WO2012018907A2 - Polypeptides for treating and/or limiting influenza infection - Google Patents
Polypeptides for treating and/or limiting influenza infection Download PDFInfo
- Publication number
- WO2012018907A2 WO2012018907A2 PCT/US2011/046414 US2011046414W WO2012018907A2 WO 2012018907 A2 WO2012018907 A2 WO 2012018907A2 US 2011046414 W US2011046414 W US 2011046414W WO 2012018907 A2 WO2012018907 A2 WO 2012018907A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- group
- phe
- polypeptide
- binding
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K7/00—Peptides having 5 to 20 amino acids in a fully defined sequence; Derivatives thereof
- C07K7/04—Linear peptides containing only normal peptide links
- C07K7/08—Linear peptides containing only normal peptide links having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/04—Peptides having up to 20 amino acids in a fully defined sequence; Derivatives thereof
- A61K38/10—Peptides having 12 to 20 amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/11—Orthomyxoviridae, e.g. influenza virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
Definitions
- Influenza virus is a member of Orthomyxoviridae family. There are three subtypes of influenza viruses designated A, B, and C.
- the influenza virion contains a segmented negative- sense RNA genome, encoding, among other proteins, hemagglutinin (HA) and neuraminidase (NA).
- Influenza virus infection is initiated by the attachment of the virion surface HA protein to a sialic acid-containing cellular receptor (glycoproteins and glycolipids).
- the NA protein mediates processing of the sialic acid receptor, and virus penetration into the cell depends on HA-dependent receptor-mediated endocytosis.
- HA2 protein undergoes conformational changes that lead to fusion of viral and cell membranes and virus uncoating and M2 -mediated release of Ml proteins from nucleocapsid-associated ribonucleoproteins (RNPs), which migrate into the cell nucleus for viral RNA synthesis.
- RNPs nucleocapsid-associated ribonucleoproteins
- Antibodies to HA proteins prevent virus infection by neutralizing virus infectivity.
- Influenza presents a serious public-health challenge and new therapies are needed to combat viruses that are resistant to existing antivirals or escape neutralization by the immune system.
- the present invention provides polypeptides comprising an amino acid sequence according to general formula I
- Rl is selected from the group consisting of Ser, Ala, Phe, His, Lys, Met, Asn, Gin, Thr, Val, Tyr, and Asp;
- R2 can be any amino acid
- R3 is selected from the group consisting of Asp, Ala, Glu, Gly, Asn, Pro, Ser, and Tyr;
- R4 is selected from the group consisting of Leu and Phe;
- R5 can be any amino acid
- R6 is selected from the group consisting of Met, Phe, His, He, Leu, Gin, and Thr;
- R7 is selected from the group consisting of Arg, Gly, Lys, Gin, and Thr;
- R8 is selected from the group consisting of He, Asn, Gin, Val, and Trp;
- R9 is selected from the group consisting of Met, Gly, He, Lys, Leu, Asn, Arg, Ser, Thr,
- RIO is selected from the group consisting of Trp and Phe;
- Rl 1 is selected from the group consisting of He, Phe, Ser, Thr, and Val;
- R12 is selected from the group consisting of Tyr, Cys, Asp, Phe, His, Asn, and Ser;
- R13 is selected from the group consisting of Val, Ala, Phe, He, Leu, Asn, Gin, Thr, and
- R14 is selected from the group consisting of Phe, Glu, and Leu;
- R15 is selected from the group consisting of Ala, Gly, Lys, Arg, and Ser;
- R16 is selected from the group consisting of Phe, Cys, His, Lys, Leu, Met, Asn, Gin, Arg,
- polypeptide comprises or consists of
- XI is 4-8 amino acids in length, wherein each position can be any amino acid; and R17 is Phe or Tyr.
- the present invention provides polypeptides comprising an amino acid sequence according to general formula II
- Rl is selected from the group consisting of Phe and Val
- R2 is selected from the group consisting of Ser, Ala, Phe, Gly, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Thr, and Val;
- R3 is selected from the group consisting of Glu, and Asp;
- R4 is selected from the group consisting of Asn, His, He, Lys, Leu, Met, Arg, Ser, and Thr;
- R5 is selected from the group consisting of Leu, Phe, He, Met, Asn, Gin, and Val;
- R6 is selected from the group consisting of Ala, Asp, Lys, Met, Asn, Gin, Arg, Glu, and
- R7 is selected from the group consisting of Phe, Asp, Asn, and Tyr;
- R8 is selected from the group consisting of Glu, Ala, Asp, Gly, His, Lys, Leu, Met, Asn,
- R9 is selected from the group consisting of Leu, Phe, He, Met, and Val;
- RIO is selected from the group consisting of Leu, He, Met, and Tyr;
- Rl 1 is selected from the group consisting of Ser, Ala, Gly, and Tyr;
- polypeptides of general formula II comprise or consist of
- XI is 5-15 amino acids in length, wherein each position can be any amino acid
- R12 is selected from the group consisting of Gin, Tyr, Phe, Met, Arg, Lys, and Gly;
- R13 is selected from the group consisting of Tyr, Asp, Met, Asn, and Ser;
- X2 is any amino acid
- R14 is selected from the group consisting of Ser, Arg, and Lys.
