WO2012061741A2 - Control and characterization of psychotic states - Google Patents

Control and characterization of psychotic states Download PDF

Info

Publication number
WO2012061741A2
WO2012061741A2 PCT/US2011/059383 US2011059383W WO2012061741A2 WO 2012061741 A2 WO2012061741 A2 WO 2012061741A2 US 2011059383 W US2011059383 W US 2011059383W WO 2012061741 A2 WO2012061741 A2 WO 2012061741A2
Authority
WO
WIPO (PCT)
Prior art keywords
light
neurons
opsin
layer
depolarization
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/059383
Other languages
English (en)
French (fr)
Other versions
WO2012061741A3 (en
Inventor
Karl Deisseroth
Vikaas Sohal
Lisa Gunaydin
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Leland Stanford Junior University
Original Assignee
Leland Stanford Junior University
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2011323197A priority Critical patent/AU2011323197B2/en
Priority to EP11838895.8A priority patent/EP2635110B1/en
Priority to JP2013537878A priority patent/JP5986575B2/ja
Priority to ES11838895.8T priority patent/ES2682962T3/es
Priority to CA2816987A priority patent/CA2816987C/en
Priority to US13/882,566 priority patent/US20140082758A1/en
Priority to CN201180060052.2A priority patent/CN103339505B/zh
Application filed by Leland Stanford Junior University filed Critical Leland Stanford Junior University
Publication of WO2012061741A2 publication Critical patent/WO2012061741A2/en
Anticipated expiration legal-status Critical
Publication of WO2012061741A3 publication Critical patent/WO2012061741A3/en
Priority to US15/214,402 priority patent/US20160316732A1/en
Priority to US17/002,330 priority patent/US20210059230A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • A01K67/0278Knock-in vertebrates, e.g. humanised vertebrates
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K67/00Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
    • A01K67/027New or modified breeds of vertebrates
    • A01K67/0275Genetically modified vertebrates, e.g. transgenic
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/0075Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the delivery route, e.g. oral, subcutaneous
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K49/00Preparations for testing in vivo
    • A61K49/0004Screening or testing of compounds for diagnosis of disorders, assessment of conditions, e.g. renal clearance, gastric emptying, testing for diabetes, allergy, rheuma, pancreas functions
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61NELECTROTHERAPY; MAGNETOTHERAPY; RADIATION THERAPY; ULTRASOUND THERAPY
    • A61N5/00Radiation therapy
    • A61N5/06Radiation therapy using light
    • A61N5/0613Apparatus adapted for a specific treatment
    • A61N5/0618Psychological treatment
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/18Antipsychotics, i.e. neuroleptics; Drugs for mania or schizophrenia
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0618Cells of the nervous system
    • C12N5/0619Neurons
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • G01N33/5058Neurological cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5082Supracellular entities, e.g. tissue, organisms
    • G01N33/5088Supracellular entities, e.g. tissue, organisms of vertebrates
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/05Animals comprising random inserted nucleic acids (transgenic)
    • A01K2217/052Animals comprising random inserted nucleic acids (transgenic) inducing gain of function
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0393Animal model comprising a reporter system for screening tests

