the first minutes of H2O2 exposure but then quickly lose viability (Fig. 10N). Taken together, these results directly implicate endogenous H2S in the mitigation of chromosomal damage inflicted by antibiotics, and indicate that endogenous ¾S renders bacteria more resistant to oxidative stress and antibiotics by suppressing the DNA-damaging Fenton reaction.
Example 5 - Endogenous H7S and NO act svnergisticallv ■-· This cytoprotective mechanism of H2S parallels that of NO (I. Gusarov, K.
Attorney Docket No. 27522-0196WO1
Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009)), which suggests that bacteria that produce both gases may benefit from their synergistic action. To test this hypothesis, the effect of simultaneously inhibiting H2S and NO on B. anthracis growth was examined. A strain of B. anthracis in which both bacterial nitric oxide synthase (bNOS) and CBS/CSE were genetically inactivated could not be generated, suggesting that the absence of both gases is incompatible with B. anthracis survival. Indeed, B. anthracis Anos cells containing an isopropylb-D-thiogalactopyranoside (IPTG)-inducible CBS/CSE conditional knockout could grow only in the presence of IPTG (Fig. 1 1). Notably, the amount of NO produced in H2S-deficient cells or the amount of H2S produced in NO-deficient cells was greater than that produced in wt cells (Fig. 12A), which indicated that one gas compensates for the lack of the other. Also, the activity of both CBS/CSE and bNOS was stimulated in response to antibiotics (Fig. ^ 12 A). Moreover, H2O2 and antibiotics (e.g., erythromycin) substantially induced CBS/CSE gene expression (Fig. 12B) and H2S production (Figs. 12B and 12C). Furthermore, chemical inhibition of CBS/CSE in bNOS-deficient cells or inhibition of bNOS in CBS/CSE-deficient cells sensitized B. anthracis to antibiotics to a much greater extent than did each mutation alone (Fig. 12C). These results in concert with previous results (I. Gusarov, . Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380 (2009)) demonstrate the synergistic and specific protective effects of H2S and NO against antibiotics. Notably, in contrast to bNOS, which is present in only a small number of Gram-positive species (I. Gusarov et al., J. Biol. Chem. 283, 13140 (2008)), H2S enzymes are essentially universal (Fig. 1A). Because H2S equilibrates rapidly across cell membranes, a fraction of cells that generate this gas in culture or in biofilms could, in principle, defend the entire population. Indeed, wt E. coli cells* effectively protect 3MST-deficient cells from Gm toxicity in exponentially growing coculture (Fig. 12E).
Because endogenous H2S diminishes the effectiveness of many clinically used antibiotics, the inhibition of this "gaskeeper" should be considered as an augmentation therapy against a broad range of pathogens. Bacterial CBS, CSE, and 3MST have diverged substantially from their mammalian counterparts (Fig. 2), suggesting that it is possible to design specific inhibitors targeting these enzymes.
Attorney Docket No. 27522-0196 WO 1
Table 1. List of chemicals that selectively inhibit the growth of E.coli sseA
(3MST-deficient) strain. The results are provided by Phenotype MicroArray (Biolog, Inc). The relative ..values of growth inhibition (negative numbers) are presented in the table (see Fig. 8 for raw data).
AsseA inhibition
Map position of growth Chemical
PM12B D09,D10,D12 -265 Novobiocin
PM16A B01,B02 -212 Norfloxacin
PM11C E09,E10 -183 Nalidixic acid
-PM13B Bll ,: -117 Oxolinic acid
PM14A A01,A02,A03 -295 Acriflavine
PM14A B02.B03 -142 9 -Aminoacridine
PM20B D03 -93 Proflavine
PM13B G09,G10,G12 -372 Trifluoperazine
PM14A H05,H06 -262 Promethazine
PM17A D09,D10 -251 Chlorpromazine
PM16A E01,E02,E03 , E04 -421 Streptomycin
..PM20B A05.AQ6 -179 Apramycin
PM13B . H09,H10,H11,H12 -520 Tylosin
PM15B F05, F06, F07 -498 Oleandomycin
PM11C F05(F06,F07,F08 -468 Erythromycin
PM19 A01,A02 -294 Josamyci
PM12B H01,H02 -235 Spiramycin
PM20B H09,H10 -203 Troleandomycin
PM11C F01, F02 -136 Chloramphenicol
PM15B C05,C06 -271 Fusidic acid
"PM16A E09,E10,E11,E12 -352 Rifamycin SV
PM16A B09,B10 -212 Trimethoprim
2, 4-Diamino-6, 7-
PM12B E01,E02,E03 -429 diisopropylpteridine
PM12B B09,B10,B11 -231 Polymyxin B
PM11C C06 -102 Colistin
PM12B C05.C06 -198 Vancomycin
PM17 H01,H02(H03,H04 -201 Cefsulodin
,.PM11C H01,HQ2 -160 Cephalothin
PM17A G09,G10 -159 Cefoperazone
PM12B B01,B02 -346 Oxacillin
PM11C D09,D10 -227 Nafcillin
PM19 F01, F02 -216 Phenethicillin
PM12B A01, A02 -186 Penicillin G
PMllC B05,B06 -182 Cloxacillin
PM13B H06,H07 -171 Moxalactam
PM12B A09, A1t0 -164 Carbenicillin
PM20B A10, All, A12 -336 Benserazide
Attorney Docket No. 27522-0196 WO 1
AsseA inhibition
Map position of growth Chemical
PM17A G02,G03,G04 -177 Chlorambucil
PM20B B01,B02 -345 Orphenadrine
PM20B F09,F10 -206 Pridinol
PM20B B05,B06 -263 Propranolol
PM18C A01,A02(A03,A04 -468 Ketoprofen - -
PM17A H06,H07 -173 Caffeine
..PM19 G09,G10 -150 Hydroxy1amine
PM19 A09,A10,A11 -243 Coumarin
P 17A A01,A02,A03 -398 D-Serine
PM18C D09,D10 -269 Lidocaine
P 18C C01,C02, C03 -377 Poly-L- lysine
Methyltrioctylammonium
PM19 B01,B02 -326 chloride
PM16A C09,C10 -269 Cetylpyridinium chloride
PM12B E09,E10 -255 Benzethonium chloride
Dodecyltrimethyl ammonium
PM12B H09,H10 -225 bromide
PM15B D05.D06 -250 Domiphen bromide
PM15B E01,E02 -216 Alexidine
PM20B A01, A02, A03 -422 Amitriptyline
PM20B G01,G02,G03 -357 Captan
PM18C F06, F07 -223 Tinidazole
PM20B C09,C10 -203 Ornidazole
PM14A A05, A06 -162 Furaltadone
-PM18C B09,B10,B11,B12 -341 Azathioprine
PM13B E01,E02,E03 -281 Cytosine arabinoside
PM19 D01,D02 -246 Disulfiram
PM09 G01,G02,G03 ,G04 -497 200mM Sodium Phosphate pH 7
PM16A D01,D02 -221 l-Chloro-2 , 4-dinitrobenzene
PM19 E09,E10,E11,E12 -330 Lawsone
Phenyl -methylsulfonyl -
PM19 D09,D10 -194 fluoride (PMSF)
PM19 F06,FQ7 -185 Blasticidin S
"PM19 D05,D06 -215 lodonitro tetrazolium violet
PM19 E01,E02,E03 -460 FCCP
PM15B G01,G02,G03,G04 -422 CCCP
PM19 F09,F10,F11,F12 -346 Sodium caprylate
P 19 B09,B10,B11 -296 2 , 4 -Dinitrophenol
PM18C C09,C10, Cll -287 Pentachlorophenol
PM20B D09,D10,D11 -212 18 -Crown- 6 ether
PM19 C09, CIO -204 Cinnamic acid
"PM13B E09,E10,E11 -268 Ruthenium red
PM20B E01,E02,E03,E04 -576 Crystal Violet
PM20B C01,C02,C03 -313 Thioridazine
P 20B B09,B10 -293 Tetrazolium violet
P 1 A C09,C10,C11 -238 Sodium cyanate
Attorney Docket No. 27522-0196W01
Table 2
3MST protects E. coli against different classes of antibiotics
Attorney Docket No. 27522-0196WO1
Example 6 - The mechanism of H?S-mediated cvtoprotection
The results presented herein suggest several non-mutually exclusive mechanisms that could explain the H2S-mediated defense against oxidative stress (Fig. 10L): (i) stimulation of the major antioxidative enzymes, catalase and SOD (Fig. 10 ); (ii) direct neutralization of peroxide (¾S + H2O2 -→ S + 2H2O); (iii) transient depletion of free cysteine, a reducing agent that fuels the Fenton reaction (S. Park, J. A. Imlay,. J. Bacteriol. 185, 1942 (2003)), and (iv) depletion of ferrous iron, a catalytic agent of the Fenton reaction. It is possible that the sequestration of ferrous iron by H2S is the largest contributor to H2S-mediated protection against oxidative stress (although other mechanisms play an important role as well, as described below). To test this hypothesis, the effect of NaHS on cell survival was measured after treatment with a lethal dose of H2O2. Within one minute of pretreatment with NaHS, cells became > 20 times more resistant to peroxide (Fig. 10F). This rules out any protective mechanism that depends on gene expression. It is noted that the amount of NaHS was ten times smaller than that of peroxide, i.e., the protective effect could not be explained by direct reaction of NaHS with peroxide in this case. Furthermore, pretreatment of cells with the Fe chelator dipyridyl also protected them rapidly against peroxide (Fig. 1 OF). Because NaHS does not provide extra protection beyond that of dipyridyl (Fig. 10F), it can be concluded that, like dipyridyl, NaHS protected cells from the Fenton reaction by eliminating Fe^.