- the present invention provides polypeptides comprising an amino acid sequence selected from the group consisting of
- the present invention provides isolated nucleic acids encoding the polypeptide of any embodiment of the invention.
- the present invention provides recombinant expression vectors comprising the nucleic acid of the third aspect of the invention, operatively linked to a suitable control sequence.
- the present invention provides recombinant host cells comprising the recombinant expression vectors of the fourth aspect of the invention.
- the present invention provides antibodies that selectively bind to the polypeptides of the invention.
- the present invention provides pharmaceutical compositions, comprising one or more polypeptides according of the invention and a pharmaceutically acceptable carrier.
- the present invention provides methods for treating and/or limiting an influenza infection, comprising administering to a subject in need thereof a therapeutically effective amount of one or more polypeptides of the invention, salts thereof, conjugates thereof, or pharmaceutical compositions thereof, to treat and/or limit the influenza infection.
- the present invention provides methods for diagnosing an influenza infection, or monitoring progression of an influenza infection, comprising (a) contacting a biological sample from a subject suspected of having an influenza infection with a diagnostically effective amount of one or more polypeptides of the invention under conditions suitable for binding of the polypeptide to a viral HA protein present in the sample; and
- binding complexes indicates that the subject has an influenza infection, or provides a measure progression of an influenza infection.
- the present invention provides methods for identifying candidate influenza vaccines, comprising
- test compounds (a) contacting test compounds with a polypeptide of the present invention under conditions suitable for polypeptide binding;
- test compounds that bind to the polypeptide of the invention, wherein such test compounds are candidate influenza vaccines.
- the present invention provides methods for identifying candidate compounds for treating, limiting, and/or diagnosing influenza infection, comprising
- test compounds that outcompete the polypeptide for binding to the HA protein, wherein such test compounds are candidate compounds for treating, limiting, and/or diagnosing influenza infection.
- Fig. 1 Overview of the design process.
- the flow chart illustrates key steps in the design process for novel binding proteins, with thumbnails illustrating each step in the creation of binders that target the stem of the 1918 HA.
- HB36 and HB80 residues are depicted as sticks, with hotspot residues noted (F49 and M53 for HB36 and L21, F25, and Y40 for HB80). For clarity, the non-contacting regions from the designs have been omitted.
- E and F Further details of the designed interactions of HB36 (E) and HB80 (F) with 1918/H1 HA.
- G and H Initial binding data for HB36 (G) and HB80 (H) designs (before affinity maturation). When incubated with 1 uM 1918 HA, yeast displaying the two designed proteins show an increase in fluorescent phycoerythrin signal (x-axis) compared to the absence of 1918 HA.
- Fig. 3 Affinity maturation. Substitutions that increase the affinity of the original designs can be classified as deficiencies in modeling the (A and B) repulsive interactions HB36 Ala60Val (A), HB80 Met26Thr (B); (C and D) electrostatics HB36 Asn64Lys (C), HB80 Asn36Lys (D); (E and F) and solvation HB36 Asp47Ser (E), HB80 Aspl2Gly (F). Binding titrations of HB36.4 (G) and HB80.3 (H) to SC1918/H1 HA as measured by yeast surface display. Circles represent the affinity-matured design, Squares the scaffold protein from which the design is derived, and crosses represent the design in the presence of 750nM inhibitory CR6261 Fab.
- Fig. 4 Crystal structure of HB36.3-SC1918/H1 complex validates the precision of the computational design.
- A Superposition of the crystal structure of HB36.3-SC1918/H1 complex and the computational design reveals good agreement in the position of the main recognition helix, with a slight rotation of the rest of the protein domain. Superposition was performed using the HA2 subunits. For clarity, only the HA from the crystal structure is depicted here (the HA used for superposition of the design, which is essentially identical to the crystal structure, was omitted).
- B Close up of the SC1918 HA-HB36.3 interface, highlighting the close agreement between the design and the crystal structure. The main recognition helix is oriented
- HB80.3 binds and inhibits multiple HA subtypes.
- A Phylogenetic tree depicting the relationship between the 16 influenza A hemagglutinin subtypes. These subtypes can be divided into two main lineages, groups 1 and 2.
- CR6261 has broad activity against group 1 viruses.
- HB80.3 has a similar cross-reactivity profile and binds multiple group 1 subtypes, including HI and H5.
- B Binding data for HB80.3 and CR6261 Fab against a panel of HAs.
- HB80.3 inhibits the pH-induced conformational changes that drive membrane fusion. Exposure to low pH converts 1918 HI HA (top panel) and the Viet04 H5 HA to a protease susceptible state (lane 1), while HAs maintained at neutral pH are highly resistant to trypsin (lane 3). Pre- incubation of HB80.3 with HI and H5 prevents pH-induced conformational changes and retains the HAs in the protease-resistant, pre-fusion state (lane 2).
- Circles represent the computational design, squares the scaffold protein from which the design is derived, and crosses represent the design in the presence of 1.5uM inhibitory CR6261 Fab.