Definitions

  • This application pertains to methods for inducing psychosis in non-human animals using light-responsive opsin proteins expressed on the plasma membranes of a subset of layer V pyramidal neurons in the prefrontal cortex and methods for identifying or screening a compound that may be used for treating psychosis.
  • Schizophrenia affects approximately 1% of the population worldwide and ranks among the top 10 causes of disability in developed countries, but current pharmacotherapies are often ineffective and induce serious treatment-limiting side effects. It is widely believed that dysfunction of the prefrontal cortex (PFC) underlies many of the most debilitating aspects of schizophrenia (1, 2); however, it has not been possible to causally link specific aspects of cellular physiology to prefrontal dysfunction in schizophrenia. To search for possible cellular underpinnings of the psychotic behavior and impaired cognition observed in schizophrenia and related conditions, we sought to identify patterns of cellular behavior that (1) occur in neurons relevant to psychotic behaviors, (2) result from multiple pharmacologic or genetic manipulations linked to schizophrenia, and (3) hold face validity as cellular endophenotypes for psychosis.
  • non-human animals comprising a light- responsive opsin expressed on the cell membrane of a subset of layer V pyramidal neurons in the prefrontal cortex, wherein light activation of the opsin induces depolarization of the membrane, and wherein the illumination of the opsin with the light induces psychosis of the animal.
  • the subset of layer V pyramidal neurons have a single large apical dendrite.
  • the opsin is selected from the group consisting of ChR2, VChRl, and DChR.
  • the opsin is selected from the group consisting of SFO, SSFO, C1V1, C1V1-E122T, C1V1-E162T, and C1V1-E122T/E162T.
  • opsin induces depolarization of the membrane by light
  • illumination of the opsin with the light induces psychosis of the animal.
  • opsin is selected from the group consisting of ChR2, VChRl, and DChR.
  • the opsin is selected from the group consisting of SFO, SSFO, C1V1, C1V1-E122T, C1V1-E162T, and C1V1-E122T/E162T.
  • prefrontal cortex tissue slices comprising a subset of layer V pyramidal neurons, wherein a light-responsive opsin is expressed on the cell membrane of the apical dentrites in layer V pyramidal neurons, and light activation of the light-responsive opsin induces depolarization of the membrane.
  • the subset of layer V pyramidal neurons have a single large apical dendrite.
  • the opsin is selected from the group consisting of ChR2, VChRl, and DChR.
  • the opsin is selected from the group consisting of SFO, SSFO, C1V1, C1V1-E122T, C1V1-E162T, and C1V1-E122T/E162T.
  • kits for screening a compound that may be useful for treating psychosis comprising measuring psychotic state of a non-human animal before and after administering the compound to the prefrontal cortex of the animal, wherein the psychotic state is induced by light activation of a light-responsive opsin expressed on the cell membrane of a subject of layer V pyramidal neurons in the animal, and activation of the opsin induces depolarization of the membrane; wherein an improvement in one or more of a psychotic state measurements after the administration of the compound indicates that the compound may be useful for treating psychosis
  • the psychotic state measurement is a behavioral measurement.
  • the psychotic state measurement is a cellular measurement.
  • the method further comprises a step of administering a D2 agonist to the animal before administration of the compound.
  • kits for screening a compound that may be useful for treating psychosis comprising: measuring a psychotic state of a prefrontal cortex tissue slice before and after incubating the tissue slice with the compound, wherein the prefrontal cortex tissue slice comprises a subject of layer V pyramidal neurons and a light- responsive opsin is expressed on the cell membrane of the subject of layer V pyramidal neurons, wherein the psychotic state is induced by the membrane depolarization of the neurons induced by activation of the light-responsive opsin; wherein an improvement in one or more of a psychotic state readouts after incubation with the compound indicates that the compound may be useful for treating psychosis.
  • the psychotic state measurement is a cellular measurement.
  • the method further comprises a step of incubating a D2 agonist with the prefrontal cortex tissue slice before incubation with the compound.
  • the present disclosure relates to identifying neural cell populations involved in various psychiatric disorders, as described herein. While the present disclosure is not necessarily limited in these contexts, various aspects of the invention may be appreciated through a discussion of examples using these and other contexts.
  • aspects of the present disclosure are directed to a method of identifying neural cell populations implicated in various psychiatric disorders.
  • the method includes providing optical stimulation to a target neuron population that expresses a light-responsive opsin.
  • a first electrical pattern of a target neuron cell population in response to the optical stimulation is measured.
  • a drug known to induce a disorder of interest, is introduced to the target neuron cell population.
  • Optical stimulation is again provided to the target neuron
  • a subsequent electrical pattern of the target neuron cell population, in response to the optical stimulation, is measured.
  • the first electrical pattern and the subsequent electrical pattern are then compared.
  • the comparison of the electrical patterns can be used to determine, for example, which neurons are involved in creating a disease-like state.
  • subsequent potential treatments can be targeted at the specific neuron population.
  • additional studies may be done on the specific neuron population to determine the mechanisms behind the aberrant behavior, for example.
  • aspects of the present disclosure are directed to comparing the electrical activity of a target neuron population of interest before and after the introduction of a drug known to induce a disorder of interest.
  • a stimulus is provided both before and after the introduction of the drug, and the electrical response patterns to the drug are compared.
  • the stimulus can be, for example, an optical stimulus, an electrical stimulus, or magnetic stimulus.
  • an area of interest within the brain is chosen. This choice can be made based on previous knowledge regarding the function of the brain and the mechanisms by which drugs, targeted at psychiatric disorders, work.
  • Layer V pyramidal neurons were previously linked to certain forms of psychosis. Aspects of the present invention allowed for the identification of a subset of pyramidal neurons linked to psychotic behavior, by examining the layer V pyramidal neurons using a combination of optical stimulation and induction of aberrant behavior in a subject by introducing substances previously found to induce the aberrant behavior.
  • This identification of a neuron population linked to psychotic behavior allows for the efficient testing of possible treatments for various psychotic behaviors. Once the reaction of particular neuron during psychosis is known and compared to the reaction when psychosis has not been introduced, various treatments can be tested based on the treatment's ability to return the neuron reaction to its baseline state.
  • Certain aspects of the present disclosure are also directed to gaining a better understanding of the mechanisms within the brain and a particular neuron population that cause psychosis. After a particular neuron of interest is identified, the channels within the neuron, as well as the pathways connecting the neuron to other neurons, can be studied in greater detail. This can lead to new insights regarding the cause of various forms of psychosis.
  • the present disclosure further relates to specific neural cell populations involved in various psychiatric disorders including psychosis (and/or symptoms of psychosis), as described herein. While the present disclosure is not necessarily limited in these contexts, various aspects of the invention may be appreciated through a discussion of examples using these and other contexts. Aspects of the present disclosure are directed to a method of involving a specific neural cell populations implicated in various psychiatric disorders, including psychosis (and/or the symptoms of psychosis). The method includes providing optical stimulation to a target neuron population that expresses a light responsive opsin. A first electrical pattern of a target neuron cell population in response to the optical stimulation is measured.
  • a drug known to induce symptoms of psychosis, is introduced to the target neuron cell population.
  • Optical stimulation is again provided to the target neuron population.
  • the first electrical pattern and the subsequent electrical pattern are then compared.
  • the comparison of the electrical patterns can be used to determine, for example, which neurons are involved in creating a disease-like state.
  • subsequent potential treatments can be targeted at the specific neuron population.
  • additional studies may be done on the specific neuron population to determine the mechanisms behind the aberrant behavior, for example.
  • the additional studies can be performed using a variety of stimuli including optical stimuli, electrical stimuli, and/or magnetic stimuli.
  • aspects of the present disclosure are directed to inducing a disease state by controlling properties of a target neuron population known to be involved in psychosis.
  • the neurons of the target neuron population have a single, large apical dendrite.
  • the target neuron population is modified with a light-responsive molecule.
  • Light is provided to the target neuron population, thereby activating the light-responsive molecule.
  • a drug is introduced to the target neuron population causing the membrane potential of the neurons to remain elevated after removal of the light.
  • the elevated membrane potential results in a modified cell response to stimulus, as well as activation of the neuron when no stimulus is present.
  • Experimental results show that a subject, who has this neuron activity induced in certain neuron populations having a single, large apical dendrite, exhibits behaviors consistent with psychosis.
  • this modified neuron activity is used as an aid in determining possible treatments for psychosis.
  • the disease state can be induced before various potential treatments are tested.
  • the testing can include introducing the treatment to the neurons, stimulating the neurons, and comparing the response in the presence of the treatment to the response in the absence of the treatment.
  • FIG. 1 demonstrates psychotic-like behaviors induced by optical stimulation of infralimbic layer V pyramidal neurons in Thyl ::ChR2 transgenic mice.
  • C) Low-frequency optical stimulation of layer V neurons with 473 nm blue light (10 Hz, 5-ms pulse width) significantly decreased social exploration of a novel juvenile in 6 of 6 Thyl::ChR2-EYFP animals tested (p 0.03; light on/ light off epochs interleaved).
  • FIG. 2 shows that the D2 agonist quinpirole modulates responses of prefrontal networks in vitro to ChR2 stimulation in Thyl ::ChR2 transgenic mice.
  • this layer V pyramidal neuron After applying quinpirole (20 ⁇ ; purple, middle trace), this layer V pyramidal neuron exhibits a prolonged depolarization that outlasts the period of light stimulation and produces spiking. The prolonged depolarization is abolished after washing out quinpirole and applying haloperidol (1 ⁇ ; green, bottom trace).
  • the control top trace ending on the right portion of (D)
  • quinpirole middle trace ending on the right portion of (D)
  • haloperidol/sulpiride trace bottom trace ending on the right portion of (D)
  • E The number of spikes as a function of interspike interval for the same cells depicted in C.
  • F responses of a layer V pyramidal neuron (in which quinpirole elicits an activity-dependent depolarization) to a combination of ChR2 and network-driven activity after a single 1 msec light flash in Control conditions (black trace; top trace ending on the right portion of (F)), quinpirole (20 ⁇ ; purple trace; bottom trace ending on the right portion of (F)), and quinpirole + sulpiride (5 ⁇ ; green trace; middle trace ending on the right portion of (F)).
  • Arrows indicate the spike AHP.
  • FIG. 3 demonstrates that D2 receptor activation elicits an activity-dependent depolarization mediated by L-type Ca 2+ channels.
  • A, C, G Responses of layer V pyramidal neurons to hyperpolarizing and/or depolarizing current pulses in various pharmacologic conditions.
  • B Morphology of layer V pyramidal neurons that do (left) and do not (right) exhibit the activity-dependent depolarization and afterdepolarization during responses to depolarizing current pulses in quinpirole (responses to depolarizing and hyperpolarizing current pulses below each cell).
  • D Top: Time constants for the membrane potential to decay by 63% or 90% towards baseline after a 250 pA depolarizing current pulse in control conditions (black; left bar) or quinpirole (purple; right bar).
  • FIG. 4 shows that phencyclidine (PCP) also elicits an activity-dependent depolarization via L-type Ca channels.
  • PCP phencyclidine
  • FIG. 5 shows a model, in accordance with an example embodiment of the present disclosure.
  • FIG. 6 shows a method of identifying a cell of interest, in accordance with an example embodiment.
  • FIG. 7 shows a model for characterizing neural disorders, in accordance with an example embodiment of the present disclosure.
  • FIG. 8 shows a method of determining the efficacy of a treatment, in accordance with an example embodiment.
  • the invention provides non-human animals with psychosis induced by activating a light-responsive opsin expressed on the plasma membrane of a subject of layer V pyramidal neurons of the prefrontal cortex, wherein activation of the light-response opsin induces depolarization of the membrane.
  • the prefrontal cortex tissue slices from the non-human animals are also provided.
  • the invention also provides methods of inducing psychosis in non-human animals and methods for identifying or screening a compound that may be used for treating psychosis using the non-human animals and tissue slices described herein.
  • an "animal” is a mammal. Mammals include, but are not limited to, humans, farm animals, sport animals, pets (e.g., dogs, and cats), primates, mice, rats, and other rodents.
  • the schizophrenia is induced.
  • Optogenetics refers to the combination of genetic and optical methods used to control specific events in targeted cells of living tissue, even within freely moving mammals and other animals, with the temporal precision (millisecond-timescale) needed to keep pace with functioning intact biological systems.
  • Optogenetics requires the introduction of fast light-responsive channel or pump proteins to the plasma membranes of target neuronal cells that allow temporally precise manipulation of neuronal membrane potential while maintaining cell-type resolution through the use of specific targeting mechanisms.
  • Light-responsive opsins that may be used in the present invention include opsins that induce depolarization of the cell membrane of neurons by light. Examples of such opsins are shown in Table 1 below.
  • Table 1 shows identified opsins for excitation and modulation across the visible spectrum:
  • a light-responsive opsin such as ChR2, VChRl, DChR, and ChETA
  • a light-responsive opsin includes naturally occurring protein and functional variants, fragments, fusion proteins comprising the fragments or the full length protein.
  • the signal peptide may be removed.
  • a variant may have an amino acid sequence at least about any of 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the naturally occurring protein sequence.
  • a functional variant may have the same or similar depolarization function as the naturally occurring protein.
  • the present disclosure provides for the modification of light-responsive opsin proteins expressed in a cell by the addition of one or more amino acid sequence motifs which enhance transport to the plasma membranes of mammalian cells.
  • Light-responsive opsin proteins having components derived from evolutionarily simpler organisms may not be expressed or tolerated by mammalian cells or may exhibit impaired subcellular localization when expressed at high levels in mammalian cells. Consequently, in some embodiments, the light- responsive opsin proteins expressed in a cell can be fused to one or more amino acid sequence motifs selected from the group consisting of a signal peptide, an endoplasmic reticulum (ER) export signal, a membrane trafficking signal, and/or an N-terminal golgi export signal.
  • ER endoplasmic reticulum
  • the one or more amino acid sequence motifs which enhance light- responsive opsin protein transport to the plasma membranes of mammalian cells can be fused to the N- terminus, the C-terminus, or to both the N- and C-terminal ends of the light- responsive opsin protein.
  • the light- responsive opsin protein and the one or more amino acid sequence motifs may be separated by a linker.
  • the light- responsive opsin protein can be modified by the addition of a trafficking signal (ts) which enhances transport of the protein to the cell plasma membrane.
  • the trafficking signal can be derived from the amino acid sequence of the human inward rectifier potassium channel Kj r 2.1.
  • the trafficking signal can comprise the amino acid sequence KSRITSEGEYIPLDQIDINV.
  • the signal peptide sequence in the protein can be deleted or substituted with a signal peptide sequence from a different protein.
  • the light-responsive opsin protein is a light-responsive channel protein.
  • one or more members of the Channelrhodopsin family of light-responsive ion channels are expressed on the plasma membranes of the subset of layer V pyramidal neurons in the prefrontal cortex.
  • the light-responsive cation channel protein can be derived from
  • Chlamydomonas reinhardtii wherein the cation channel protein can be capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
  • the light-responsive cation channel protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence shown in SEQ ID NO: 1.
  • the light used to activate the light- responsive cation channel protein derived from Chlamydomonas reinhardtii can have a wavelength between about 460 and about 495 nm or can have a wavelength of about 470 nm. Additionally, the light can have an intensity of at least about 100 Hz. In some embodiments, activation of the light-responsive cation channel derived from
  • Chlamydomonas reinhardtii with light having an intensity of 100 Hz can cause
  • the light-responsive cation channel protein can additionally comprise substitutions, deletions, and/or insertions introduced into a native amino acid sequence to increase or decrease sensitivity to light, increase or decrease sensitivity to particular wavelengths of light, and/or increase or decrease the ability of the light-responsive cation channel protein to regulate the polarization state of the plasma membrane of the cell.
  • the. light-responsive cation channel protein can contain one or more
  • the light-responsive cation channel protein comprising substitutions, deletions, and/or insertions introduced into the native amino acid sequence suitably retains the ability to depolarize the plasma membrane of a neuronal cell in response to light.
  • the light-responsive cation channel protein can be a step function opsin (SFO) protein or a stabilized step function opsin (SSFO) protein that can have specific amino acid substitutions at key positions throughout the retinal binding pocket of the protein.
  • the SFO protein can have a mutation at amino acid residue C128 of SEQ ID NO:l.
  • the SFO protein has a C128A mutation in SEQ ID NO:l.
  • the SFO protein has a C128S mutation in SEQ ID NO: 1.
  • the SFO protein has a C128T mutation in SEQ ID NO: 1.
  • the SSFO protein can have a mutation at amino acid residues CI 28 and D156 of SEQ ID NO:l. In other embodiments, the SSFO protein has a C128S mutation and a D156A mutation in SEQ ID NO:l . In some embodiments, the SFO protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%), or 100%) identical to the sequence shown in SEQ ID NO:2 or SEQ ID NO:3.
  • the light-responsive cation channel protein can be a CI VI chimeric protein derived from the VChRl protein of Volvox carteri and the ChRl protein from Chlamydomonas reinhardti, wherein the protein comprises the amino acid sequence of VChRl having at least the first and second transmembrane helices replaced by the first and second transmembrane helices of ChRl ; is responsive to light; and is capable of mediating a depolarizing current in the cell when the cell is illuminated with light.
  • the invention can include polypeptides comprising substituted or mutated amino acid sequences, wherein the mutant polypeptide retains the characteristic light- responsive nature of the precursor CI VI chimeric polypeptide but may also possess altered properties in some specific aspects.
  • the mutant light-responsive CI VI chimeric proteins described herein can exhibit an increased level of expression both within an animal cell or on the animal cell plasma membrane; an altered responsiveness when exposed to different wavelengths of light, particularly red light; and/or a combination of traits whereby the chimeric CI VI polypeptide possess the properties of low desensitization, fast deactivation, low violet-light activation for minimal cross-activation with other light- responsive cation channels, and/or strong expression in animal cells.
  • the ClVl protein can comprise an amino acid sequence at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%), 99%, or 100% identical to the sequence shown in SEQ ID NOs:4, 5, 6, or 7.
  • Further disclosure related to light-responsive cation channel proteins can be found in U.S. Patent Application Publication No. 2007/0054319 and International Patent Application Publication Nos. WO 2009/131837 and WO 2007/024391. Further disclosure related to SFO or SSFO proteins can be found in International Patent Application Publication No. WO 2010/056970 and U.S. Provisional Patent Application Nos. 61/410,704 and 61/511,905.
  • the disclosure also provides polynucleotides comprising a nucleotide sequence encoding a light-responsive opsin protein described herein.
  • the polynucleotide comprises an expression cassette.
  • the polynucleotide is a vector comprising the above-described nucleic acid.
  • the nucleic acid encoding a light-responsive opsin protein of the disclosure is operably linked to a promoter. Promoters are well known in the art. Any promoter that functions in a cholinergic interneuron can be used for expression of the light-responsive proteins and/or any variant thereof of the present disclosure.
  • Initiation control regions or promoters which are useful to drive expression of the light-responsive opsin proteins or variant thereof in a specific animal cell are numerous and familiar to those skilled in the art. Virtually any promoter capable of driving these nucleic acids can be used.
  • the promoter used to drive expression of the light-responsive protein can be the thymus cell antigen 1 (Thyl) promoter, which is capable of driving robust expression of transgenes in pyramidal neurons of the prefrontal cortex ⁇ See, e.g., Arenkiel et al, Neuron 54, 205 (Apr 19, 2007)).
  • vectors comprising a nucleotide sequence encoding a light- responsive opsin protein or any variant thereof described herein.