To further investigate the validity of this conclusion, the effect of ¾S on the Fenton reaction in vitro was examined. Hydrogen peroxide alone or together with Fe3+ did not produce significant strand brakes in pBR322 DNA (Fig. 10M), whereas addition of Cys along with Fe3+ caused dramatically accelerated DNA damage. Addition of NaHS (NaHS:Fe3+ - 6: 1) completely inhibited DNA damage under physiological pH (pH=8). It is noted that NaHS was 20 times less abundant than H2O2. This result shows that ¾S can effectively interfere with Fenton chemistry by scavenging cellular iron.
To examine the role of free Cys in oxidative stress associated with antibiotics, its effect on gentamicin (Gm) toxicity was studied in wt and 3MST-deficient cells.
WT E. coli became more resistant to the antibiotic in Cys-enriched media (0.5 mM L- cysteine) than in^regular LB (<20 μΜ L-cysteine) (Fig. 12F). In contrast, 3MST-
Attorney Docket No. 27522-0196W01 deficient cells became more sensitive to Gm in Cys rich media. This stronger sensitivity of the 3MST mutant cells to Gm killing in the presence of Cys was attributed to the higher level of intercellular pro-oxidative Cys that could not be efficiently converted to protective H2S. Indeed, addition of the thiol-depleting diamide protected 3MST mutant cells against Gm (Fig. 12F).
Example 7 - Antibiotic potentiation by AOAA against Enterococcus faecalis
A study was conducted to demonstrate potentiation of antibiotics by AOAA. E. faecalis (ATCC 29212) cultures were prepared at initial inoculums of ~5xl 05 CFU/ml in Mueller-Hinton II Broth (cation-adjusted). Aliquots of 190 μΐ were dispensed to each well of a fresh set of plates, and 10 μΐ of an antibiotic solution (levofloxacin, meropenem, gentamicin, piperacillin, linezolid, cefepime, daptomycin, vancomycin, or chloramphemicol) were transferred to the corresponding wells in each bacterial plate (Fig. 13). For each antibiotic, the starting concentration was 2X MIC (minimum inhibitory concentration) with serial ½ dilutions. Two sets of dilutions were prepared, arid to one of them 0.1 mM AOAA was added. The resulting plates were kept at 37°C and 85% humidity for 20 hours. All nine antibiotics tested were potentiated by AOAA, with respective MICs dropped from 8-fold to 32-fold (Fig. 13). Thus, this study demonstrated that the activities of the antibiotics tested were potentiated by AOAA. Example 8 - Comparison of antibiotic potentiation by AOAA and PAG
Minimum inhibitory concentration (MIC) determination was conducted as described in Example 7, above. To assess antibiotic potentiation by AOAA and PAG, MIC was determined for nine antibiotics (levofloxacin, meropenem, gentamicin, piperacillin, linezolid, cefepime, daptomycin, vancomycin, and chloramphemicol) and four bacterial strains (E. faecium (A2373), E. faecalis (ATCC 29212), S. pneumoniae (ATCC 49619), and P. aeruginosa (PAOl)) in the presence of antibiotic alone, ImM PAG, 0.1 mM AOAA, or 0.5 mM PAG + 0.05 mM AOAA. The results are summarized in Table 3. The smaller the MIC value, the stronger the effect of antibiotic potentiation. As shown in Table 3, in most cases, AOAA has a stronger antibiotic potentiation effect than PAG or even AOAA+PAG. These data also suggest that inhibiting CBS (targeted by AOAA) may be more clinically relevant
Attorney Docket No. 27522-0196WO1 than inhibiting CSE (targeted by PAG) (Fig. 1 A).
Table 3. Minimum inhibitory concentrations (in μg/ml) of antibiotics in the presence of antibiotic alone, ImM PAG, 0.1 mM AOAA, or 0.5 mM PAG + 0.05 mM AOAA.
Ch'oriirnphcnicof 8 8 2 8 3 B 0.5 8 a 4 4 64 64 64 64
Attorney Docket No. 27522-0196 WO 1
REFERENCES
1. H. imura, Antioxid Redox Signal. 12, 1 11 1-1 123 (2010).
2. G. Yang, et al. Science 322, 587-590 (2008).
3. Q. C. Yong, S. W. Lee, C. S. Foo, . L. Neo, X. Chen, J. S. Bian. Am J Physiol Heart Circ Physiol 295, H133O-H1340 (2008).
4. M. M. Gadalla, S. H. Snyder, J Neurochem. 113,14-26 (2010).
5. D. R. Linden, M. D. Levitt, G. Farrugia, J. H. Szurszewski, Antioxid Redox Signal. 12, 1 135-1 146 (2010).
6. R. Wang, Antioxid Redox Signal. 12, 1061-1064 (2010).
7. A. . Mustafa, M. M. Gadalla, S. H. Snyder, Sci Signal. 2, re2 (2009).
8. B. Lima, . T. Forrester, D. T. Hess, J. S. Stamler, Circ Res.106, 633-646 (2010).
9. M. Ishigami, K. Hiraki, . Umemura, Y. Ogasawara, . Ishii, H. Kimura, Antioxid Redox Signal. 1 1 , 205-214 (2009).
10. 1. Gusarov, E. Nudler, Proc Natl Acad Sci U S A 102, 13855-60 (2005).
c
U . K. Shatalin et al., Proc Natl Acad Sci U S A 105, 1009-13 (2008).
12. 1. Gusarov, K. Shatalin, M. Starodubtseva, E. Nudler, Science 325, 1380-1384 (2009).