- Figure 7. Phycoerythrin (PE) intensity histograms for (a.) HB80 design and (b.) the scaffold the design was derived from (PDB code 2CJJ). Dashed lines represent the population of yeast cells displaying the design in the absence and dark lines the presence of luM HI HA.
- PE Phycoerythrin
- Figure 9 Alanine scanning mutagenesis of key residues at the designed interface of HB36.3 (a.) and HB80.1 (b.) completely abrogating binding. Binding was measured by yeast surface display titrations Figure 10. Yeast display titrations of designs to HI & H5 HA subtypes show heterosubtypic binding of (A.) HB36.4 & (B.) HB80.3 design variants. For both panels, circles are binding titrations of SC/1918/H1 HA and squares the titration data for VN/2004/H5 HA.
- FIG. 11 Protease susceptibility-inhibition assay for HB36.3 against the SC1918/H1 HA.
- A The upper panel shows the effect of various pH treatments and trypsin digestion on SC1918 HA alone. Most of the HA is converted to the protease-susceptible, post-fusion conformation below pH -6.0-6.5.
- the lower panel shows the identical assay for the HB36.3-SC1918 complex (saturated with HB36.3 and purified by gel filtration prior to the experiment; approximately 1 : 1 molar ratio of HB36.3 to HA). Presence of pre-bound HB36.3 in the reactions is unable to block the conversion of HA to the protease-resistant state.
- B Assay carried out under conditions identical those used for HB80.3 as presented in Fig. 5C (approximately 10: 1 molar ratio of HB36.3 to HA). HB36.3 has no protective effect under these conditions.
- polypeptides comprising an amino acid sequence according to general formula I
- Rl is selected from the group consisting of Ser, Ala, Phe, His, Lys, Met, Asn, Gin, Thr,
- R2 can be any amino acid
- R3 is selected from the group consisting of Asp, Ala, Glu, Gly, Asn, Pro, Ser, and Tyr;
- R4 is selected from the group consisting of Leu and Phe;
- R5 can be any amino acid
- R6 is selected from the group consisting of Met, Phe, His, He, Leu, Gin, and Thr;
- R7 is selected from the group consisting of Arg, Gly, Lys, Gin, and Thr;
- R8 is selected from the group consisting of He, Asn, Gin, Val, and Trp;
- R9 is selected from the group consisting of Met, Gly, He, Lys, Leu, Asn, Arg, Ser, Thr,
- RIO is selected from the group consisting of Trp and Phe;
- Rl 1 is selected from the group consisting of He, Phe, Ser, Thr, and Val;
- R12 is selected from the group consisting of Tyr, Cys, Asp, Phe, His, Asn, and Ser;
- R13 is selected from the group consisting of Val, Ala, Phe, He, Leu, Asn, Gin, Thr, and
- R14 is selected from the group consisting of Phe, Glu, and Leu;
- R15 is selected from the group consisting of Ala, Gly, Lys, Arg, and Ser;
- R16 is selected from the group consisting of Phe, Cys, His, Lys, Leu, Met, Asn, Gin, Arg,
- general formula I is Rl-R2-Phe-R3-R4-R5-R6-R7-R8-R9-R10-Rl 1- R12-R13-R14-R15-R16-X1-R17 (SEQ ID NO: 2), wherein Rl through R16 are as defined above, and wherein
- XI is 4-8 amino acids in length, wherein each position can be any amino acid; and R17 is Phe or Tyr. In various embodiments, XI is 4, 5, 6, 7, or 8 amino acids in length. In another embodiment, XI comprises the amino acid sequence Zl -Arg-Z2-Ile-Pro (SEQ ID NO: 3), wherein Zl is Lys or Asn, and Z2 is selected from the group consisting of Lys, Pro, and Thr.
- general formula I is Al-Rl-R2-Phe-R3-R4-R5-R6-R7-R8-R9-R10-Rl 1-R12-R13-R14-R15-R16- X1-R17-B1 (SEQ ID NO: 4), wherein Rl through R17 and XI are as defined above, wherein Al and/or Bl are optionally present, and
- Al comprises the amino acid sequence:
- Bl comprises the amino acid sequence
- polypeptides comprising or consisting of the amino acid sequence of general formula I (derived from HB36.4, as described in more detail in the attached) form helices that recognize and are strong binders to Influenza A hemagglutinin ("HA"), such as influenza viruses of phylogenetic group I, preferably influenza A viruses comprising HA of the HI or H5 subtype.
- HA hemagglutinin
- the polypeptides can be used, for example, to treat and/or limit development of an influenza infection.