  • the vectors that can be administered according to the present invention also include vectors comprising a nucleotide sequence which encodes an R A ⁇ e.g., an mR A) that when transcribed from the polynucleotides of the vector will result in the accumulation of light-responsive proteins on the plasma membranes of target animal cells.
  • Vectors which may be used include, without limitation, lentiviral, HSV, adenoviral, and adeno-associated viral (AAV) vectors.
  • Lentiviruses include, but are not limited to FflV-l, HIV-2, SIV, FTV and EIAV. Lentiviruses may be pseudotyped with the envelope proteins of other viruses, including, but not limited to VSV, rabies, Mo-MLV, baculovirus and Ebola. Such vectors may be prepared using standard methods in the art.
  • the vector is a recombinant AAV vector.
  • AAV vectors are DNA viruses of relatively small size that can integrate, in a stable and site-specific manner, into the genome of the cells that they infect. They are able to infect a wide spectrum of cells without inducing any effects on cellular growth, morphology or differentiation, and they do not appear to be involved in human pathologies.
  • the AAV genome has been cloned, sequenced and characterized. It encompasses approximately 4700 bases and contains an inverted terminal repeat (ITR) region of approximately 145 bases at each end, which serves as an origin of replication for the virus.
  • ITR inverted terminal repeat
  • the remainder of the genome is divided into two essential regions that carry the encapsidation functions: the left-hand part of the genome, that contains the rep gene involved in viral replication and expression of the viral genes; and the right-hand part of the genome, that contains the cap gene encoding the capsid proteins of the virus.
  • AAV vectors may be prepared using standard methods in the art.
  • Adeno-associated viruses of any serotype are suitable (see, e.g., Blacklow, pp. 165-174 of " Parvoviruses and Human Disease” J. R. Pattison, ed. (1988); Rose, Comprehensive Virology 3:1, 1974; P. Tattersall "The Evolution of Parvovirus Taxonomy” In Parvoviruses (JR Kerr, SF Cotmore. ME Bloom, RM Linden, CR Parrish, Eds.) p5-14, Hudder Arnold, London, UK (2006); and DE Bowles, JE Rabinowitz, RJ Samulski "The Genus Dependovirus” (JR Kerr, SF Cotmore.
  • the replication defective recombinant AAVs according to the invention can be prepared by co-transfecting a plasmid containing the nucleic acid sequence of interest flanked by two AAV inverted terminal repeat (ITR) regions, and a plasmid carrying the AAV encapsidation genes (rep and cap genes), into a cell line that is infected with a human helper virus (for example an adenovirus).
  • ITR inverted terminal repeat
  • rep and cap genes AAV encapsidation genes
  • the vector(s) for use in the methods of the invention are encapsidated into a virus particle (e.g. AAV virus particle including, but not limited to, AAV1, AAV2, AAV3, AAV4, AAV5,AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAV14, AAV15, and AAV16).
  • a virus particle e.g. AAV virus particle including, but not limited to, AAV1, AAV2, AAV3, AAV4, AAV5,AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAV14, AAV15, and AAV16.
  • the invention includes a recombinant virus particle (recombinant because it contains a recombinant polynucleotide) comprising any of the vectors described herein. Methods of producing such particles are known in the art and are described in U.S. Patent No. 6,596,535,
  • polynucleotides encoding the light-responsive opsin proteins disclosed herein can be delivered directly to the pyramidal neurons of the prefrontal cortex of an animal using a needle, catheter, or related device, using neurosurgical techniques known in the art, such as by stereotactic injection (See, e.g. , Stein et al., J. Virol, 73:34243429, 1999; Davidson et al., PNAS, 97:3428-3432, 2000;
  • a light-responsive opsin proteins can be expressed in the pyramidal neurons of the prefrontal cortex of a transgenic animal.
  • a transgenic mouse line can be employed using Cre-recombinase under control of the thymus cell antigen 1 (Thyl) promoter.
  • a Cre-inducible adeno-associated virus (AAV) vector carrying the light- responsive opsin gene can then be stereotaxically injected into the prefrontal cortex.
  • AAV adeno-associated virus
  • any of the light-responsive opsin proteins can be expressed in the pyramidal neurons of the prefrontal cortex of a transgenic animal.
  • a transgenic mouse line can be employed using ChR2 under control of the thymus cell antigen 1 (Thyl) promoter.
  • Transgenic mice can be generated using standard pronuclear injection techniques (See, e.g., Arenkiel et cd., Neuron 54, 205 (Apr 19, 2007)).
  • Other methods to deliver the light-responsive proteins to pyramidal neurons can also be used, such as, but not limited to, transfection with ionic lipids or polymers,
  • the invention provides non-human animals generated by any methods described herein.
  • the non-human animals comprise a light- responsive opsin protein expressed on the cell membrane of a subset of layer V pyramidal neurons of the prefrontal cortex of the animal, wherein the opsin induces depolarization of the membrane by light, and wherein the illumination of the opsin by the light induces psychosis of the animal.
  • the invention provides a prefrontal cortex tissue slice comprising a subset of layer V pyramidal neurons of the prefrontal cortex from a non- human animal, wherein a light-responsive opsin is expressed on the cell membrane of the subset of layer V pyramidal neurons, and activation of the opsin by light induces
  • any device that is capable of applying light having a wavelength to activate the light- responsive proteins expressed in a neuron may be used to depolarize the neuron.
  • a light-delivery device for activating a light-responsive opsin protein to affect the membrane voltage of one or more neurons may be used.
  • a light-delivery device can be configured to provide optical stimulus to a target region of the brain.
  • the light-delivery device may comprise a base, a cannula guide that is attached to the base, and one or more optical conduits attached to the base via the cannula guide.
  • the base may comprise one or more light delivery ports that are positioned to deliver light from the optical conduits to targeted tissue regions, such as the pyramidal neurons in the prefrontal cortex.
  • the optical conduits may be optical fibers, where the proximal end of the fiber is attached to an optical light source, and the distal end is in communication with the light delivery ports.
  • the optical light source may be capable of providing continuous light and/or pulsed light, and may be programmable to provide light in pre-determined pulse sequences.
  • the light delivery device may have any number of optical conduits as may be desirable, e.g., 1, 2, 3, 4, 5, 10, 15, 20, etc.
  • the optical conduits may each carry light of the same or different wavelengths.
  • the delivered light may have a wavelength between 450 nm and 600 nm, such as yellow or green or blue light.
  • the light delivery device may have any number of light delivery ports as may be desirable, e.g., 1, 2, 3, 4, 5, 10, 15, 20, etc.
  • the light delivery device is configured to deliver light to the subset of layer V pyramidal neurons of the prefrontal cortex to induce depolarization of the opsin proteins expressed on the cell membrane of the subset of layer V pyramidal neurons.
  • Light delivery devices may also comprise one or more measurement electrodes that may be configured for measuring neural activity.
  • measurement electrodes may record changes in the membrane potential (e.g., action potentials) and/or current flow across a membrane of one or more neurons as the neurons respond to a stimulus.
  • the measurement electrodes may measure the electrical response of one or more neurons to optical stimulation.
  • Measurement electrodes may be extracellular or intracellular electrodes.
  • the light delivery device can be an implantable light source that does not require physical tethering to an external power source.
  • the implantable light source can comprise an inner body, the inner body having at least one means for generating light which is configured to a power source.
  • the power source can be an internal battery for powering the light-generating means.
  • the implantable light source can comprise an external antenna for receiving wirelessly transmitted
  • the wirelessly transmitted electromagnetic energy can be a radio wave, a microwave, or any other electromagnetic energy source that can be transmitted from an external source to power the light-generating means of the implantable light source.
  • the light-generating means is controlled by an integrated circuit produced using semiconductor or other processes known in the art.
  • the light means can be a light emitting diode (LED).
  • the LED can generate blue and/or green light.
  • the LED can generate amber, yellow and/or blue light.
  • several micro LEDs are embedded into the inner body of the implantable light source.
  • the light-generating means is a solid state laser diode or any other means capable of generating light.
  • the light generating means can generate light having an intensity sufficient to activate the light-responsive proteins expressed on the plasma membrane of the nerves in proximity to the light source (such as a light cuff).
  • the intensity of the light reaching the cholinergic interneurons of the NAc or striatum produced by the light-generating means has an intensity of any of about 0.05 mW/mm 2 , 0.1 mW/mm 2 , 0.2 mW/mm 2 , 0.3 mW/mm 2 , 0.4 mW/mm 2 , 0.5 mW/mm 2 , about 0.6 mW/mm 2 , about 0.7 mW/mm 2 , about 0.8 mW/mm 2 , about 0.9 mW/mm 2 , about 1.0 mW/mm 2 , about 1.1 mW/mm 2 , about 1.2 mW/mm 2 , about 1.3 mW/mm 2 , about 1.4 mW/mm 2 , about 1.5 mW/mm 2 , about 1.6 mW/mm 2 , about 1.7 mW/mm 2 , about 1.8 mW/mm 2 , about 1.9 mW/mm 2 ,
  • the light-generating means can be externally activated by an external controller.
  • the external controller can comprise a power generator which can be mounted to a transmitting coil.
  • a battery can be connected to the power generator, for providing power thereto.
  • a switch can be connected to the power generator, allowing an individual to manually activate or deactivate the power generator.
  • the power generator upon activation of the switch, can provide power to the light-generating means on the light source through electromagnetic coupling between the transmitting coil on the external controller and the external antenna of the implantable light source.
  • the transmitting coil can establish an electromagnetic coupling with the external antenna of the implantable light source when in proximity thereof, for supplying power to the light-generating means and for transmitting one or more control signals to the implantable light source.
  • the electromagnetic coupling between the transmitting coil of the external controller and the external antenna of the implantable light source can be radio-frequency magnetic inductance coupling.
  • the operational frequency of the radio wave can be between about 1 and 20 MHz, inclusive, including any values in between these numbers (for example, about 1 MHz, about 2 MHz, about 3 MHz, about 4 MHz, about 5 MHz, about 6 MHz, about 7 MHz, about 8 MHz, about 9 MHz, about 10 MHz, about 11 MHz, about 12 MHz, about 13 MHz, about 14 MHz, about 15 MHz, about 16 MHz, about 17 MHz, about 18 MHz, about 19 MHz, or about 20 MHz).
  • the invention provides methods for inducing psychosis in a non-human animal comprising: administering a polynucleotide encoding a light-responsive opsin protein to the non-human animal, wherein the light-responsive opsin protein is expressed on the cell membrane of a subset of layer V pyramidal neurons in the prefrontal cortex of the non- human animal, and the protein is responsive to light and is capable of inducing membrane depolarization of a subset of layer V pyramidal neurons when the subset of layer V pyramidal neurons are illuminated with the light, whereby activating the protein by the light induces psychosis in the non-human animal.
  • the schizophrenia is induced.
  • disruption of social exploration is induced.
  • the invention also provide methods for inducing depolarization of the membrane of a subset of layer V pyramidal neurons in a prefrontal cortex tissue slice comprising:
  • a light-responsive opsin protein expressed on the cell membrane of the subset of layer V pyramidal neurons in the prefrontal cortex tissue slice, wherein the light-responsive opsin protein is capable of inducing membrane depolarization of the neurons by light.
  • the non-human animals and prefrontal cortex tissue slices described herein may be used to identify, screen or test the effectiveness of a compound that is useful for treating psychosis (e.g., schizophrenia).
  • the invention provides methods of screening a compound that may be useful for treating psychosis, comprising measuring psychotic state of a non-human animal before and after administering the compound to the prefrontal cortex of the animal, wherein the psychotic state is induced by light activation of a light-responsive opsin expressed on the cell membrane of a subject of layer V pyramidal neurons in the animal, and activation of the opsin induces depolarization of the membrane; wherein an improvement in one or more of psychotic state measurements after the administration of the compound indicates that the compound may be useful for treating psychosis.
  • the psychotic state measurement is a behavioral measurement (such as social exploration). In some embodiments, the psychotic state measurement is a cellular measurement (such as electrophysiology measurement of depolarization patterns exhibited by a subset of layer V pyramidal neurons).
  • the method further comprises a step of administering a D2 agonist (such as quinpriole) to the animal before administration of the compound.
  • a D2 agonist such as quinpriole
  • the compound can be a D2 antagonist such as, but not limited to, sulpiride and haloperidol.
  • the compound can be an L-type Ca channel antagonist such as, but not limited to, nifedipine.
  • the invention also provides methods of screening a compound that may be useful for treating psychosis, comprising: measuring a psychotic state of a prefrontal cortex tissue slice before and after incubating the tissue slice with the compound, wherein the prefrontal cortex tissue slice comprises a subject of layer V pyramidal neurons and a light-responsive opsin is expressed on the cell membrane of the subject of layer V pyramidal neurons, wherein the psychotic state is induced by the membrane depolarization of the neurons induced by activation of the light-responsive opsin; wherein an improvement in one or more of a psychotic state readouts after incubation with the compound indicates that the compound may be useful for treating psychosis.
  • the psychotic state comprises a subject of layer V pyramidal neurons and a light-responsive opsin is expressed on the cell membrane of the subject of layer V pyramidal neurons, wherein the psychotic state is induced by the membrane depolarization of the neurons induced by activation of the light-responsive opsin; wherein an improvement in one or more of a psychotic state readouts
  • a measurement is a cellular measurement.
  • a D2 agonist such as quinpirole
  • the compound can be a D2 antagonist such as, but not limited to, sulpiride and haloperidol.
  • the compound can be an L-type Ca channel antagonist such as, but not limited to, nifedipine.
  • the present disclosure is believed to be useful for the identification of neural cell populations involved in various psychiatric disorders.
  • Specific applications of the present invention facilitate assessing disease models relating to neural cell populations linked to various psychiatric disorders.
  • the following discussion summarizes such previous developments to provide a solid understanding of the foundation and underlying teachings from which implementation details and modifications might be drawn including those found in the Examples. It is in this context that the following discussion is provided and with the teachings in the references incorporated herein by reference. While the present invention is not necessarily limited to such applications, various aspects of the invention may be appreciated through a discussion of various examples using this context.
  • identifying neural populations involved in psychiatric disorders comprising: providing optical stimulation to a target neuron population that expresses a light-responsive opsin, measuring a first electrical pattern of the target neuron population in response to the optical stimulation, introducing a drug, known to induce psychosis, to the target neuron population, providing optical stimulation to the target neuron population, measuring a subsequent electrical pattern of the target neuron population in response to the optical stimulation, and comparing the first electrical pattern and the subsequent electrical pattern.
  • identifying a subset of neurons associated with psychosis In some embodiments, the subset of neurons is a subset of layer V pyramidal neurons.
  • the target neuron cell population is in a patient.
  • the drug can be a D2 agonist such as, but not limited to, quinpirole.
  • the drug can be an NMDA receptor inhibitor such as, but not limited to, phencyclidine.
  • An area of interest within the brain is specified (500).
  • the area of interest can be chosen based on previously identified characteristics of a disease of interest or known functions of the area, for example.
  • One or more cell types within the area of interest are modified with an opsin (510).
  • Each of the different cell types can be modified with a different opsin that responds to a different wavelength of light.
  • the different cell types are modified with the same opsin, but in different samples or patients.
  • the different cell types in the area of interest are stimulated (520) with visible light in a range that is determined based on the opsin used to modify the particular cell type being stimulated.
  • the response of each cell type is observed (580).
  • a drug known to induce a particular state in a patient when observed on the macro level (instead of the cellular level) is introduced to the area of interest (530).
  • the response of each cell type in the presence of the drug is observed (590).
  • the responses of each cell type in the presence of the drug known to induce the particular state is compared (540) to the response of the same cell type to stimulation when the cells are in a "normal” or "natural” state (that is, without the drug being present). Based on the comparison a determination can be made as to whether one or more of the cell types is involved in creating the state triggered by the drug (550). If one or more of the responses in the presence of the drug differs from the baseline responses, the cell type with the changing response can be investigated further to determine whether the cell type is involved in causing the particular state being induced.
  • an area of interest can be studied in vivo(560), in vitro (570) or both.
  • slices of the area of interest that maintain the neural circuitry intact can be used.
  • Multiple sets of the slices are used, with a different cell type within the area of interest being modified in each set.
  • a single cell of each cell type in the area of interest can be studied.
  • the alternative in vitro method allows for the response of the cell in isolation, as well as its effect on the surrounding cells, to be observed.
  • the use of multiple sets of slices or single cells allows for a single opsin type to be used to modify all of the different cell types without causing all of the cells to fire at once.
  • studying an area of interest in vivo multiple subjects can be used with a different cell type being modified in each subject.
  • different excitatory opsins responsive to different wavelengths of light, can be used to modify the different cell types in the area of interest.
  • the area of interest is layer V of the prefrontal cortex.
  • the pyramidal neurons of Layer V are modified.
  • the prefrontal cortex is believed to be involved in psychotic states such as schizophrenia.
  • a drug such as quinpirole or PCP is introduced to the layer V pyramidal neurons.
  • a subset of the layer V pyramidal neurons has a different response. This subset of layer V pyramidal neurons can be used to study the effectiveness of various treatments for schizophrenia or other psychosis.
  • a target cell type is chosen (600). The choice of target cell can be made based on previous experimental results.
  • the target cells are stimulated, and the response to the stimulation is observed (610).
  • stimulation of the target cells is achieved by activating a light-responsive molecule that has been introduced into the target cells.
  • Psychosis is induced (620). This can be achieved by introducing a drug known to induce psychosis in a subject.
  • the target cells are again stimulated and the response is observed (630).
  • a comparison is made between the response of the target cells before the induction of psychosis and after the induction of psychosis (640). The comparison can be used to determine whether the target cells are involved in causing psychosis in the subject based on whether or not the cells react differently in the presence of the drug known to induce psychosis.
  • both a D2 agonist such as quinpirole and a psychotomimetic drug, such as phencyclidine (“PCP'), produce
  • Various aspects of the present disclosure are directed to characteristics of a subset of layer V pyramidal neurons in the prefrontal cortex. Characteristics of the subset include activity-dependent depolarization that elicits bistability and disrupts the flow of information through these neurons. The disruptive bistability depends on a Ca channel subtype (The L- type channel). This channel has been implicated previously in schizophrenia. Further, while depolarization of the subset neurons creates a non-social phenotype, blockade of the L-type channels corrects psychotomimetic-induced social dysfunction.
  • Certain aspects of the present disclosure are directed to identifying possible cellular underpinnings of psychotic behavior and impaired cognition as observed in schizophrenia and other related conditions.
  • Optogenetic tools are used to activate cells without introducing an outside electrical source. This allows for a response to activation, of a target cell population that has been infected with an opsin, to be observed without, for example, other cells in the area also being activated and altering the results.
  • the response of a cell is observed in the cells "natural" state, that is, without the presence of an additional stimulus known to cause behavior changes on a macro level. This response is then compared to the response of the cell of interest after a stimulus has been introduced.
  • Certain aspects of the present disclosure are directed to searching for specific neurons linked to prefrontal dysfunction in schizophrenia or other psychosis.
  • a particular area of the brain or type of neural cell can be chosen for further examination, such as layer V pyramidal neurons within the PFC.
  • Layer V pyramidal neurons are of interest with respect to schizophrenia and other forms of psychosis because D2 receptors in the PFC are selected.
  • layer V pyramidal neurons are output neurons of the neocortex and are responsible for signals including corollary discharge.
  • Various aspects of the present disclosure are used to verify connections between psychiatric disorders and specific neurons.
  • Neurons of interest are modified to express channelrhodopsin-2 (ChR2) in vivo.
  • ChR2 channelrhodopsin-2