13. B. A. Forbes, Bailey and Scott's Diagnostic Microbiology, 10th ed. C.V.
Mosby Company, St. Louis, MO (1998).
14. R. Lutz, H. Bujard, Nucl Acid Res. 25, 1203-1210 (1997).
15. M. A. Kohanski, D. J. Dwyer, B. Hayete, C. A. Lawrence, J. J. Collins, Cell 130, 797-810 (2007).
16. N. R. Asad, A. C. Leitao, J Bacteriol 173, 2562-2568 (1991).
Attorney Docket No. 27522-0196WO1 c
O. I. Aruoma, B. Halliwell, E. Gajewski, M. Dizdaroglu J Biol Chem. 264, 20509-20512 (1989). S. I. Liochev, I. Fridovich, IUBMB Life 48,157-161 (1999). J. A. Imlay, Annu Rev Microbiol. 57, 395^118 (2003). M. A. Kbhanski, D. J. Dwyer, J. J. Collins, Nat Rev Microbiol. 8, 423-435 (2010). B. W. Davies, M. A. Kohanski, L. A. Simmons, J. A. Winkler, J. J. Collins, G. C. Walker, Mol Cell 36, 845-860 (2009). B. Birren, E. Lai, Pulse Field Gel Electrophoresis, a Practical Guide r.
(Academic Press, New York; 1993). A. Azvolinsky, S. Dunaway, J. Z. Torres, J. B. Bessler, V.A. Zakian, Genes Dev 20, 3104-31 1 (2006). M. Kostrzynska, K. T. Leung, H. Lee, J. T. Trevors, 'J Microbiol Methods 48, 43-51 (2002). U. Gayon, Comp Rend Acad Sci 85: 1074-1076, 1877. 9 P. Bruinenberg, G. De Roo, G. Limsowtin, Appl Environ Microbiol. 63, 561- 566 (1997). W.-J. Lee, et al., Appl Environ Microbiol. 73, 3034-3039 (2007). M. H. Stipanuk, P. W. Beck, Biochem J. 206, 267-277 (1982). Y. J. Peng et al., Proc Natl Acad Sci U S A. 107, 10719-10724 (2010). S. Park, J. A. Imlay, J Bacteriol. 185, 1942-1950 (2003). O. Kabil, R. Banerjee J Biol Chem. 285, 21903-21907 (2010). 1. Gusarov, et al; J Biol Chem. 283, 13140-13147 (2008). M. H. Lim, D. Xu, S. J. Lippard, Nat Chem Biol 2, 375-380 (2006).
Attorney Docket No. 27522-0196W01
SUPPLEMENTAL REFERENCES:
51. . Datsenko, B. Wanner, Proc Natl Acad Sci USA 97, 6640-45 (2000).
52. J. atashkina et al., Mol Biol (Mosk) 39, 823-31 (2005).
53. R. Lutz, H. Bujard, NAR 25, 1203-10 (1997).
:: S4. K. Shatalin et al., Proc Natl Acad Sci USA 105, 1009-13 (2008).
55. . Shatalin, A. Neyfakh, FEMS Microbiol. Lett. 245, 315-19 (2005).
56. B. Forbes et al., Bailey and Scott's Diagnostic Microbiology, 10th ed. C.V. Mosby Company, St. Louis, MO (1998)
- S7. M. Kostrzynska et al., J Microbiol Methods 48, 43-51(2002).
S8. L. Chen et al., Proc Natl Acad Sci USA 92, 8190-4 (1995).
S9. 1. Dunham et al., Nature 402, 489-95 (1999).
S10. A. Spallarossa et al., Acta Crist. D59, 168-70 (2003).
SI 1. R. Strausberg et al., Proc Natl Acad Sci USA 99, 16899-903 (2002).
512. S. Gregory et al., Nature 441 , 315-21 (2006).
513. M. Meier et al., EMBO Journal 20, 3910 - 16 (2001 ).
514. Q. Sun et al., J. Biol. Chem. 284, 3076-85 (2009).
Attorney Docket No. 27522-0196WO I
The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the appended claims.
All patents, applications, publications, test methods, literature, and other materials cited herein are hereby incorporated by reference in their entirety as if physically present in this specification.
LIST OF SEQUENCES:
5'-atgcgtgagaatttacgttatgtaattcagtatcaccgctcaagttagtataaaaaagct-3 ' (SEQ ID NO: 1) 5'-ttatttcactggctcaaccggtaaatctgcccgcgtgaagcctgcttttttatactaag-3' (SEQ ID NO: 2) 5'-attagcatgcaggcggctac-3 ' (SEQ ID NO: 3)
5'-tgctggaaaggccgcgaa-3' (SEQ ID NO: 4)
5'-cgcagatcttgaagcctgcttttttatac-3' (SEQ ID NO: 5)
5'-cgctcaagttagtataaaaaagct-3 ' (SEQ ID NO: 6)
5'-cgcagatctcgagtccctatcagtg-3' (SEQ ID NO: 7)
5'-aatttctcctctttccatgg-3' (SEQ ID NO: 8)
5'-ccctgccacaatggcccgttagcaacgtcgaataacgctcaagttagtataaaaaagct-3 ' (SEQ ID NO: 9)
5'-gtgatactgaattacataacgtaaattctcacgcatggtacctttctcctctttaatga-3 ' (SEQ ID NO: 10)
5'-attagcatgcaggcggctac-3 ' (SEQ ID NO: 1 1)
5'-gcaaaagaggctgatttggct-3 ' (SEQ ID NO: 12)
5'-ttccattgggatgtagatgctg-3 ' (SEQ ID NO: 13)
5'-ggtaaaagagtcaagggaagaacc-3' (SEQ ID NO: 14)
5'-acgctttgacttctctcacttcggt-3' (SEQ ID NO: 15)
5'-aaacatttgctcttgatgtcctgga-3' (SEQ ID NO: 16)
5'-ctttgcaacctgtacatgccttg-3' (SEQ ID NO: 17)
5'-catcgtagtagttgatcggatggac-3' (SEQ ID NO: 18)
5'-ggggacaagtttgtacaaaaaagcaggctaagggggagaacacgatgaatg-3' (SEQ ID NO: 19) 5'-ggggaccactttgtacaagaaagctgggtgtgccgaccaaagttcaggac-3' (SEQ ID NO: 20)
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEE
RHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDAS
DQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEF
RAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
VNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGA
YLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH (SEQ ID NO: 21)
MSTTWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVF FDIEALSDHTSPLPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRA WWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAFNPEAVV VTDVLLASHENTAQIIDARPAARFNAEVDEPRPGLRRGHIPGALNVPWTELV
REGELKTTDELDAIFFGRGVSYDKPIIVSCGSGVTAAVVLLALATLDVPNVKL YDGAWSEWGARADLPVEPVK (SEQ ID NO: 22)
MNSDFLVTPQWLAAHANDANIVILDARMSPPGVVPKRNIQAEFEQGHIPGAV
YFDIDAIADHSTGLPHMLPSPQLFSEMAGQLGITEQHTVVIYDEGNLFSAPRV
WWTFRTFGAKNVRILASGLSGWQQAGYKLESGPAHPTPQTFNVTFNAAAVS
SVDEVLAVLGNNEVQILDARPSARYRAQEPEPRPGLRLGRIPGSINIPWGTMV
ENGHLKSPQALAEIFAAQGVDLTKPIITSCGSGVTAAWVLGLAAVNARSVSL
YDGSWAEWGASNSLPIDATPLA (SEQ ID NO: 23)
MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALF FDIEALSDRASPLPHMMPRPEAFAVAMRELGVRQDKHLVIYDEGNLFSAPRA WWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFAPQAV VRLTDVLLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTE LVYEGELKTTDELNEVFFSHGVSFDRPIIASCGSGVTAAVVVLALATLDVPDV TLYDGAWSEWGARTDLPVEPA (SEQ ID NO: 24)
MTEKSAFWSRDWLKERLHKPGLAIVDASWYLPAAGRNGQEEYEKAHIPGA
VFFDQDKIADKESGLPHTLPSPEFFAQQVGTLGITADETWVYDGPGMFSAPR
VWWMFRVMGVKNVYVLDGGFDGWKKAGYPVTDEVTKIAATFFKPSFNKD
AVVDFQEMRKIVDEKRSQIADARGAGRFTGRDAEPRAEMRSGHMPGARNVP
VTTLSENGELKDLESLRRIFDEAGIDLSGPVVTSCGSGVTAAVITLALTSLGHK
DNRLYDGSWSEWGSRQDTPVVTGEAE (SEQ ID NO: 25)
MSASSSDLPVSHERFVSADWLANHLNDSSITLIDARMLPPGNDTRDIHAEYRA
AHLPGAVFFDIENLSDHSTDLPHMMPTCENFARAMGELGIDNQQHLVIYDEG
NLFSAPRAWWMLHTFGATSISILSGGLAGWKAQNLPLEQGYVTRKPVTFHAT
LDENAIRSRDDVLSISRDKSEQIVDARPASRFHAEVDEPRPGLHRGHIPGSLNV
PWTDLVNNGALKPNAELATILHKHGVDFTRPIVASCGSGVTASVWLALTQL
NVPNVTLYDGSWSDWGSRDDVPIARD (SEQ ID NO: 26)
MNNAYFVTPQWLKDHLDDKNLVILDATAPPPPQQIDCHKLWLNTHIPGAQFL DLDKIANHQSGLPHMLPDPQTFSQAVGAMGISENHLVVIYDQGNMFSAPRA
WWTFKIFGSHNVRILDGGLQGWQQAGFPTASGEVKRNPQIFNTDFNADKVKS LEQILGALNDQQIQIVDARATDRFQAKAPEPRPGLRMGHIPGSKNIPWTMLVE NGHFKSETEITDIFHKQGVDLNKPVITSCGSGMTAAVLVLGLDIIGKKDVYLY DGSWAEWGADEALPLEK (SEQ ID NO: 27)
MTAHTDPLVSTDWLAERLGDPSVKIIDASFKMPGVLPLPADDYLAAHIPGAV
FFDVDAVSDHASSLPHMYPSADQFARDVEALGISSGDTVVAYDAGGWVAAP
RAWWMFLSFGHANIRILDGGLKKWVAEGLPTEAGKPTIAPGRFSAKLDPSFIR
SRDQLVANLDSGAEQVIDARAAPRFEGSVAEPRPGLRAGHIPGSRNLPYNELF
DAATGTMKPLAELRQAFERAGLDLGRPVVTSCGSGVSAAVLTLALYRLGVR
GSALYDGSWSEWGLQDGPPVATGPAA (SEQ ID NO: 28)
MSLMMDIAMNPTLDDPLVSTEWLAAHLGEVKAIDASFKMPGVLPLAVDDFY
AAHIPGAVFFDVDAVSDRASPLPHMYPDAAQFGRDVGALGISSKDTVVVYD
NGGWLAGPRAWWMFLSFGHAGVRVLDGGLKKWRAEGRPVESGKVSPEPG
HFTATFDPLFVRDKAQLVSNLSSCREQLVDARAAARFTGAVMEPRQGLRSGH
IPGSRNLSYAELFDPGTGVMKPLDDIRAAFSRAGVDLAKPWTTCGSGVSAA
VLTLALYRLGARGSALYDGSWSEWGLVEGPPIATGPA (SEQ ID NO: 29)
MSTTWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVF
FDIEALSDHTSPLPHMLPRPKTFAVAMRELGVNQDKHLIVYDEGNLFSAPRA
WWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAVELPEGEFNAAFNPEAVV
KVTDVLLASHENTAQIIDARPAARFNAEVDEPRPGLRRGHIPGALNVPWTELV
REGELKTTDELDAIFFGRGVSYDKPIIVSCGSGVTAAVVLLALATLDVPNVKL
YDGAWSEWGARADLPVEPVK (SEQ ID NO: 30)
MAEVITGDDPQTLVSTDWLAAHFNDPDLRIIDASYYLAEMNRDAKAEYDAG
HIPGARFFDIDDISDARSELPHMVAPVEKFMSRMRAMGVGDGHQVWYDGR
GVFSAARVWWNFRLMGKTDVAVLDGGLPKWVAEGRPVEDMPPIIRDRHMT
VQRQAHLVKDVTQVASASKLGDWQIVDARAPARFRGEEPETRPGLRAGRIPN
SKNVHYASLFKPDGTMKEGDALRAAFEAGGVDLDKRIITTCGSGVTAAILML
GLTRLGHQDVSLYDGSWSEWGQFEQLKVETG (SEQ ID NO: 31)
LKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERD
GTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGA
EIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYR ASNPLAHYDTTADE
ILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEEL
NQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLC
GGSAGSTVAVAVKAAQELQEGQRCVVILPDSVR YMTKFLSDRWMLQKG
(SEQ ID NO: 32)
HELIGHTPIVEITRFSLPEGVRLFAKLEFYNPGGSVKDRLGRELIEDALEKGLVT
EGGTIIEPTAGNTGIGLALAALQHDLRVIVCVPEKFSIEKQELMKALGATVVH
TPTEQGMTGAIAKAKELVNEIPNSYSPSQFANEANPRAYFKTLGPELWSALNG
EINIFVAGAGTGGTFMGTASYLKEKNIDIKTVIVEPEGSILNGGKAGSHETEGI
GLEFIPPFLKTSYFDEIHTISDRNAFLRVKELAQKEGLLVGSSSGAAFHASLLE
AEKAAPGTNIVTIFPDSSERYLSKDIYKGWE (SEQ ID NO: 33)
LDLIGNTPLVRVTRFDTGPCTLYLKLESQNPGGSIKDRIGVAMIEAAERDGRL
RPGGTIVEATAGNTGLGLALVGRAKGYRWLVVPDKMSTEKVLHLRAMGAE
VHITRSDVGKGHPEYYQDVAARLAQDIPGAFFADQFNNPANPLAHECGTGPE
LWAQTGHDLDAIVVGVGSSGTLTGLTRFFQKVQPELEMVLADPEGSIMAEYS
RSGTLGTPGSWAVEGIGEDFVPAIADLSSVRHAYSISDEESFAMARELLRVEGI
PGGSSTGTLLAAALRFCREQKEPKRVVSFVCDTGTRYLSKIYNDQWMTDQG
(SEQ ID NO: 34)
YDLIGNTPLVLLEHYSDDKVKIYAKLEQWNPGGSVKDRLGKYLVEKAIQEGR
VRAGQTIVEATAGNTGIGLAIAANRHHLKCKIFAPYGFSEEKINIMIALGADVS
RTSQSEGMHGAQLAARSYAEKYGAVYMNQFESEHNPDTYFHTLGPELTSAL
QQIDYFVAGIGSGGTFTGTARYLKQHHVQCYAVEPEGSVLNGGPAHAHDTE
GIGSEKWPIFLERRLVDGIFTIKDQDAFRNVKSLAINEGLLVGSSSGAALQGAL
NLKAQLSEGTIVWFPDGSDRYMSKQIFNYEENDYE (SEQ ID NO: 35)
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAWPPISLSTTFKQGAP
GQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAG
DQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIET
PTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATK YMNGHSDVVMGLVSV CESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLH VRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGM VTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVL GISDTLIRLSVGLEDEEDLLEDLDQALKAA (SEQ ID NO: 36)
MRAKTKLIHGIRIGEPSTGSVNVPIYQTSTYKQEAVGKHQGYEYSRTGNPTRA
ALEEMIAVLENGHAGFAFGSGMAAITATIMLFSKGDHVILTDDVYGGTYRVIT
KVLNRFGIEHTFVDTTNLEEVEEAIRPNTKAIYVETPTNPLLKITDIKKISTLAK
EKGLLTIIDNTFMTPYWQSPISLGADIVLHSATKYLGGHSDVVAGLVVVNSPQ
LAEDLHFVQNSTGGILGPQDSFLLLRGLKTLGIRMEEHETNSRAIAEFLNNHPK
VNKVYYPGLASHQNHELATEQANGFGAIISFDVDSEETLNKVLERLQYFTLAE
SLGAVESLISIPSQMTHASIPADRRKELGITDTLIRISVGIEDGEDLIEDLAQALA
(SEQ ID NO: 37)
MSQHDQHPDAPAQAFATRVIHAGQAPDPSTGAIMPPIYANSTYIQESPGVHKG
LDYGRSHNPTRWALERCVADLEGGTQAFAFASGLAAISSVLELLDAGSHIVS
GNDLYGGTFRLFERVRRRSAGHRFSFVDPTDLQAFEAALTPETRMVWVETPS
NPLLRLTDLRAIAQLCRARGIISVADNTFASPYIQRPLELGFDVVVHSTTKYLN
GHSDVIGGIAIVGDNPDLRERLGFLQNSVGAISGPFDAFLTLRGVKTLALRME
RHCSNALALAQWLERQPQVARVYYPGLASHPQHELAKRQMRGFGGMISLDL
RCDLAGARRFLENVRIFSLAESLGGVESLIEHPAIMTHASIPAETRADLGIGDSL
IRLSVGVEALEDLQADLAQALAKI (SEQ ID NO: 38)
MNKKTKLIHGGHTTDDYTGAVTTPIYQTSTYLQDDIGDLRQGYEYSRTANPT
RSSVESVIAALENGKHGFAFSSGVAAISAVVMLLDKGDHIILNSDVYGGTYRA
LTKVFTRFGIEVDFVDTTHTDSrVQAIRPTTKMLFIETPSNPLLRVTDIKKSAEI
AKEHGLISVVDNTFMTPYYQNPLDLGIDIVLHSATKYLGGHSDVVAGLVATS