- the polypeptide comprises the polypeptide
- SAFDLAMRIMWIYVFAF SEQ ID NO:7
- SAFDLAMRIMWIYVFAFKRPIPF SEQ ID NO:8
- the polypeptide comprises or consists of a polypeptide selected from the group consisting of (scaffold derived from noted in parentheses):
- DAFDLAMRIMWIYVFAFNRPIPF (HB36.2) (SEQ ID NO: 9);
- DAFDLAMRIMWIYVFAF (HB36.2) (SEQ ID NO: 10);
- SAFDLAMRIMWIYVFAF (HB36.3 and HB36.4) (SEQ ID NO: 7);
- HAFDLAMRIHWIYVFAF SEQ ID NO: 15
- HAFDLAMRIHWIYVFAFKR IPF SEQ ID NO: 16
- SAFDLAMRIHWIYIFAFKRPIPF (SEQ ID NO: 28); >HB36.4_s4_El l
- SAFDLAMKIHWIYIFAFKRTIPF SEQ ID NO: 42
- HAFDLAMRIMWIYVFAF SEQ ID NO: 44
- SAFDLAMRIMWIYLFAF SEQ ID NO: 50
- HAFDLAMRIMWIYVFAFKRPIPF SEQ ID NO: 55
- SAFDLAMRIHWIYVFAFKRPIPF (SEQ ID NO: 57);
- SAFDLAMRINWIYVFAFKRPIPF SEQ ID NO: 58
- SAFDLAMRIYWIYVFAFKRPIPF SEQ ID NO: 59
- SAFDLAMRIMWIYFFAFKRPIPF SEQ ID NO: 60
- SAFDLAMRIMWIYLFAFKRPIPF (SEQ ID NO: 61);
- SAFDLAMRIMWIYTFAFKRPIPF (SEQ ID NO: 62);
- SAFDLAMRIMWIYNFAFKRPIPF (SEQ ID NO: 63);
- SAFDLAMRIMWIYVFAWKRPIPF (SEQ ID NO: 64); >HB36.4 (Asp47Ser, Ala60Val, Asn64Lys) MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFDLA MRIMWIYVFAFKRPIPFPHAQKLARRLLELKQAASSPLPLE (SEQ ID NO: 65);
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFDLA MRIMWIYVFAFNRPIPFSHAQKLARRLLELKQAASSPLPLE SEQ ID NO: 68
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDDEAAAVLQAVYETNHAFDLA MRIHWIYVFAFKRKIPFLHAQKLARRLLELKQAASSPLP SEQ ID NO: 69
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAAAVLKAVYATNSAFDLA MRIIWIYVFAYKRKIPFAHAQKLARRLLELKQAASSPLP SEQ ID NO: 70
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDFEADKVLQAVYETNSAFDLAM RINWIYVFAFKRPIPFVHAQKLARRLLELKQAASSPLP SEQ ID NO: 71
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEADKVLQAVYDTNSAFDLA MTIHWIYNFAFKRKIPFLHAPKLARRLLELKLAASSPLP SEQ ID NO: 73
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDDEADRVLQAVYETNSAFDLAM RINWIYVFAFKRTIPFAHAQKLARRLLELKQAASSPLP SEQ ID NO: 74
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDYEADKVLQAVYETNSAFDLA MRIHWIYIFAFKRPIPFVHAQKLARRLLELKQAASSPLP SEQ ID NO: 75
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEADAVLKAVYETNSAFDLA MRIHWIYNFAFKRKIPFVHAQKLARRLLELKQAASSPLP SEQ ID NO: 76
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDDEADKVLQAVYATNSAFDLA MRIHWIYNFAYKRTIPFVHAQKLARRLLELKQAASSPLP SEQ ID NO: 77
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDDEAARVLKAVYATDSAFDLA MRIHWIYNFAFKRKIPFLHAQKLARRLLELKQAASSPLP SEQ ID NO: 78
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEADKVLQAVYATNSAFDLA MRIHWIYIFAFKRTIPFIHAQKLARRLLELKQAASSPLP SEQ ID NO: 79
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDYEADEVLKAVYATNSAFDLA MRIHWIYNFAFKRKIPFTHAQKLARRLLELKQAASSPLP SEQ ID NO: 80
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAAKVLQAVYETNSAFDLA MKIHWIYNFAFKRTIPFVHAQKLARRLLELKQAASSPLPLE (SEQ ID NO: 81); and >HB36.4_s4_E19
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEADKVLQAVYATNSAFDLA MKIHWIYIFAFKRTIPFIHAQKLARRLLELKQAASSPLP SEQ ID NO: 82.
- HB36.4 (SAFDLAMRIMWIYVFAF (SEQ ID NO: 7)) is modified such that one or more of the following is true: Rl is His; R7 is Lys; R9 is Tyr, Asn, or His; R13 is Phe, Leu, Thr, or Asn; and R16 is Trp.
- RIO is Trp.
- R2 and/or R5 is Ala.
- R17 is Phe.
- Allowable positions were determined from yeast display selections of HB36.4 variants to SC1918/H1 HA coupled to deep sequencing (see attached for further details).
- the threshold was no more than 80% depletion in the frequency of a given mutant in the selection library after two selection sorts by FACS. Positions listed in bold font indicate positions that make contact with the HA surface.