  • the ChR2 in the modified neurons is stimulated.
  • ChR2 expression is localized to layer V pyramidial neurons in the PFC.
  • Modest optical stimulation for example, 470 nm, 0.4m W, 5msec at 10Hz
  • Increasing the frequency of stimulation for example, 470nm, 0.4m W, 2.5msec at 40Hz
  • Assessing such results leads to the conclusion that the cells expressing ChR2 contribute to psychotic like behaviors.
  • a finding such as this is used as a foundation for circuit level investigation of the cells expressing the opsin.
  • Certain aspects of the present disclosure are directed to combining opsin activation with pharmacological manipulations of target cells of interest.
  • the D2 agonist quinpirole elicits schizophrenia-like behaviors in animals.
  • Quinpirole can be delivered in vivo, or can be applied to slices from the area of interest. When using slices, network activity evoked by light is studied. As discussed in the Examples, including FIG. 2A, application of quinpirole changes the responses of a subset of layer V pyramidal neurons. The change in cell response includes some light flashes that no longer evoke spikes, new spikes unrelated to light flashes, and plateau potentials.
  • Periods of high-frequency spiking is followed by a prolonged depolarization that outlasts direct stimulation by tens or hundreds of milliseconds. In certain instances this prolonged depolarization elicits further spiking. In other instances the depolarization produces a plateau-like depolarization above the spike threshold.
  • the induction of abnormal response using a drug known to induce psychosis allows for the testing of the effectiveness of antipsychotic drugs, and well as confirmation of the mechanisms of known antipsychotics.
  • application of the antipsychotic drug haloperidol reverses the effect of the quinpirole on the target cells.
  • the specific D2 antagonist sulpiride also reverses the effects of quinpirole on the target cells when used in the right doses. See the Examples for more discussion of the effect of quinpirole, haloperidol and sulpiride on D2 receptors, spike rate and other characteristics of the target cell.
  • a subset of layer V pyramidal neurons was observed to display activity-dependent depolarization when quinpirole is present.
  • the subset of cells with this reaction can be identified by a prominent sag and rebound after depolarization in response to a hyperpolarizing current pulse when quinpirole is not present.
  • Layer V pyramidal neurons without the prominent sag and rebound do not exhibit activity-dependent depolarization in the presence of quinpirole.
  • the two subpopulations of pyramidal neurons do not differ in their input resistance or membrane time constancies. However cells that exhibit the activity-dependent depolarization tend to be slightly more depolarized at rest.
  • the subpopulation of layer V pyramidal neurons exhibiting the activity-dependent depolarization was substantially similar to the population activated by ChR2 that resulted in social and other behavioral abnormalities in Thyl ::ChR2 transgenic mice.
  • the activity-dependent depolarization can be elicited by current injection alone and did not require optogenetic stimulation.
  • the cells exhibiting the activity-dependent depolarization are morphologically distinct.
  • the subset of layer V pyramidal neurons possesses a single large apical dendrite that does not bifurcate until it reaches superficial layers 2/3.
  • the cells also have many projections within layer V.
  • cells without the activity-dependent depolarization have more heterogeneous morphologies, including apical dendrites that branch in layers 4 or 5. See the Examples for a more in-depth discussion of the differences between the subsets of layer 5 pyramidal neurons.
  • the electrophysiological patterns are studied on the single cell level.
  • Activity-dependent depolarization appears to elicit a range of notable cellular behaviors, including a marked depolarization that blocks further spiking, prolonged bistability, an increase in spiking elicited by current injection, and an afterdepolarization that outlasts the period of direct stimulations and can elicit additional spikes.
  • Bistability is typically associated with rhythmic activity in the beta/gamma band. In certain embodiments, bistability peaks in the power spectra between 20 and 40 Hz.
  • the net effect of quinpirole on neural excitability dependsed on the dose and duration of quinpirole application, as well as the input strength.
  • increased spiking can occur during early quinpirole application or in response to weak depolarizing input, which evolves into a prolonged depolarization or bistability after longer quinpirole application or in response to stronger depolarizing input.
  • the activity-dependent depolarization can be present in control conditions (before applying quinpirole). It was found that this phenomenon can be elicited in some circumstances by unusually-elevated levels of D2 receptor activation in a slice.
  • Certain aspects of the present disclosure are directed to whole-cell voltage clamping. This allows for the identification of ion channel currents effecting the activity-dependent depolarization.
  • voltage-dependent Ca 2+ currents contribute to the activity-dependent depolarization.
  • a Ca 2+ influx via L-type channels during an action potential activates Ca 2+ -dependent K + currents that play a major role in spike repolarization.
  • Strong D2 activation also enhances Ca 2+ influx via L-type channels.
  • strong D2 activation is expected to enhance the spike AHP, and selectively suppress spiking at short interspike intervals. D2 blockage is expected to
  • the effects of quinpirole on a target cell population are compared to the effects of another psychotomimemic, such as
  • PCP phencyclidine
  • PCP produces a similar range of effects via the activity-dependent depolarization as did quinpirole, including an afterdepolarization outlasting the period of direct stimulation, marked depolarization that blocked spiking, bistability, and persistent firing outlasting the period of direct stimulation.
  • the activity- dependent depolarization is limited to the subpopulation of layer V pyramidal neurons that exhibited a prominent sag and rebound afterdepolarization in response to hyperpolarizing current injection.
  • PCP was in some cases found to elicit wide action potentials that were blocked by nifedipine and may represent dendritic Ca 2+ spikes.
  • PCP like quinpirole
  • L-type Ca currents like those of quinpirole
  • PCP although not previously linked to this kind of pathway, appears to exert part of its psychotomimetic action by recruiting L-type Ca channels.
  • the L-type calcium channel antagonist nifedipine ameliorates social deficits induced by PCP in mice.
  • the nifedipine also reduces the incidence of catatonic-like behaviors elicited by PCP alone.
  • Appropriate doses of nifedpine reduces excessive levels of calcium channel activation, thereby preventing prolonged spiking or bistability, and restores normal prefrontal output and other behaviors mediated by the prefrontal cortex.
  • the activity-dependent depolarization represents a single cellular phenomenon that could support both perseverative and tangential behavior in prefrontal networks. Accordingly, the neurons, along with the induction of activity-dependent depolarization can be used as a disease model to study new potential treatments for diseases such as schizophrenia.
  • the present disclosure is believed to be useful for targeting of specific neural cell populations involved in various psychiatric disorders, and more specifically to psychosis and/or symptoms of psychosis.
  • Specific applications of the present invention facilitate assessing, treating and characterizing psychosis and/or symptoms of psychosis by targeting specific neural cell populations linked thereto. As many aspects of the example
  • Embodiments of the present disclosure are directed towards targeting cells that are a subset of the layer V pyramidal neurons.
  • the targeting of these cells can be particularly useful for generating, studying, treating or otherwise characterizing psychotic states.
  • FIG. 7 a model for the control and characterization of neural disorders is depicted, consistent with an embodiment of the present disclosure.
  • a cell type that has been identified as having involvement in a neural disorder of interest is chosen.
  • an opsin is selected (700) to infect the identified cell type.
  • an excitatory opsin such as ChR2 is chosen to infect the identified cell type. ChR2 is chosen when excitation of the identified cell type is desired.
  • the identified cell type can be modified to exhibit aberrant behavior using a second opsin, or by introducing a drug known to induce the aberrant behavior of the disease being modeled. The behavior can be exhibited on the macro level and can include the outwards signs of the disease being modeled.
  • the behavior monitored is on the cellular level and can include the response of the cell to a stimulus.
  • the identified cell type can be located, and stimulated (705), in vivo (730) or in vitro (725).
  • the identified cell type can be stimulated as a single cell (750) or as part of a slice from an animal (745), for example.
  • the identified cell type can be in a transgenic animal (735) or a human (740), for example.
  • the identified cell type is stimulated (705) and the response is observed (720).
  • the response of the identified cell type can be observed when the cell is in its "normal" state or when a diseased state has been induced, or both.
  • a drug of interest is chosen. The drug can be chosen based on the identified cell type, the disease being modeled, previous observations of other drugs, a combination of these factors, or other factors guiding the determination of possible drugs to treat a specific disease.
  • An initial dose of the drug is introduced to the identified cell (710), and the cell's response to stimulus in the presence of the drug is observed (715). The response is then compared to the response of the cell when the drug is not present (755).
  • the response of the cell in the presence of the drug of interest is compared to the response of the cell in the presence of a drug known to induce aberrant behavior.
  • the drug of interest can also be introduced to the identified cell type in addition to the drug known to induce aberrant behavior.
  • the dose of the drug of interest is modified and the identified cell type is stimulated again, based on the assessment.
  • the response to the modified dose can then be compared to the response in the absence of the drug of interest as well as the response to the previous dosage of the drug of interest.
  • the responses can also be compared to other drugs or treatments for the disease being modeled. This allows for the
  • an effective dosage and/or drug can be determined from a set of possible drugs.
  • an identified cell type is a subset of the layer V pyramidal neurons.
  • a drug such as PCP or quinpirole is introduced to the identified cell type to induce aberrant behavior consistent with a disease state to be modeled.
  • the indentified cell type is then stimulated using visible light that activates the opsin introduced into the cell, and the response to the stimulation is observed.
  • a second drug, the drug of interest is then introduced to the identified cell type.
  • the response to stimulus in the presence of the drug of interest is observed, and compared to the response of the cell in the diseased state. This comparison can be use to determine the efficacy of the drug of interest. It can also be used to determine whether modification should be made to the dose or to other aspects of the administration of the drug.
  • An aberrant behavior can occur on the cellular level when investigating a treatment in vitro.
  • the aberrant behavior can be at the cellular level and/or at the macro level, including observable behavior of the patient.
  • the aberrant behavior can be induced (800) by administration of a drug known to cause the aberrant behavior to be treated.
  • a proposed treatment is administered (810) either to the patient (in vivo) or to a cell (or cells) (in vitro).
  • the response of the cell or patient to stimulus in the presence of the treatment is observed (820).
  • the observations are then used to assess the efficacy of the treatment (830).
  • the treatment can be a drug, electrical stimulus, or a behavioral treatment, for example.
  • the response can be to a light stimulus, for example.
  • the light stimulus can excite or inhibit the cells based on a chosen light-responsive molecule introduced to a cell population of interest.
  • embodiments involving the disease modeling as discussed above may be implemented using a variety of different opsins and stimuli. Further, the modeling can occur in vivo or in vitro. In view of the description herein, those skilled in the art will recognize that many changes may be made thereto without departing from the spirit and scope of the present invention.
  • phencyclidine which produce schizophrenia-like behaviors in humans and animals but act via different receptors, converge upon a novel activity-dependent depolarization phenotype in a subset of layer V pyramidal neurons in the PFC.
  • this activity-dependent depolarization elicits bistability and disrupts the flow of information through these neurons, and that this disruptive bistability depends on a Ca 2+ channel subtype (the L-type channel) which has been implicated in schizophrenia.
  • endophenotype of these neurons is causally linked to negative symptom-type social behaviors; selectively depolarizing these neurons optogenetically creates a non-social phenotype, whereas blockade of the L-type channels corrects psychotomimetic-induced social dysfunction.
  • Example 1 Psychitic-like behaviors induced in mice by optical stimulation of infralimbic layer V pyramidal neurons expressing ChR2.
  • D2 receptors in the PFC are concentrated on layer V pyramidal neurons (3, 4), and D2 receptors play a critical role in schizophrenia and other forms of psychosis (5) as all known antipsychotics block the D2 receptor, whereas drags that increase dopamine levels (e.g. L-Dopa, stimulants), and dopamine receptor agonists can cause psychosis in normal individuals, or exacerbate symptoms in patients with schizophrenia. Indeed, binding to cortical D2 receptors may specifically explain the superior efficacy of certain
  • antipsychotics particularly for cognitive and negative symptoms of schizophrenia (6).
  • layer V pyramidal neurons are the key output neurons of the neocortex, responsible for signals including corollary discharge, which, when deficient, could contribute to failures of self-monitoring that produce psychotic symptoms such as auditory hallucinations (7).
  • ChR2 channelrhodopsin-2
  • Thy 1 : :ChRl 8 transgenic mice in which neocortical expression of ChR2 is chiefly localized to layer V pyramidal neurons (8).
  • Optical stimulation of infralimbic layer V pyramidal neurons expressing ChR2-EYFP in Thyl ::ChR2 transgenic mice was achieved by unilateral optical fiber placement above the infralimbic prefrontal cortex (FIG. 1 A-B).
  • Low frequency and high frequency gamma-band optical stimulation of layer V neurons was achieved with 473 nm blue light (10 Hz, 5-ms pulse width) and 473 nm blue light (40 Hz, 5-ms pulse width), respectively.
  • social exploration was measured in these mice and for assessment of positive-like symptoms, disorganized or catatonic behavior including stereotyped movements and rigidity were measured.
  • FIG. F-H Increasing the frequency of stimulation (470 nm, 0.4 mW, 2.5 msec @ 40 Hz) almost completely abolished social behavior and elicited a variety of catatonic like behaviors. Specifically, increasing the frequency of optical stimulation of layer V pyramidal neurons almost completely abolished social exploration of a novel juvenile in 6 of the 6 animals tested (p ⁇ 0.01; light on/ light off epochs interleaved) (FIG. F-G).
  • Example 2 A D2 agonist elicits an activity-dependent depolarization mediated by L-type Ca2+ channels in a subset of layer V pyramidal neurons that is reversible by D2 antagonist treatment.
  • schizophrenic-like behavior in Thyl : ChR2-EYFP transgenic mice We therefore proceeded to explore processes by which pharmacologic manipulations relevant to schizophrenia could affect these layer V pyramidal neurons in the PFC.
  • D2 receptors play a key role in schizophrenia, and the D2 agonist quinpirole elicits schizophrenia-like behaviors in animals (10, 11).
  • prefrontal slices from Thyl ::ChR2 mice were used to study network activity evoked by light in the presence or absence of quinpirole followed by treatment with known D2 antagonists (FIG. 2 and 3).
  • mice We used prefrontal slices from Thyl ::ChR2 mice to study network activity evoked by light.
  • Brain slices isolated from Thyl ::ChR2 transgenic mice underwent in vitro light stimulation and a layer V pyramidal neuron was monitored by electrophysiological recordings for cellular responses to trains of light flashes (470 nm, 1 msec) in the absence of a D2 agonist (control) or presence a D2 agonist (20 ⁇ quinpirole).
  • the brain slice was subsequently washed to remove the quinpirole and treated with either 0.2-2 ⁇ haloperidol or 5 ⁇ sulpiride, both of which are known D2 antagonists.
  • the spike rate of the layer V pyramidal neurons and the amount of information transmitted by the spike rate was quantified as well as the number of spikes as a function of interspike interval.
  • Layer V pyramidal neurons were subsequently treated to hyperpolarizing and/or depolarizing current pulses in the presence of 20 ⁇ quinpirole alone or in combination with a D2 antagonist, haloperidol (2 ⁇ ) or sulpiride (5 ⁇ ), or with an L-type Ca2+ channel antagonist, nifedipine (10 ⁇ ).
  • Electrophysiological recordings monitored the cellular responses of the layer V pyramidal neurons to in vitro light stimulation when under the pharmacological conditions or treatments.
  • D2 activation with quinpirole enhanced the spike afterhyperpolarization (AHP, arrows in FIG. 2F), consistent with rendering subthreshold subsequent input that would elicit a second spike in control conditions.
  • AHP spike afterhyperpolarization
  • D2 blockade with sulpiride widened action potentials, consistent with preventing spiking at short interspike intervals via a mechanism such as Na + channel inactivation.
  • hyperpolarizing current pulse exhibited the activity-dependent depolarization after the application of 20 ⁇ quinpirole (16/17 cells), whereas 0/9 layer V pyramidal neurons without these properties exhibited the activity-dependent depolarization after applying quinpirole.
  • These two subpopulations of pyramidal neurons did not differ in their input resistance or membrane time constants, although cells that exhibited the activity-dependent depolarization were slightly more depolarized at rest.
  • the subpopulation of layer V pyramidal neurons exhibiting the activity-dependent depolarization was substantially similar to the population activated by ChR2 that resulted in social and other behavioral abnormalities in Thyl ::ChR2 transgenic mice (FIG. 1).
  • the activity dependent depolarization could be elicited by current injection alone ("1" in FIG. 3A, middle panel, purple trace) and did not require optogenetic stimulation nor the sort of network activity shown in FIG. 2 to be manifested, as described below.
  • bistability was typically associated with rhythmic activity in the beta gamma band (FIG. 3F; 4/6 cells with bistability had peaks in their power spectra between 20 and 40 Hz).
  • PCP Phencyclidine
  • PCP produces a syndrome closely resembling schizophrenia in humans (14), and has long been used to model schizophrenia in animals,
  • social exploration was measured in mice treated with 4-15 mg/kg nifedipine alone or in combination with 5 mg/kg PCP.
  • PCP produced a similar range of effects via the activity-dependent depolarization as did quinpirole, including an afterdepolarization outlasting the period of direct stimulation, marked depolarization that blocked spiking, bistability, and persistent firing outlasting the period of direct stimulation (FIG. 4B).
  • the activity-dependent depolarization was again limited to the subpopulation of layer V
  • PCP (like quinpirole) suppressed spiking at short interspike intervals, suggesting that the effects of PCP on L-type Ca 2+ currents (like those of quinpirole) enhance the recruitment of Ca 2+ -dependent K + currents during action potentials. If the structurally- and functionally-distinct psychotomimetics quinpirole and PCP do indeed converge upon a common causally-important Ca 2+ -channel-dependent aberrant neural state, a prediction emerges that PCP (not previously linked to this kind of pathway) could exert part of its psychotomimetic action by recruiting L-type Ca channels.
  • nifedipine alone will reduce Ca 2+ channel activation to levels that impair spike repolarization and repetitive spiking (thereby impairing prefrontal mediated-behaviors), but in combination with PCP, appropriate doses of nifedipine will reduce the excessive levels of calcium channel activation (preventing prolonged spiking or bistability), thereby restoring normal prefrontal output and rescuing behaviors mediated by prefrontal cortex.
  • layer V neurons are well poised to affect the cognitive domains disrupted in schizophrenia. As shown by the effects of quinpirole, these neurons express D2 receptors, and prefrontal D2 receptors are involved in working memory and set-shifting tasks (9, 17); moreover, in the PFC, D2 receptors are located primarily on layer V pyramidal neurons (4), which send outputs from the PFC to other brain regions. Thus, via the effects shown in FIG. 1 A-D, L-type Ca channels in these layer V neurons could profoundly alter the information flowing out of the PFC to brain regions such as the striatum (18).
  • the activity-dependent depolarization represents a single cellular phenomenon that could support both perseverative and tangential behavior in prefrontal networks. If D2 activation affects a subset of prefrontal neurons mediating output signals that trigger motor responses or corollary discharges (7, 9, 18, 27) via activity- dependent depolarization that enhances spiking in these neurons, the resulting aberrant or prolonged spiking (FIG. 2A,B; FIG. 3C,E) may give rise to promiscuous or inappropriate output signals corresponding to tangential behavior in processes mediated by cortical networks. Extremely high levels of D2 activation may in turn produce bistability (FIG. 3A) or depolarization blockade of spiking (FIG.
  • L-type Ca 2+ channels have been implicated in schizophrenia by genome-wide association studies (29), although until now, there has been no clear hypothesis for their role. In fact, with few exceptions (30), it has been very difficult to link ion channels in specific neurons with symptoms of psychiatric disease. Genetic studies have also implicated L-type Ca channels in bipolar disorder (31), which includes tangentiality and cognitive deficits similar to those seen in schizophrenia (32), and we have recently found that a mouse line designed to generate elevated L-type Ca 2+ channel activity (33, 34) by prolonging L-type currents (35) elicited similar cellular dysfunction in layer V neurons (FIG. 4D).
  • the amino acid sequence of CI VI (E122T): SRRPWLLALALAVALAAGSAGASTGSDATVPVATQDGPDYVFHRAHERMLFQTSYTLENNGSVICIPNNGQCF CLAWLKSNGTNAEKLAANILQWITFALSALCLMFYGYQTWKSTCGWETIYVATIEMIKFIIEYFHEFDEPAVIY SSNGNKTVWLRYAEWLLTCPVLLIHLSNLTGLKDDYSKRTMGLLVSDVGCIVWGATSAMCTGWTKILFFLISLS YGMYTYFHAAKVYIEAFHTVPKGICRELVRVMAWTFFVAWGMFPVLFLLGTEGFGHISPYGSAIGHSILDLIAK NMWGVLGNYLRVKIHEHILLYGDIR KQKITIAGQEMEVETLVAEEED (SEQ ID NO: 5)
  • the amino acid sequence of CI VI (E162T):