DDKLAERLAFISNSTGGILGPQDSYLLVRGIKTLGLRMEQINRSVIEIIKMLQA
HPAVQQVFHPSIESHLNHDVHMAQADGHTGVIAFEVKNTESAKQLIKATSYY
TLAESLGAVESLISVPALMTHASIPADIRAKEGITDGLVRISVGIEDTEDLVDDL
KQALDTL (SEQ ID NO: 39)
Claims
1. A method for treating a subject having a microbial infection, said method comprising administering to said subject a therapeutically effective amount of at least one inhibitor of endogenous I¾S production by an organism causing the microbial infection.
2. The method of claim 1, further comprising administering a second antimicrobial compound.
3. The method of claim 1 or 2, wherein the inhibitor of endogenous I¾S production inhibits an H^S-generating enzyme within the organism causing the microbial infection.
4. The method of claim 3, wherein the inhibitor of endogenous H2S production inhibits microbial cystathionine β-synthase (CBS) or paralogs thereof.
5. The method of claim 4, further comprising administering to said subject an inhibitor of microbial cystathionine γ-lyase (CSE) or paralogs thereof.
6. The method of claim 3, wherein the inhibitor of endogenous I¾S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof.
7. The method of claim 3, wherein the inhibitor of endogenous H2S production inhibits microbial cystathionine γ-lyase (CSE) or paralogs thereof.
8. The method of claim 1 or 2, wherein the inhibitor of endogenous I¾S production is amino-oxyacetate (AOAA).
9. The method of claim 1 or 2, wherein the inhibitor of endogenous I¾S production is hydroxylamine.
10. The method of claim 1 or 2, wherein the inhibitor of endogenous I¾S production is D,L-propargylglycine (PAG).
11. The method of claim 1 or 2, wherein the inhibitor of endogenous I¾S production is β-cyano-L-alanine.
12. The method of claim 1 or 2, wherein the inhibitor of endogenous I¾S production is aspartate or a derivative thereof.
13. The method of claim 1 or 2, wherein the inhibitor of endogenous I¾S production is homocysteine.
14. The method of claim 1 or 2, wherein the organism causing the microbial infection is selected from the group consisting of bacteria, fungi and protozoa.
15. The method of claim 14, wherein said bacteria is from a genus selected from the group consisting of Bacillus, Brucella, Clostridium, Enterococcus, Escherichia, Francisella, Helicobacter, Klebsiella, Legionella, Listeria, Mycobacterium, Pseudomonas, Salmonella, Shigella, Staphylococcus, Streptococcus, Trypanosoma, Vibrio, and Yersinia.
16. The method of claim 14, wherein said bacteria is from a species selected from the group consisting of E. coli, S. aureus, B. anthracis, and P. aeruginosa.
17. The method of claim 1 or 2, wherein said microbial infection causes a disease selected from the group consisting of pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis, malaria, trachoma, leishmaniasis, chagas disease, trichomoniasis, lyme disease, and leprosy.
18. The method of claim 1 or 2, wherein said subject is a mammal.
19. The method of claim 18, wherein said mammal is human.
20. The method of claim 2, wherein said second antimicrobial compound is selected from the group consisting of a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a cephalosporin, a lactam, and any combination thereof.
21. The method of claim 2, wherein said second antimicrobial compound is selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, josamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7-diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam, carbenicillin, and any combination thereof.
22. The method of claim 2, wherein said second antimicrobial compound is selected from the compounds disclosed in Tables 1 and 2 and any combination thereof.
23. The method of claim 2, wherein said inhibitor of endogenous H2S production and said second antimicrobial compound are administered simultaneously.
24. The method of claim 23, wherein said inhibitor of endogenous H2S production and said second antimicrobial compound are contained within the same composition.
25. The method of claim 23, wherein said inhibitor of endogenous H2S production and said second antimicrobial compound are contained in different compositions.
26. The method of claim 2, wherein said inhibitor of endogenous H2S production and said second antimicrobial compound are administered sequentially.
27. The method of claim 1 or 2, further comprising administering an inhibitor of endogenous microbial nitric oxide (NO) production or a NO scavenger.
28. The method of claim 27, wherein the inhibitor of endogenous NO production is selected from the group consisting of L-arginine, N G -monomethyl-L-arginine, N G-nitro-L-arginine methyl ester, N G -nitro-L-arginine, N G -amino-L-arginine, N G ,N G-dimethylarginine (asymmetric dimethylarginine), L-thiocitrulline, S-methyl-L- thiocitrulline, diphenyleneiodonium chloride, 2-(4-carboxyphenyl)-4,4,5,5- tetramethylimidazoline-l-oxy 3-oxide, 7-nitroindazole, N(5)-(l-iminoethyl)-L- ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L-citrulline, S- methylisourea, and 2-mercaptoethylguanidine.
29. The method of claim 27, wherein said microbial infection is caused by Gram (+) bacteria, and wherein the inhibitor of endogenous NO production is an iNOS- specific inhibitor.