- the polypeptide comprises amino acid substitutions relative to HB36.4 as follows (singly or in combination): able 2. H] 336.4 point mutations that show increased binding affinity
- polypeptides comprising an amino acid sequence according to general formula II
- Rl is selected from the group consisting of Phe and Val
- R2 is selected from the group consisting of Ser, Ala, Phe, Gly, He, Lys, Leu, Met, Asn, Pro, Gin, Arg, Thr, and Val;
- R3 is selected from the group consisting of Glu, and Asp;
- R4 is selected from the group consisting of Asn, His, He, Lys, Leu, Met, Arg, Ser, and Thr;
- R5 is selected from the group consisting of Leu, Phe, He, Met, Asn, Gin, and Val;
- R6 is selected from the group consisting of Ala, Asp, Lys, Met, Asn, Gin, Arg, Glu, and
- R7 is selected from the group consisting of Phe, Asp, Asn, and Tyr;
- R8 is selected from the group consisting of Glu, Ala, Asp, Gly, His, Lys, Leu, Met, Asn,
- R9 is selected from the group consisting of Leu, Phe, He, Met, and Val;
- R10 is selected from the group consisting of Leu, He, Met, and Tyr;
- Rl 1 is selected from the group consisting of Ser, Ala, Gly, and Tyr;
- general formula II is Rl-R2-R3-R4-R5-R6-R7-R8-R9-Ala-R10-Rl 1- Phe-Xl-R12-R13-X2-R14 (SEQ ID NO: 84), wherein Rl through Rl 1 are as defined above, and wherein XI is 5-15 amino acids in length, wherein each position can be any amino acid;
- R12 is selected from the group consisting of Gin, Tyr, Phe, Met, Arg, Lys, and Gly;
- R13 is selected from the group consisting of Tyr, Asp, Met, Asn, and Ser;
- X2 is any amino acid
- R14 is selected from the group consisting of Ser, Arg, and Lys.
- XI is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids in length.
- XI comprises the amino acid sequence TNKDTPDRW-Zl-KVA (SEQ ID NO: 85) where Zl is Ala, Lys, Arg, Gly, or Thr.
- general formula II is Al- Rl-R2-R3-R4-R5-R6-R7-R8-R9-Ala-R10-Rl 1-Phe-Xl-R12-R13-X2- R14-B1 (SEQ ID NO: 86), wherein Rl through R14 and XI are as defined above, wherein Al and/or Bl are optionally present, and wherein:
- Al comprises the amino acid sequence: Z 1 -ASTRGSGRPW-Z2 (SEQ ID NO: 87), wherein Zl is absent or is Met, and Z2 is selected from group consisting of Gly, Arg, Lys, Asp and
- Bl comprises the amino acid sequence G-Z 1 -TPEE VKKHYE (SEQ ID NO: 88), where Zl is R or K
- polypeptides comprising the amino acid sequence of general formula II (derived from HB80.3, as described in more detail in the attached) form helices that recognize and are strong binders to Influenza A hemagglutinin.
- the polypeptides can be used, for example, to treat and/or limit development of an influenza infection.
- the polypeptide comprises the peptide FSENLAFELALSF (SEQ ID NO: 89), or a variant including 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more variant positions of
- polypeptide comprises amino acid substitutions relative to HB80.3 as follows (singly or in combination)
- the polypeptide comprises or consists of a polypeptide selected from the group consisting of
- FSENLAFELALA SEQ ID NO: 90
- >HB80.3_s4_E84 FSENVAFEIALSFTNKDTPDRWRKVARYVR (SEQ ID NO: 119); >HB80.3_s4_E85: FSENIAFELALYFTNKDTPDRWGKVARYVR (SEQ ID NO: 120); >HB80.3_s4_E86: FSENVAFELALYFTNKDTPDRWKKVARYVK (SEQ ID NO: 121); >HB80.3_s4_E87: FSENIAFELALYFTNKDTPDRWKKVARYVK (SEQ ID NO: 122); >HB80.3_s4_E88: FKENLEFEI AL SFTNKDTPDRWKKV AY Y VR (SEQ ID NO: 123);
- >HB80.3_s4_E89 FSENVAFEIALSFTNKDTPDRWRKVARYVR (SEQ ID NO: 124); >HB80.3_s4_E90: FSENVAFELALYFTNKDTPDRWTKVARYVK (SEQ ID NO: 125); >HB80.3_s4_E91 : FSENVAFELALYFTNKDTPDRWTKVARYVK (SEQ ID NO: 126); >HB80.3_s4_E92: FSENVAFEIALSFTNKDTPDRWRKVARYVR (SEQ ID NO: 127); >HB80.3_s4_E93 : FSENVAFELALYFTNKDTPDRWGKVAQYVR (SEQ ID NO: 128);
- >HB80.3_s4_E94 FSENVAFELALYFTNKDTPDRWAKVARYVK (SEQ ID NO: 129); >HB80.3_s4_E95: FSENVAFELALYFTNKDTPDRWTKVARYVK (SEQ ID NO: 130); >HB80.3_s4_E96: FSENVAFEIALSFTNKDTPDRWRKVAYYVR (SEQ ID NO: 131); >HB80.3_s4_E97: FSENVAFEIALSFTNKDTPDRWRKVARYVR (SEQ ID NO: 132); >HB80.3_s4_E98: FSENVAFEIALSFTNKDTPDRWAKVARYVR (SEQ ID NO: 133);