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Biotechnology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Molecular Biology (AREA)
  • Environmental Sciences (AREA)
  • Public Health (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • Genetics & Genomics (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Urology & Nephrology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Hematology (AREA)
  • Pathology (AREA)
  • Neurology (AREA)
  • Animal Husbandry (AREA)
  • Biodiversity & Conservation Biology (AREA)
  • Microbiology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Neurosurgery (AREA)
  • General Physics & Mathematics (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Organic Chemistry (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Psychiatry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hospice & Palliative Care (AREA)
PCT/US2011/059383 2010-11-05 2011-11-04 Control and characterization of psychotic states Ceased WO2012061741A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
EP11838895.8A EP2635110B1 (en) 2010-11-05 2011-11-04 Control and characterization of psychotic states
JP2013537878A JP5986575B2 (ja) 2010-11-05 2011-11-04 精神病状態の制御および特徴付け
ES11838895.8T ES2682962T3 (es) 2010-11-05 2011-11-04 Control y caracterización de estados psicóticos
CA2816987A CA2816987C (en) 2010-11-05 2011-11-04 Control and characterization of psychotic states
US13/882,566 US20140082758A1 (en) 2010-11-05 2011-11-04 Control and Characterization of Psychotic States
AU2011323197A AU2011323197B2 (en) 2010-11-05 2011-11-04 Control and characterization of psychotic states
CN201180060052.2A CN103339505B (zh) 2010-11-05 2011-11-04 精神病状态的控制和表征
US15/214,402 US20160316732A1 (en) 2010-11-05 2016-07-19 Control and characterization of psychotic states
US17/002,330 US20210059230A1 (en) 2010-11-05 2020-08-25 Control and Characterization of Psychotic States