30. The method of claim 27, wherein the NO scavenger is selected from the group consisting of non-heme iron-containing peptides, non-heme iron-containing proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferrioxamine, pyridoxal isonicotinoyl hydrazone, 1 ,2-dimethyl- 3hydroxypyrid-4-one, [+] 1, 2-bis (3,5-dioxopiperazine-lyl)propane, and 2-(4- carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl-l-oxy-3-oxide.
31. The method of claim 27, wherein the NO scavenger is a perfluorocarbon emulsion.
32. The method of claim 27, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the second antimicrobial compound are contained within the same composition.
33. The method of claim 27, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the second antimicrobial compound are contained in different compositions.
34. The method of claim 27, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the second antimicrobial compound are administered sequentially.
35. The method of claim 27, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the second antimicrobial compound are administered simultaneously.
36. The method of claim 1 or 2, wherein said inhibitor of endogenous H2S production selectively inhibits a H2S-generating enzyme within the organism causing the microbial infection, but not a H2S-generating enzyme in the cells of the subject being treated.
37. A method for enhancing efficacy of an antimicrobial treatment in a subject having a microbial infection, wherein said antimicrobial treatment comprises administering to the subject a first antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo, said method comprising co-administering said first compound with a therapeutically effective amount of a second compound which second compound is an inhibitor of endogenous H2S production by an organism causing the microbial infection.
38. The method of claim 37, wherein the first compound and the inhibitor of endogenous H2S production are administered simultaneously.
39. The method of claim 38, wherein the first compound and the inhibitor of endogenous H2S production are contained in the same composition.
40. The method of claim 38, wherein the first compound and the inhibitor of endogenous H2S production are contained in different compositions.
41. The method of claim 37, wherein the first compound and the inhibitor of endogenous H2S production are administered sequentially.
42. The method of claim 37, wherein the inhibitor of endogenous H2S production inhibits an H2S-generating enzyme within the organism causing the microbial infection.
43. The method of claim 42, wherein the inhibitor of endogenous H2S production inhibits microbial cystathionine β-synthase (CBS) or paralogs thereof.
44. The method of claim 43, further comprising administering to the subject an inhibitor of microbial cystathionine γ-lyase (CSE) or paralogs thereof.
45. The method of claim 42, wherein the inhibitor of endogenous H2S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof.
46. The method of claim 42, wherein the inhibitor of endogenous H2S production inhibits microbial cystathionine γ-lyase (CSE) or paralogs thereof.
47. The method of claim 37, wherein the inhibitor of endogenous H2S production is amino-oxyacetate (AOAA).
48. The method of claim 37, wherein the inhibitor of endogenous H2S production is hydroxylamine.
49. The method of claim 37, wherein the inhibitor of endogenous H2S production is D,L-propargylglycine (PAG).
50. The method of claim 37, wherein the inhibitor of endogenous H2S production is β-cyano-L-alanine.
51. The method of claim 37, wherein the inhibitor of endogenous H2S production is aspartate or a derivative thereof.
52. The method of claim 37, wherein the inhibitor of endogenous H2S production is homocysteine.
53. The method of claim 37, wherein the organism causing the microbial infection is selected from the group consisting of bacteria, fungi and protozoa.
54. The method of claim 53, wherein said bacteria is from a genus selected from the group consisting of Bacillus, Brucella, Clostridium, Enterococcus, Escherichia, Francisella, Helicobacter, Klebsiella, Legionella, Listeria, Mycobacterium, Pseudomonas, Salmonella, Shigella, Staphylococcus, Streptococcus, Trypanosoma, Vibrio, and Yersinia.
55. The method of claim 53, wherein said bacteria is from a species selected from the group consisting of E. coli, S. aureus, B. anthracis, and P. aeruginosa.
56. The method of claim 37, wherein said microbial infection causes a disease selected from the group consisting of pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis, malaria, trachoma, leishmaniasis, chagas disease, trichomoniasis, lyme disease, and leprosy.
57. The method of claim 37, wherein said subject is a mammal.
58. The method of claim 57, wherein said mammal is human.
59. The method of claim 37, wherein the first compound is selected from the group consisting of a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a cephalosporin, a lactam, and any combination thereof.
60. The method of claim 37, wherein the first compound is selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, josamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7-diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam, carbenicillin, and any combination thereof.
61. The method of claim 37, wherein the first compound is selected from the compounds disclosed in Tables 1 and 2 and any combination thereof.
62. The method of claim 37, further comprising administering an inhibitor of endogenous microbial nitric oxide (NO) production or a NO scavenger.
63. The method of claim 62, wherein the inhibitor of endogenous NO production is selected from the group consisting of L-arginine, N G -monomethyl-L-arginine, N G-nitro-L-arginine methyl ester, N G -nitro-L-arginine, N G -amino-L-arginine, N G ,N G-dimethylarginine (asymmetric dimethylarginine), L-thiocitrulline, S-methyl-L- thiocitrulline, diphenyleneiodonium chloride, 2-(4-carboxyphenyl)-4,4,5,5- tetramethylimidazoline-l-oxy 3-oxide, 7-nitroindazole, N(5)-(l-iminoethyl)-L- ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L-citrulline, S- methylisourea, and 2-mercaptoethylguanidine.
64. The method of claim 62, wherein said microbial infection is caused by Gram (+) bacteria, and wherein the inhibitor of endogenous NO production is an iNOS- specific inhibitor.
65. The method of claim 62, wherein the NO scavenger is selected from the group consisting of non-heme iron-containing peptides, non-heme iron-containing proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferrioxamine, pyridoxal isonicotinoyl hydrazone, 1 ,2-dimethyl- 3hydroxypyrid-4-one, [+] 1, 2-bis (3,5-dioxopiperazine-lyl)propane, and 2-(4- carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl-l-oxy-3-oxide.
66. The method of claim 62, wherein the NO scavenger is a perfluorocarbon emulsion.
67. The method of claim 62, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the first antimicrobial compound are contained within the same composition.
68. The method of claim 62, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the first antimicrobial compound are contained in different compositions.
69. The method of claim 62, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the first antimicrobial compound are administered sequentially.
70. The method of claim 62, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production and/or the first antimicrobial compound are administered simultaneously.
71. The method of claim 37, wherein said inhibitor of endogenous H2S production selectively inhibits a H2S-generating enzyme within the organism causing the microbial infection, but not a H2S-generating enzyme in the cells of the subject being treated.
72. A method for sensitizing a microbial pathogen to oxidative damage comprising administering to said pathogen an effective amount of at least one inhibitor of endogenous H2S production by said pathogen.
73. The method of claim 72, wherein said pathogen is in a subject and the inhibitor of endogenous H2S production is administered to the subject.
74. The method of claim 73, wherein the subject is a mammal.
75. The method of claim 74, wherein the mammal is human.
76. The method of claim 72, wherein the inhibitor of endogenous H2S production inhibits an H2S-generating enzyme within said pathogen.
77. The method of claim 76, wherein the inhibitor of endogenous H2S production inhibits microbial cystathionine β-synthase (CBS) or paralogs thereof.
78. The method of claim 77, further comprising administering to said pathogen an inhibitor of microbial cystathionine γ-lyase (CSE) or paralogs thereof.
79. The method of claim 76, wherein the inhibitor of endogenous H2S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof.
80. The method of claim 76, wherein the inhibitor of endogenous H2S production inhibits microbial cystathionine γ-lyase (CSE) or paralogs thereof.