- >HB80.3_s4_E99 FSENLAFELALYFTNKDTPDRWAKVAYYVK (SEQ ID NO: 134); >HB80.3_s4_E100: FSENVAFEIALSFTNKDTPDRWKKVARYVK (SEQ ID NO: 135); >HB80.3_s5_E01 : FSENVAFEIALSFTNKDTPDRWRKVARYVR (SEQ ID NO: 136); >HB80.3_s5_E04: FSENVAFEIALSFTNKDTPDRWRKVARYVR (SEQ ID NO: 137); >HB80.3_02: FSENIAFEIALSFTNKDTPDRWKKVAQYVK (SEQ ID NO: 138);
- FGENLAFELALSF (SEQ ID NO: 142);
- FIENLAFELALSF (SEQ ID NO: 143);
- FKENLAFELALSF (SEQ ID NO: 144);
- FRENLAFELALSF SEQ ID NO: 145
- FTENLAFELALSF SEQ ID NO: 146
- FVENLAFELALSF (SEQ ID NO: 147);
- FSENIAFELALSF (SEQ ID NO: 148);
- FSENVAFELALSF (SEQ ID NO: 149);
- FSENLRFELALSF (SEQ ID NO: 151);
- FSENLTFELALSF (SEQ ID NO: 152);
- FSENLAFSLALSF (SEQ ID NO: 153);
- FSENLAFELALYF SEQ ID NO: 154
- FSENLAFELALSFTNKDTPDRWAKVARYVS SEQ ID NO: 156
- FSENLAFELALSFTNKDTPDRWAKVAYYVS SEQ ID NO: 157
- FSENLAFELALSFTNKDTPDRWAKVAQYVK SEQ ID NO: 158
- FSENLAFELALSFTNKDTPDRWAKVAQYVR SEQ ID NO: 159
- FSENLAFELALSFTNKDTPDRWAKVAQYVS SEQ ID NO: 160
- FAENLAFELALSFTNKDTPDRWAKVAQYVS SEQ ID NO: 161
- FGENLAFELALSFTNKDTPDRWAKVAQYVS SEQ ID NO: 162
- FIENLAFELALSFTNKDTPDRWAKVAQYVS SEQ ID NO: 163
- FKENLAFELALSFTNKDTPDRWAKVAQYVS SEQ ID NO: 164
- FRENLAFELALSFTNKDTPDRWAKVAQYVS SEQ ID NO
- FSENLAFELALSFTNKDTPDRWAKVAQYVR (SEQ ID NO: 179);
- ASTRGSGRPWKFSENVAFELALYFTNKDTPDRWAKVARYVKGRTPEEVKKHYE SEQ ID NO: 200
- Tyrosine 40 that is outside of that recognition motif.
- Allowable positions were determined from yeast display selections of HB80.3 variants to SC1918/H1 HA coupled to deep sequencing (see attached for further details).
- the threshold was no more than 80% depletion in the frequency of a given mutant in the selection library after two selection sorts by FACS. Positions listed in bold font indicate positions that make contact with the HA surface.
- the polypeptide comprises amino acid substitutions relative to HB80.3 as follows (singly or in combination).
- HB80.3 (FSENLAFELALSF (SEQ ID NO: 89)) is modified such that one or more of the following is true: R2 is Ala, Gly, He, Lys, Arg, Thr, or Val; R5 is He or Val; R6 is Lys or Arg; R8 is Ser; R9 is He; and/or Rl 1 is Tyr.
- the invention provides polypeptides comprising or consisting of a polypeptide selected from the group consisting of
- Each of these polypeptides form helices that recognize and are strong binders to
- influenza A hemagglutinin.
- the polypeptides can be used, for example, to treat and/or limit development of an influenza infection
- the present invention provides a polypeptide comprising or consisting of any helix coming from a peptide or a protein that docks and binds against the HA epitope recognized by the polypeptides of the invention.
- the helix is 15-17 residues in length, similar to the HB36.4 and HB80.3 helices disclosed above
- polypeptide is used in its broadest sense to refer to a sequence of subunit amino acids.
- the polypeptides of the invention may comprise L-amino acids, D-amino acids (which are resistant to L-amino acid-specific proteases in vivo), or a combination of D- and L-amino acids.
- the polypeptides described herein may be chemically synthesized or recombinantly expressed.
- the polypeptides may be linked to other compounds to promote an increased half-life in vivo, such as by PEGylation, HESylation, PASylation, glycosylation, or may be produced as an Fc-fusion or in deimmunized variants. Such linkage can be covalent or non-covalent as is understood by those of skill in the art.
- polypeptides of any embodiment of any aspect of the invention may further comprise a tag, such as a detectable moiety or therapeutic agent.
- the tag(s) can be linked to the polypeptide through covalent bonding, including, but not limited to, disulfide bonding, hydrogen bonding, electrostatic bonding, recombinant fusion and
- the tag(s) can be linked to the polypeptide by means of one or more linking compounds.