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US41072010P 2010-11-05 2010-11-05
US41072510P 2010-11-05 2010-11-05
US61/410,720 2010-11-05
US61/410,725 2010-11-05

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US13/882,566 A-371-Of-International US20140082758A1 (en) 2010-11-05 2011-11-04 Control and Characterization of Psychotic States
US15/214,402 Division US20160316732A1 (en) 2010-11-05 2016-07-19 Control and characterization of psychotic states
US17/002,330 Continuation US20210059230A1 (en) 2010-11-05 2020-08-25 Control and Characterization of Psychotic States

Publications (2)

Publication Number Publication Date
WO2012061741A2 true WO2012061741A2 (en) 2012-05-10
WO2012061741A3 WO2012061741A3 (en) 2013-08-08

Family

ID=46025139

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/059383 Ceased WO2012061741A2 (en) 2010-11-05 2011-11-04 Control and characterization of psychotic states

Country Status (8)

Country Link
US (3) US20140082758A1 (enExample)
EP (1) EP2635110B1 (enExample)
JP (2) JP5986575B2 (enExample)
CN (2) CN106267236A (enExample)
AU (3) AU2011323197B2 (enExample)
CA (1) CA2816987C (enExample)
ES (1) ES2682962T3 (enExample)
WO (1) WO2012061741A2 (enExample)