81. The method of claim 72, wherein the inhibitor of endogenous H2S production is amino-oxyacetate (AOAA).
82. The method of claim 72, wherein the inhibitor of endogenous H2S production is hydroxylamine.
83. The method of claim 72, wherein the inhibitor of endogenous H2S production is D,L-propargylglycine (PAG).
84. The method of claim 72, wherein the inhibitor of endogenous H2S production is β-cyano-L-alanine.
85. The method of claim 72, wherein the inhibitor of endogenous H2S production is aspartate or a derivative thereof.
86. The method of claim 72, wherein the inhibitor of endogenous H2S production is homocysteine.
87. The method of claim 72, wherein said pathogen is selected from the group consisting of bacteria, fungi and protozoa.
88. The method of claim 87, wherein said bacteria is from a genus selected from the group consisting of Bacillus, Brucella, Clostridium, Enterococcus, Escherichia, Francisella, Helicobacter, Klebsiella, Legionella, Listeria, Mycobacterium, Pseudomonas, Salmonella, Shigella, Staphylococcus, Streptococcus, Trypanosoma, Vibrio, and Yersinia.
89. The method of claim 87, wherein said bacteria is from a species selected from the group consisting of E. coli, S. aureus, B. anthracis, and ! aeruginosa.
90. The method of claim 72, wherein said pathogen causes a disease selected from the group consisting of pneumonia, bronchitis, diphtheria, pertussis (whooping cough), tetanus, endocarditis, sepsis, bacterial gastroenteritis, cholera, tuberculosis, gonorrhea, chlamydia, syphilis, bacterial meningitis, malaria, trachoma, leishmaniasis, chagas disease, trichomoniasis, lyme disease, and leprosy.
91. The method of claim 72, further comprising administering an inhibitor of endogenous microbial nitric oxide (NO) production or a NO scavenger.
92. The method of claim 91, wherein the inhibitor of endogenous NO production is selected from the group consisting of L-arginine, N G -monomethyl-L-arginine, N G-nitro-L-arginine methyl ester, N G -nitro-L-arginine, N G -amino-L-arginine, N G ,N G-dimethylarginine (asymmetric dimethylarginine), L-thiocitrulline, S-methyl-L- thiocitrulline, diphenyleneiodonium chloride, 2-(4-carboxyphenyl)-4,4,5,5- tetramethylimidazoline-l-oxy 3-oxide, 7-nitroindazole, N(5)-(l-iminoethyl)-L- ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L-citrulline, S- methylisourea, and 2-mercaptoethylguanidine.
93. The method of claim 91, wherein said pathogen is Gram (+) bacteria, and wherein the inhibitor of endogenous NO production is an iNOS-specific inhibitor.
94. The method of claim 91, wherein the NO scavenger is selected from the group consisting of non-heme iron-containing peptides, non-heme iron-containing proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferrioxamine, pyridoxal isonicotinoyl hydrazone, 1 ,2-dimethyl- 3hydroxypyrid-4-one, [+] 1, 2-bis (3,5-dioxopiperazine-lyl)propane, and 2-(4- carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl-l-oxy-3-oxide.
95. The method of claim 91, wherein the NO scavenger is a perfluorocarbon emulsion.
96. The method of claim 91, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production are contained within the same composition.
97. The method of claim 91, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production are contained in different compositions.
98. The method of claim 91, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production are administered sequentially.
99. The method of claim 91, wherein the inhibitor of endogenous microbial NO production or a NO scavenger and the inhibitor of endogenous H2S production are administered simultaneously.
100. The method of claim 72, wherein said inhibitor of endogenous H2S production selectively inhibits a H2S-generating enzyme within said pathogen, but not a H2S- generating enzyme in the cells of the subject being treated.
101. A pharmaceutical composition comprising (i) an antimicrobial compound that becomes compromised by H2S or natural products of H2S metabolism in vivo and (ii) an inhibitor of microbial endogenous H2S production.
102. The composition of claim 101 further comprising (iii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
103. A pharmaceutical composition comprising (i) an inhibitor of microbial endogenous H2S production and (ii) an inhibitor of microbial endogenous nitric oxide (NO) production or a NO scavenger.
104. The composition of claim 101 or 102, wherein the antimicrobial compound (i) is selected from the group consisting of a quinolone, an acridine, a phenothiazine, an aminoglycoside, a macrolide, an amphenicol, a steroid, an ansamycin, an antifolate, a polymyxin, a glycopeptide, a cephalosporin, a lactam, and any combination thereof.
105. The composition of claim 101 or 102, wherein the antimicrobial compound (i) is selected from the group consisting of novobiocin, norfloxacin, nalidixic acid, oxolinic acid, acriflavine, 9-aminoacridine, proflavine, trifluoperazine, promethazine, chlorpromazine, streptomycin, apramycin, tylosin, oleandomycin, erythromycin, josamycin, spiramycin, troleandomycin, chloramphenicol, fusidic acid, rifamycin SV, trimethoprim, 2,4-diamino-6,7-diisopropylpteridine, polymyxin B, colistin, vancomycin, cefsulodin, cephalothin, cefoperazone, oxacillin, nafcillin, phenethicillin, penicillin G, cloxacillin, moxalactam, carbenicillin, and any combination thereof.
106. The composition of claim 101 or 102, wherein the antimicrobial compound (i) is selected from the compounds disclosed in Tables 1 and 2 and any combination thereof.
107. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous I¾S production inhibits a microbial H^S-generating enzyme.
108. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous I¾S production inhibits microbial cystathionine β-synthase (CBS) or paralogs thereof.
109. The composition of claim 108, further comprising an inhibitor of microbial cystathionine γ-lyase (CSE) or paralogs thereof.
110. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous I¾S production inhibits microbial 3-mercaptopyruvate sulfurtransferase (3MST) or paralogs thereof.
111. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous I¾S production inhibits microbial cystathionine γ-lyase (CSE) or paralogs thereof.
112. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous I¾S production is amino-oxyacetate (AOAA).
113. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous H2S production is hydroxylamine.
114. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous H2S production is D,L-propargylglycine (PAG).
115. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous H2S production is β-cyano-L-alanine.
116. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous H S production is aspartate or a derivative thereof.
117. The composition of any one of claims 101-103, wherein the inhibitor of microbial endogenous H2S production is homocysteine.
118. The composition of claim 102 or 103, wherein the inhibitor of endogenous NO production is selected from the group consisting of L-arginine, N G -monomethyl-L- arginine, N G-nitro-L-arginine methyl ester, N G -nitro-L-arginine, N G -amino-L- arginine, N G ,N G-dimethylarginine (asymmetric dimethylarginine), L-thiocitrulline, S-methyl-L-thiocitrulline, diphenyleneiodonium chloride, 2-(4-carboxyphenyl)- 4,4,5,5-tetramethylimidazoline-l-oxy 3-oxide, 7-nitroindazole, N(5)-(l-iminoethyl)- L-ornithine, aminoguanidine, canavanine, ebselen, S-methyl-L-citrulline, S- methylisourea, and 2-mercaptoethylguanidine.
119. The composition of claim 102 or 103, wherein the inhibitor of endogenous NO production is an iNOS-specific inhibitor.
120. The composition of claim 102 or 103, wherein the NO scavenger is selected from the group consisting of non-heme iron-containing peptides, non-heme iron- containing proteins, porphyrins, metalloporphyrins, dithiocarbamates, dimercaptosuccinic acid, phenanthroline, desferoxamine, pyridoxal isonicotinoyl hydrazone, l,2-dimethyl-3hydroxypyrid-4-one, [+] 1, 2-bis (3,5-dioxopiperazine- lyl)propane, and 2-(4-carboxyphenyl)-4,5-dihydro-4,4,5,5-tetramethyl-lH-imidazolyl- l-oxy-3 -oxide.