- Techniques for conjugating tags to polypeptides are well known to the skilled artisan.
- Polypeptides comprising a detectable tag can be used diagnostically to, for example, assess if a subject has been infected with influenza virus or monitor the development or progression of an influenza virus infection as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment regimen. However, they may also be used for other detection and/or analytical and/or diagnostic purposes.
- Any suitable detection tag can be used, including but not limited to enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals, and nonradioactive paramagnetic metal ions.
- the tag used will depend on the specific
- detection/analysis/diagnosis techniques and/or methods used such as immunohistochemical staining of (tissue) samples, flow cytometric detection, scanning laser cytometric detection, fluorescent immunoassays, enzyme-linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), bioassays (e.g., neutralization assays), Western blotting applications, etc.
- immunohistochemical staining of (tissue) samples such as tissue samples, flow cytometric detection, scanning laser cytometric detection, fluorescent immunoassays, enzyme-linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), bioassays (e.g., neutralization assays), Western blotting applications, etc.
- ELISAs enzyme-linked immunosorbent assays
- RIAs radioimmunoassays
- bioassays e.g., neutralization assays
- Western blotting applications etc.
- Enzymes typically conjugated to polypeptides to permit their immunohistochemical visualization are well known and include, but are not limited to, acetylcholinesterase, alkaline phosphatase, beta-galactosidase, glucose oxidase, horseradish peroxidase, and urease.
- Typical substrates for production and deposition of visually detectable products are also well known to the skilled person in the art.
- polypeptides can be labeled using colloidal gold or they can be labeled with radioisotopes, such
- Polypeptides of the invention can be attached to radionuclides directly or indirectly via a chelating agent by methods well known in the art.
- the tag may comprise, for example, a fluorophore.
- fluorophore A wide variety of fluorophores useful for fluorescently labeling the polypeptides of the invention are known to the skilled artisan.
- the tag can comprise, for example, magnetic resonance imaging (MRI) contrast agents, such as gadolinium diethylenetriaminepentaacetic acid, to ultrasound contrast agents or to X-ray contrast agents, or by radioisotopic labeling.
- MRI magnetic resonance imaging
- polypeptides of the invention can also be attached to solid supports, which are particularly useful for in vitro assays or purification of influenza virus or HA protein.
- solid supports might be porous or nonporous, planar or nonplanar and include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene supports.
- the polypeptides can also, for example, usefully be conjugated to filtration media, such as NHS-activated Sepharose or CNBr-activated Sepharose for purposes of affinity
- the polypeptides of the invention can usefully be attached to the surface of a microtiter plate for ELISA.
- polypeptides of the invention can be fused to marker sequences to facilitate purification.
- marker sequences include, but are not limited to, the hexa-histidine tag, the myc tag or the flag tag.
- polypeptides of the invention can be conjugated to an antigen recognized by the immune system of a subject to which the polypeptide is administered.
- Conjugation methods for attaching the antigens and polypeptide are well known in the art and include, but are not limited to, the use of cross-linking agents.
- the polypeptide will bind to the influenza virus HA protein and the antigen will initiate a T-cell attack on the conjugate that will facilitate destruction of the influenza virus.
- the present invention provides retro-inverso polypeptides corresponding to the polypeptides of the invention.
- Retro-inverso polypeptides of the invention comprise or consist of D-amino acids assembled in a reverse order from that of L- sequence polypeptide versions of the polypeptides disclosed above, thus maintaining the overall topology of the polypeptide, and maintaining HA binding.
- the present invention provides isolated nucleic acids encoding a polypeptide of the present invention.
- the isolated nucleic acid sequence may comprise RNA or DNA.
- isolated nucleic acids are those that have been removed from their normal surrounding nucleic acid sequences in the genome or in cDNA sequences.
- Such isolated nucleic acid sequences may comprise additional sequences useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. It will be apparent to those of skill in the art, based on the teachings herein, what nucleic acid sequences will encode the polypeptides of the invention.
- the present invention provides recombinant expression vectors comprising the isolated nucleic acid of any aspect of the invention operatively linked to a suitable control sequence.
- “Recombinant expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any control sequences capable of effecting expression of the gene product.
- "Control sequences" operably linked to the nucleic acid sequences of the invention are nucleic acid sequences capable of effecting the expression of the nucleic acid molecules. The control sequences need not be contiguous with the nucleic acid sequences, so long as they function to direct the expression thereof.
- intervening untranslated yet transcribed sequences can be present between a promoter sequence and the nucleic acid sequences and the promoter sequence can still be considered "operably linked" to the coding sequence.
- Other such control sequences include, but are not limited to, polyadenylation signals, termination signals, and ribosome binding sites.
- Such expression vectors can be of any type known in the art, including but not limited plasmid and viral-based expression vectors.
- control sequence used to drive expression of the disclosed nucleic acid sequences in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid- responsive).
- inducible promoters including, but not limited to, tetracycline, ecdysone, steroid- responsive.
- the construction of expression vectors for use in transfecting prokaryotic cells is also well known in the art, and thus can be accomplished via standard techniques. (See, for example, Sambrook, Fritsch, and Maniatis, in: Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1989; Gene Transfer and Expression Protocols, pp.