Cited By (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140082758A1 (en) * 2010-11-05 2014-03-20 The Board Of Trustees Of The Leland Stanford Junior University Control and Characterization of Psychotic States
EP2635111A4 (en) * 2010-11-05 2014-10-15 Univ Leland Stanford Junior STABILIZED OPSIN PROTEINS WITH STAGE FUNCTION AND METHOD OF USE THEREOF
US8962589B2 (en) 2008-05-29 2015-02-24 The Board Of Trustees Of The Leland Stanford Junior University Cell line, system and method for optical control of secondary messengers
US9079940B2 (en) 2010-03-17 2015-07-14 The Board Of Trustees Of The Leland Stanford Junior University Light-sensitive ion-passing molecules
US9084885B2 (en) 2008-06-17 2015-07-21 The Board Of Trustees Of The Leland Stanford Junior University Methods, systems and devices for optical stimulation of target cells using an optical transmission element
US9101690B2 (en) 2005-07-22 2015-08-11 The Board Of Trustees Of The Leland Stanford Junior University Light-activated cation channel and uses thereof
US9101759B2 (en) 2008-07-08 2015-08-11 The Board Of Trustees Of The Leland Stanford Junior University Materials and approaches for optical stimulation of the peripheral nervous system
US9175095B2 (en) 2010-11-05 2015-11-03 The Board Of Trustees Of The Leland Stanford Junior University Light-activated chimeric opsins and methods of using the same
US9187745B2 (en) 2007-01-10 2015-11-17 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US9238150B2 (en) 2005-07-22 2016-01-19 The Board Of Trustees Of The Leland Stanford Junior University Optical tissue interface method and apparatus for stimulating cells
US9284353B2 (en) 2007-03-01 2016-03-15 The Board Of Trustees Of The Leland Stanford Junior University Mammalian codon optimized nucleotide sequence that encodes a variant opsin polypeptide derived from Natromonas pharaonis (NpHR)
US9309296B2 (en) 2008-11-14 2016-04-12 The Board Of Trustees Of The Leland Stanford Junior University Optically-based stimulation of target cells and modifications thereto
US9365628B2 (en) 2011-12-16 2016-06-14 The Board Of Trustees Of The Leland Stanford Junior University Opsin polypeptides and methods of use thereof
US9421258B2 (en) 2010-11-05 2016-08-23 The Board Of Trustees Of The Leland Stanford Junior University Optically controlled CNS dysfunction
US9522288B2 (en) 2010-11-05 2016-12-20 The Board Of Trustees Of The Leland Stanford Junior University Upconversion of light for use in optogenetic methods
US9615789B2 (en) 2010-11-22 2017-04-11 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic magnetic resonance imaging
US9636380B2 (en) 2013-03-15 2017-05-02 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic control of inputs to the ventral tegmental area
US9693692B2 (en) 2007-02-14 2017-07-04 The Board Of Trustees Of The Leland Stanford Junior University System, method and applications involving identification of biological circuits such as neurological characteristics
US9878176B2 (en) 2008-04-23 2018-01-30 The Board Of Trustees Of The Leland Stanford Junior University System utilizing Volvox carteri light-activated ion channel protein (VChR1) for optical stimulation of target cells
US9992981B2 (en) 2010-11-05 2018-06-12 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic control of reward-related behaviors
US10035027B2 (en) 2007-10-31 2018-07-31 The Board Of Trustees Of The Leland Stanford Junior University Device and method for ultrasonic neuromodulation via stereotactic frame based technique
US10052497B2 (en) 2005-07-22 2018-08-21 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US10086012B2 (en) 2010-11-05 2018-10-02 The Board Of Trustees Of The Leland Stanford Junior University Control and characterization of memory function
US10220092B2 (en) 2013-04-29 2019-03-05 The Board Of Trustees Of The Leland Stanford Junior University Devices, systems and methods for optogenetic modulation of action potentials in target cells
US10307609B2 (en) 2013-08-14 2019-06-04 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods for controlling pain
US10426970B2 (en) 2007-10-31 2019-10-01 The Board Of Trustees Of The Leland Stanford Junior University Implantable optical stimulators
US10451608B2 (en) 2005-07-22 2019-10-22 The Board Of Trustees Of The Leland Stanford Junior University Cell line, system and method for optical-based screening of ion-channel modulators
US10568516B2 (en) 2015-06-22 2020-02-25 The Board Of Trustees Of The Leland Stanford Junior University Methods and devices for imaging and/or optogenetic control of light-responsive neurons
US10569099B2 (en) 2005-07-22 2020-02-25 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US10711242B2 (en) 2008-06-17 2020-07-14 The Board Of Trustees Of The Leland Stanford Junior University Apparatus and methods for controlling cellular development
US10974064B2 (en) 2013-03-15 2021-04-13 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic control of behavioral state
US11103723B2 (en) 2012-02-21 2021-08-31 The Board Of Trustees Of The Leland Stanford Junior University Methods for treating neurogenic disorders of the pelvic floor
US11294165B2 (en) 2017-03-30 2022-04-05 The Board Of Trustees Of The Leland Stanford Junior University Modular, electro-optical device for increasing the imaging field of view using time-sequential capture
WO2025041032A1 (en) * 2023-08-22 2025-02-27 Friedrich Miescher Institute For Biomedical Research Promoter for the specific expression of genes in layer 5 cells in mouse cortex
WO2025041033A1 (en) * 2023-08-22 2025-02-27 Friedrich Miescher Institute For Biomedical Research Promoter for the specific expression of genes in layer 5 pyramidal tract cells in mouse cortex
WO2025041034A1 (en) * 2023-08-22 2025-02-27 Friedrich Miescher Institute For Biomedical Research Promoter for the specific expression of genes in layer 5 cells in mouse cortex

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3122761B1 (en) 2014-03-28 2019-03-06 The Board of Trustees of The Leland Stanford Junior University Engineered light-activated anion channel proteins and methods of use thereof
US9279797B2 (en) 2014-06-12 2016-03-08 Axion Biosystems, Inc. Multiwell microelectrode array with optical stimulation

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080060088A1 (en) 2006-09-01 2008-03-06 Heesup Shin Phospholipase c beta1 (plcbeta1) knockout mice as a model system for testing schizophrenia drugs
US20090088680A1 (en) 2005-07-22 2009-04-02 Alexander Aravanis Optical tissue interface method and apparatus for stimulating cells
WO2010056970A2 (en) 2008-11-14 2010-05-20 The Board Of Trustees Of The Leland Stanford Junior University Optically-based stimulation of target cells and modifications thereto
WO2012061744A2 (en) 2010-11-05 2012-05-10 The Board Of Trustees Of The Leland Stanford Junior University Stabilized step function opsin proteins and methods of using the same

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2001263199B2 (en) * 2000-05-17 2004-09-16 Asterias Biotherapeutics, Inc. Neural progenitor cell populations
EP1573314B1 (en) * 2002-12-16 2008-07-23 Genentech, Inc. Transgenic mice expressing human cd20
WO2011005978A2 (en) * 2009-07-08 2011-01-13 Duke University Methods of manipulating cell signaling
EP3486253A1 (en) * 2010-11-05 2019-05-22 The Board of Trustees of The Leland Stanford Junior University Light-activated chimeric opsins and methods of using the same
CA2816987C (en) * 2010-11-05 2018-09-18 The Board Of Trustees Of The Leland Stanford Junior University Control and characterization of psychotic states

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090088680A1 (en) 2005-07-22 2009-04-02 Alexander Aravanis Optical tissue interface method and apparatus for stimulating cells
US20080060088A1 (en) 2006-09-01 2008-03-06 Heesup Shin Phospholipase c beta1 (plcbeta1) knockout mice as a model system for testing schizophrenia drugs
WO2010056970A2 (en) 2008-11-14 2010-05-20 The Board Of Trustees Of The Leland Stanford Junior University Optically-based stimulation of target cells and modifications thereto
WO2012061744A2 (en) 2010-11-05 2012-05-10 The Board Of Trustees Of The Leland Stanford Junior University Stabilized step function opsin proteins and methods of using the same

Non-Patent Citations (15)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 1987
"Current Protocols in Nucleic Acid Chemistry", 2000, JOHN WILEY & SONS, INC.
"Gene Transfer Vectors for Mammalian Cells", 1987
"Handbook of Experimental Immunology", 1987, BLACKWELL SCIENCE INC.
"PCR: The Polymerase Chain Reaction", 1994
ARENKIEL ET AL., NEURON, vol. 54, 19 April 2007 (2007-04-19), pages 205
ARENKIEL ET AL., NEURON, vol. 54, 19 April 2007 (2007-04-19), pages 205 - 218
HARLOW; LANE: "Antibodies, A Laboratory Manual", 1988, COLD SPRING HARBOR PUBLICATIONS
HARLOW; LANE: "Using Antibodies: A Laboratory Manual", 1999, COLD SPRING HARBOR LABORATORY PRESS
MIELLA ET AL., PSYCHOPHANNACOLOGY, vol. 211, 2010, pages 355 - 366
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989
SAMBROOK; RUSSEL: "Molecular Cloning: A Laboratory Manual", 2001
See also references of EP2635110A4
WANG ET AL., PROC NATL ACAD SCI USA, vol. 104, 2007, pages 8143 - 8148
YIZHAR ET AL., NATURE, vol. 477, 2011, pages 171 - 178