121. The composition of claim 102 or 103, wherein the NO scavenger is a perfluorocarbon emulsion.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US13/983,149 US20140066362A1 (en) | 2011-02-01 | 2012-02-01 | Method for treating infections by targeting microbial h2s-producing enzymes |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201161438524P | 2011-02-01 | 2011-02-01 | |
| US61/438,524 | 2011-02-01 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012106469A2 true WO2012106469A2 (en) | 2012-08-09 |
| WO2012106469A3 WO2012106469A3 (en) | 2012-10-26 |
Family
ID=46603299
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2012/023542 Ceased WO2012106469A2 (en) | 2011-02-01 | 2012-02-01 | Methods for treating infections by targeting microbial h2s-producing enzymes |
Country Status (2)
| Country | Link |
|---|---|
| US (1) | US20140066362A1 (en) |
| WO (1) | WO2012106469A2 (en) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160081605A (en) * | 2014-12-31 | 2016-07-08 | (의료)길의료재단 | Pharmaceutical composition for preventing or treating for Helicobacter pylori infectious diseases |
| CN108486081A (en) * | 2018-05-04 | 2018-09-04 | 山西大学 | A kind of plant mercaptopyruvate sulfurtransferase and its application |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CZ305247B6 (en) * | 2013-09-20 | 2015-07-01 | Ústav molekulární genetiky AV ČR, v.v.i. | Pharmaceutical composition containing diphenyleneiodonium for treating diseases caused by parasites of Trypanosomatidae species |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4557035A (en) | 1982-09-13 | 1985-12-10 | Chiron-Werke Gmbh | Machine tool with tool magazine |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3733358A (en) * | 1970-12-28 | 1973-05-15 | Richter Gedeon Vegyeszet | Alfa-aminooxy-carboxylic amide derivatives |
| GB0212622D0 (en) * | 2002-05-31 | 2002-07-10 | Natural Technologies Group Ltd | Bacterial transforming agent |
| AU2003270689A1 (en) * | 2002-09-19 | 2004-04-08 | New York University | Control of nitric oxide bioactivity by perfluorocarbons |
| US7662856B2 (en) * | 2003-08-29 | 2010-02-16 | The University Of Houston System | Compositions having antimycrobial activity including a hydroxamate or a hydroxamate and a hydroxlyamine |
| US20090233888A1 (en) * | 2005-03-23 | 2009-09-17 | Usc Stevens, University Of Southern California | Treatment of disease conditions through modulation of hydrogen sulfide produced by small intestinal bacterial overgrowth |
| US7531164B2 (en) * | 2005-10-21 | 2009-05-12 | Duke University | Preventing bacterial or viral infectivity and composition containing infection preventing additive |
| US20100292472A1 (en) * | 2008-01-23 | 2010-11-18 | Tomoko Toyama | Prophylactic and therapeutic medicine for malaria |
| WO2010072807A2 (en) * | 2008-12-23 | 2010-07-01 | Fondation Jerome Lejeune | Inhibitors of cystathionine beta synthase to reduce the neurotoxic overproduction of endogenous hydrogen sulfide |
| EP2536411A4 (en) * | 2010-02-18 | 2013-08-07 | Univ Princeton | INHIBITORS OF FATTY ACID METABOLISM LONG AND VERY LONG CHAIN AS BROAD SPECTRUM ANTIVIRALS |
-
2012
- 2012-02-01 WO PCT/US2012/023542 patent/WO2012106469A2/en not_active Ceased
- 2012-02-01 US US13/983,149 patent/US20140066362A1/en not_active Abandoned
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4557035A (en) | 1982-09-13 | 1985-12-10 | Chiron-Werke Gmbh | Machine tool with tool magazine |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20160081605A (en) * | 2014-12-31 | 2016-07-08 | (의료)길의료재단 | Pharmaceutical composition for preventing or treating for Helicobacter pylori infectious diseases |
| KR101647899B1 (en) | 2014-12-31 | 2016-08-12 | (의료)길의료재단 | Pharmaceutical composition for preventing or treating for Helicobacter pylori infectious diseases |
| CN108486081A (en) * | 2018-05-04 | 2018-09-04 | 山西大学 | A kind of plant mercaptopyruvate sulfurtransferase and its application |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2012106469A3 (en) | 2012-10-26 |
| US20140066362A1 (en) | 2014-03-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| Cascioferro et al. | Therapeutic strategies to counteract antibiotic resistance in MRSA biofilm‐associated infections | |
| Campestre et al. | Carbonic anhydrases: new perspectives on protein functional role and inhibition in Helicobacter pylori | |
| Römling et al. | Biofilm infections, their resilience to therapy and innovative treatment strategies | |
| Marcinkiewicz et al. | Taurine and inflammatory diseases | |
| Maybin et al. | Cold atmospheric pressure plasma-antibiotic synergy in Pseudomonas aeruginosa biofilms is mediated via oxidative stress response | |
| Gottardi et al. | N-chloramines, a promising class of well-tolerated topical anti-infectives | |
| Kanagaratnam et al. | An efflux pump (MexAB-OprM) of Pseudomonas aeruginosa is associated with antibacterial activity of Epigallocatechin-3-gallate (EGCG) | |
| RU2529799C2 (en) | Compositions for enhancing antibacterial activity of myeloperoxidase and methods of their application | |
| Patange et al. | The effect of atmospheric cold plasma on bacterial stress responses and virulence using Listeria monocytogenes knockout mutants | |
| WO2012149058A2 (en) | Methods and system for interfering with viability of bacteria and related compounds and compositions | |
| US20120172292A1 (en) | Method for protection of antimicrobial and anticancer drugs from inactivation by nitric oxide | |
| Seregina et al. | Enhancement of the bactericidal effect of antibiotics by inhibition of enzymes involved in production of hydrogen sulfide in bacteria | |
| Dubey et al. | Drug-resistant Acinetobacter baumannii: mortality, emerging treatments, and future pharmacological targets for a WHO priority pathogen | |
| Mohammadzamani et al. | Inhibitory effects of Cinnamaldehyde, Carvacrol, and honey on the expression of exoS and ampC genes in multidrug-resistant Pseudomonas aeruginosa isolated from burn wound infections | |
| Fruci et al. | Bacterial stress responses as determinants of antimicrobial resistance | |
| Yang et al. | In vitro and in vivo enhancement effect of glabridin on the antibacterial activity of colistin, against multidrug resistant Escherichia coli strains | |
| US20140066362A1 (en) | Method for treating infections by targeting microbial h2s-producing enzymes | |
| Kwon et al. | Tailoring formulation for enhanced phage therapy in canine otitis externa: a cocktail approach targeting Pseudomonas aeruginosa and Staphylococcus pseudintermedius | |
| Rose et al. | Host DNA repair response to oxidative damage is modulated by Trypanosoma cruzi in a strain-dependent manner | |
| CA3046254C (en) | Use of cranberry derived phenolic compounds as antibiotic synergizing agent against pathogenic bacteria | |
| US20200398077A1 (en) | System and method to eradicate a majority of disease-causing germs and produce avirulent phenotype survivors susceptible to microbicides using a light dose regiment | |
| RoyChowdhury et al. | Colistin resistance in the era of antimicrobial resistance: challenges and strategic countermeasures | |
| CA3131230A1 (en) | Anti-bacterial combination therapy | |
| Rathod et al. | Strategies for biofilm inhibition: the role of synthetic drug-and nanotechnology-based agents | |
| Fekrirad et al. | Oxidative stress and the response of bacteria to it |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 12742211 Country of ref document: EP Kind code of ref document: A2 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13983149 Country of ref document: US |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 12742211 Country of ref document: EP Kind code of ref document: A2 |