Cited By (74)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10052497B2 (en) 2005-07-22 2018-08-21 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US9278159B2 (en) 2005-07-22 2016-03-08 The Board Of Trustees Of The Leland Stanford Junior University Light-activated cation channel and uses thereof
US10627410B2 (en) 2005-07-22 2020-04-21 The Board Of Trustees Of The Leland Stanford Junior University Light-activated cation channel and uses thereof
US9829492B2 (en) 2005-07-22 2017-11-28 The Board Of Trustees Of The Leland Stanford Junior University Implantable prosthetic device comprising a cell expressing a channelrhodopsin
US10569099B2 (en) 2005-07-22 2020-02-25 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US9101690B2 (en) 2005-07-22 2015-08-11 The Board Of Trustees Of The Leland Stanford Junior University Light-activated cation channel and uses thereof
US10451608B2 (en) 2005-07-22 2019-10-22 The Board Of Trustees Of The Leland Stanford Junior University Cell line, system and method for optical-based screening of ion-channel modulators
US10422803B2 (en) 2005-07-22 2019-09-24 The Board Of Trustees Of The Leland Stanford Junior University Light-activated cation channel and uses thereof
US10036758B2 (en) 2005-07-22 2018-07-31 The Board Of Trustees Of The Leland Stanford Junior University Delivery of a light-activated cation channel into the brain of a subject
US9238150B2 (en) 2005-07-22 2016-01-19 The Board Of Trustees Of The Leland Stanford Junior University Optical tissue interface method and apparatus for stimulating cells
US10046174B2 (en) 2005-07-22 2018-08-14 The Board Of Trustees Of The Leland Stanford Junior University System for electrically stimulating target neuronal cells of a living animal in vivo
US10094840B2 (en) 2005-07-22 2018-10-09 The Board Of Trustees Of The Leland Stanford Junior University Light-activated cation channel and uses thereof
US10369378B2 (en) 2007-01-10 2019-08-06 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US10105551B2 (en) 2007-01-10 2018-10-23 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US11007374B2 (en) 2007-01-10 2021-05-18 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US9187745B2 (en) 2007-01-10 2015-11-17 The Board Of Trustees Of The Leland Stanford Junior University System for optical stimulation of target cells
US9693692B2 (en) 2007-02-14 2017-07-04 The Board Of Trustees Of The Leland Stanford Junior University System, method and applications involving identification of biological circuits such as neurological characteristics
US9284353B2 (en) 2007-03-01 2016-03-15 The Board Of Trustees Of The Leland Stanford Junior University Mammalian codon optimized nucleotide sequence that encodes a variant opsin polypeptide derived from Natromonas pharaonis (NpHR)
US9855442B2 (en) 2007-03-01 2018-01-02 The Board Of Trustees Of The Leland Stanford Junior University Method for optically controlling a neuron with a mammalian codon optimized nucleotide sequence that encodes a variant opsin polypeptide derived from natromonas pharaonis (NpHR)
US10589123B2 (en) 2007-03-01 2020-03-17 The Board Of Trustees Of The Leland Stanford Junior University Systems, methods and compositions for optical stimulation of target cells
US9757587B2 (en) 2007-03-01 2017-09-12 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic method for generating an inhibitory current in a mammalian neuron
US10426970B2 (en) 2007-10-31 2019-10-01 The Board Of Trustees Of The Leland Stanford Junior University Implantable optical stimulators
US10434327B2 (en) 2007-10-31 2019-10-08 The Board Of Trustees Of The Leland Stanford Junior University Implantable optical stimulators
US10035027B2 (en) 2007-10-31 2018-07-31 The Board Of Trustees Of The Leland Stanford Junior University Device and method for ultrasonic neuromodulation via stereotactic frame based technique
US10350430B2 (en) 2008-04-23 2019-07-16 The Board Of Trustees Of The Leland Stanford Junior University System comprising a nucleotide sequence encoding a volvox carteri light-activated ion channel protein (VCHR1)
US9878176B2 (en) 2008-04-23 2018-01-30 The Board Of Trustees Of The Leland Stanford Junior University System utilizing Volvox carteri light-activated ion channel protein (VChR1) for optical stimulation of target cells
US8962589B2 (en) 2008-05-29 2015-02-24 The Board Of Trustees Of The Leland Stanford Junior University Cell line, system and method for optical control of secondary messengers
US9084885B2 (en) 2008-06-17 2015-07-21 The Board Of Trustees Of The Leland Stanford Junior University Methods, systems and devices for optical stimulation of target cells using an optical transmission element
US10711242B2 (en) 2008-06-17 2020-07-14 The Board Of Trustees Of The Leland Stanford Junior University Apparatus and methods for controlling cellular development
US9101759B2 (en) 2008-07-08 2015-08-11 The Board Of Trustees Of The Leland Stanford Junior University Materials and approaches for optical stimulation of the peripheral nervous system
US10583309B2 (en) 2008-07-08 2020-03-10 The Board Of Trustees Of The Leland Stanford Junior University Materials and approaches for optical stimulation of the peripheral nervous system
US9308392B2 (en) 2008-07-08 2016-04-12 The Board Of Trustees Of The Leland Stanford Junior University Materials and approaches for optical stimulation of the peripheral nervous system
US10064912B2 (en) 2008-11-14 2018-09-04 The Board Of Trustees Of The Leland Stanford Junior University Optically-based stimulation of target cells and modifications thereto
US9309296B2 (en) 2008-11-14 2016-04-12 The Board Of Trustees Of The Leland Stanford Junior University Optically-based stimulation of target cells and modifications thereto
US9458208B2 (en) 2008-11-14 2016-10-04 The Board Of Trustees Of The Leland Stanford Junior University Optically-based stimulation of target cells and modifications thereto
US10071132B2 (en) 2008-11-14 2018-09-11 The Board Of Trustees Of The Leland Stanford Junior University Optically-based stimulation of target cells and modifications thereto
US9079940B2 (en) 2010-03-17 2015-07-14 The Board Of Trustees Of The Leland Stanford Junior University Light-sensitive ion-passing molecules
US9604073B2 (en) 2010-03-17 2017-03-28 The Board Of Trustees Of The Leland Stanford Junior University Light-sensitive ion-passing molecules
US9249234B2 (en) 2010-03-17 2016-02-02 The Board Of Trustees Of The Leland Stanford Junior University Light-sensitive ion-passing molecules
US9359449B2 (en) 2010-03-17 2016-06-07 The Board Of Trustees Of The Leland Stanford Junior University Light-sensitive ion-passing molecules
EP3486253A1 (en) * 2010-11-05 2019-05-22 The Board of Trustees of The Leland Stanford Junior University Light-activated chimeric opsins and methods of using the same
US20140082758A1 (en) * 2010-11-05 2014-03-20 The Board Of Trustees Of The Leland Stanford Junior University Control and Characterization of Psychotic States
EP2635111A4 (en) * 2010-11-05 2014-10-15 Univ Leland Stanford Junior STABILIZED OPSIN PROTEINS WITH STAGE FUNCTION AND METHOD OF USE THEREOF
US10086012B2 (en) 2010-11-05 2018-10-02 The Board Of Trustees Of The Leland Stanford Junior University Control and characterization of memory function
US9522288B2 (en) 2010-11-05 2016-12-20 The Board Of Trustees Of The Leland Stanford Junior University Upconversion of light for use in optogenetic methods
US9850290B2 (en) 2010-11-05 2017-12-26 The Board Of Trustees Of The Leland Stanford Junior University Light-activated chimeric opsins and methods of using the same
US10196431B2 (en) 2010-11-05 2019-02-05 The Board Of Trustees Of The Leland Stanford Junior University Light-activated chimeric opsins and methods of using the same
US9421258B2 (en) 2010-11-05 2016-08-23 The Board Of Trustees Of The Leland Stanford Junior University Optically controlled CNS dysfunction
US10252076B2 (en) 2010-11-05 2019-04-09 The Board Of Trustees Of The Leland Stanford Junior University Upconversion of light for use in optogenetic methods
US9340589B2 (en) 2010-11-05 2016-05-17 The Board Of Trustees Of The Leland Stanford Junior University Light-activated chimeric opsins and methods of using the same
US10568307B2 (en) 2010-11-05 2020-02-25 The Board Of Trustees Of The Leland Stanford Junior University Stabilized step function opsin proteins and methods of using the same
US9992981B2 (en) 2010-11-05 2018-06-12 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic control of reward-related behaviors
US9968652B2 (en) 2010-11-05 2018-05-15 The Board Of Trustees Of The Leland Stanford Junior University Optically-controlled CNS dysfunction
EP2635110B1 (en) * 2010-11-05 2018-05-09 The Board of Trustees of the Leland Stanford Junior University Control and characterization of psychotic states
US9175095B2 (en) 2010-11-05 2015-11-03 The Board Of Trustees Of The Leland Stanford Junior University Light-activated chimeric opsins and methods of using the same
US9615789B2 (en) 2010-11-22 2017-04-11 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic magnetic resonance imaging
US10018695B2 (en) 2010-11-22 2018-07-10 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic magnetic resonance imaging
US10371776B2 (en) 2010-11-22 2019-08-06 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic magnetic resonance imaging
US10914803B2 (en) 2010-11-22 2021-02-09 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic magnetic resonance imaging
US10087223B2 (en) 2011-12-16 2018-10-02 The Board Of Trustees Of The Leland Stanford Junior University Opsin polypeptides and methods of use thereof
US10538560B2 (en) 2011-12-16 2020-01-21 The Board Of Trustees Of The Leland Stanford Junior University Opsin polypeptides and methods of use thereof
US9969783B2 (en) 2011-12-16 2018-05-15 The Board Of Trustees Of The Leland Stanford Junior University Opsin polypeptides and methods of use thereof
US9365628B2 (en) 2011-12-16 2016-06-14 The Board Of Trustees Of The Leland Stanford Junior University Opsin polypeptides and methods of use thereof
US9840541B2 (en) 2011-12-16 2017-12-12 The Board Of Trustees Of The Leland Stanford Junior University Opsin polypeptides and methods of use thereof
US11103723B2 (en) 2012-02-21 2021-08-31 The Board Of Trustees Of The Leland Stanford Junior University Methods for treating neurogenic disorders of the pelvic floor
US9636380B2 (en) 2013-03-15 2017-05-02 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic control of inputs to the ventral tegmental area
US10974064B2 (en) 2013-03-15 2021-04-13 The Board Of Trustees Of The Leland Stanford Junior University Optogenetic control of behavioral state
US10220092B2 (en) 2013-04-29 2019-03-05 The Board Of Trustees Of The Leland Stanford Junior University Devices, systems and methods for optogenetic modulation of action potentials in target cells
US10307609B2 (en) 2013-08-14 2019-06-04 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods for controlling pain
US10568516B2 (en) 2015-06-22 2020-02-25 The Board Of Trustees Of The Leland Stanford Junior University Methods and devices for imaging and/or optogenetic control of light-responsive neurons
US11294165B2 (en) 2017-03-30 2022-04-05 The Board Of Trustees Of The Leland Stanford Junior University Modular, electro-optical device for increasing the imaging field of view using time-sequential capture
WO2025041032A1 (en) * 2023-08-22 2025-02-27 Friedrich Miescher Institute For Biomedical Research Promoter for the specific expression of genes in layer 5 cells in mouse cortex
WO2025041033A1 (en) * 2023-08-22 2025-02-27 Friedrich Miescher Institute For Biomedical Research Promoter for the specific expression of genes in layer 5 pyramidal tract cells in mouse cortex
WO2025041034A1 (en) * 2023-08-22 2025-02-27 Friedrich Miescher Institute For Biomedical Research Promoter for the specific expression of genes in layer 5 cells in mouse cortex

Also Published As

Publication number Publication date
US20210059230A1 (en) 2021-03-04
JP2013544091A (ja) 2013-12-12
US20160316732A1 (en) 2016-11-03
CA2816987C (en) 2018-09-18
CN106267236A (zh) 2017-01-04
AU2011323197A1 (en) 2013-05-09
WO2012061741A3 (en) 2013-08-08
US20140082758A1 (en) 2014-03-20
CN103339505A (zh) 2013-10-02
ES2682962T3 (es) 2018-09-24
EP2635110A2 (en) 2013-09-11
AU2016200948A1 (en) 2016-03-03
CN103339505B (zh) 2016-08-24
CA2816987A1 (en) 2012-05-10
AU2011323197B2 (en) 2015-11-19
JP5986575B2 (ja) 2016-09-06
JP2017029148A (ja) 2017-02-09
EP2635110B1 (en) 2018-05-09
EP2635110A4 (en) 2014-02-26
AU2018208657A1 (en) 2018-08-09

Similar Documents

Publication Publication Date Title
US20210059230A1 (en) Control and Characterization of Psychotic States
US10711044B2 (en) Channelrhodopsins for optical control of cells
US9636380B2 (en) Optogenetic control of inputs to the ventral tegmental area
US10307609B2 (en) Compositions and methods for controlling pain
CN103491770B (zh) 稳定阶跃函数视蛋白及其使用方法
AU2013235517B2 (en) Non-human animal models of depression and methods of use thereof
US9992981B2 (en) Optogenetic control of reward-related behaviors
JP2016522794A (ja) 行動状態の光遺伝学的制御方法
WO2022035765A1 (en) Molecular targets for modulation of dissociative and associative states
Mantoan Neuronal Signalling Studied with Light-activated Ion Channels to Target Interneurons, Entrain Hippocampal Gamma Oscillations and Suppress Epileptiform Activity

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11838895

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2013537878

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2816987

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2011323197

Country of ref document: AU

Date of ref document: 20111104

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011838895

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13882566

Country of ref document: US