- the expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA.
- the expression vector comprises a plasmid.
- the invention is intended to include other expression vectors that serve equivalent functions, such as viral vectors.
- the present invention provides host cells that have been transfected with the recombinant expression vectors disclosed herein, wherein the host cells can be either prokaryotic or eukaryotic.
- the cells can be transiently or stably transfected.
- transfection of expression vectors into prokaryotic and eukaryotic cells can be accomplished via any technique known in the art, including but not limited to standard bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection.
- a method of producing a polypeptide according to the invention is an additional part of the invention.
- the method comprises the steps of (a) culturing a host according to this aspect of the invention under conditions conducive to the expression of the polypeptide, and (b) optionally, recovering the expressed polypeptide.
- the expressed polypeptide can be recovered from the cell free extract, but preferably they are recovered from the culture medium. Methods to recover polypeptide from cell free extracts or culture medium are well known to the man skilled in the art.
- the present invention provides antibodies that selectively bind to the polypeptides of the invention.
- the antibodies can be polyclonal, monoclonal antibodies,human ized antibodies, and fragments thereof, and can be made using techniques known to those of skill in the art .
- selective bind means preferential binding of the antibody to the polypeptide of the invention, as opposed to one or more other biological molecules, structures, cells, tissues, etc., as is well understood by those of skill in the art.
- the present invention provides pharmaceutical compositions, comprising one or more polypeptides of the invention and a pharmaceutically acceptable carrier.
- the pharmaceutical compositions of the invention can be used, for example, in the methods of the invention described below.
- the pharmaceutical, composition may comprise in addition to the polypeptide of the invention (a) a lyoprotectant; (b) a surfactant; (c ) a bulking agent: (d) a tonicity adjusting agent; (e) a stabilizer; (f) a preservative and/or (g) a buffer.
- the buffer in the pharmaceutical composition is a Tris buffer, a histidme buffer, a phosphate buffer, a citrate buffer or an acetate buffer.
- the pharmaceutical composition may also include a [yoprotectant, e.g. sucrose, sorbitol or trehalose.
- the pharmaceutical composition includes a preservative e.g.
- the pharmaceutical composition includes a bulking agent, like glycine.
- the pharmaceutical composition includes a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate- 60, polysorbate-65, polysorbate ⁇ 80 polysorbate-85, poloxamer-188, sorbitan monoiaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooieate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof.
- the pharmaceutical composition may also include a tonicity adjusting agent, e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human blood.
- Exemplary tonicity adjusting agents include sucrose, sorbitol, glycine, methionine, manmtoL dextrose, inositol, sodium chloride, arginme and arginme hydrochloride.
- the pharmaceutical composition additionally includes a stabilizer, e.g., a molecule which, when combined with a protein of interest substantially prevents or reduces chemical and/or physical instability of the protein of interest in lyophilized or liquid form.
- Exemplary stabilizers include sucrose, sorbitol, glycine, inositol, sodium chloride, methionine, arginine, and arginine hydrochloride.
- polypeptides may be the sole active agent in the pharmaceutical composition, or the composition may further comprise one or more other active agents suitable for an intended use, including but not limited to anti-HA and anti-NA antibodies.
- the present invention provides methods for treating and/or limiting an influenza infection, comprising administering to a subject in need thereof a therapeutically effective amount of one or more polypeptides of the invention, salts thereof, conjugates thereof, or pharmaceutical compositions thereof, to treat and/or limit the influenza infection.
- the method comprises treating an influenza infection
- the one or more polypeptides are administered to a subject that has already been infected with the influenza virus, and/or who is suffering from symptoms (including but not limited to chills, fever, sore throat, muscle pains, coughing, weakness, fatigue, and general discomfort) indicating that the subject is likely to have been infected with the influenza virus.
- treat or “treating” means accomplishing one or more of the following: (a) reducing influenza viral titer in the subject; (b) limiting any increase of influenza viral titer in the subject; (c) reducing the severity of flu symptoms; (d) limiting or preventing development of flu symptoms after infection; (e) inhibiting worsening of flu symptoms; (f) limiting or preventing recurrence of flu symptoms in subjects that were previously symptomatic for influenza infection.
- the method comprises limiting an influenza infection
- the one or more polypeptides are administered prophylactically to a subject that is not known to have been infected, but may be at risk of exposure to the influenza virus.
- limiting means to limit influenza infection in subjects at risk of influenza infection. Given the nature of seasonal influenza outbreaks, virtually all subjects are at risk of exposure, at least at certain times of the year.
- Groups at particularly high risk include children under age 18, adults over the age of 65, and individuals suffering from one or more of asthma, diabetes, heart disease, or any type of immunodeficiency.
- the methods of the invention can be used to treat any individual infected with influenza virus, including but not limited to influenza virus A, influenza virus B, and influenza virus C.
- the methods are preferably used to treat influenza A virus infections caused by influenza A viruses of phylogenetic group I, in particular comprising HA of the HI or H5 subtype.
- a "therapeutically effective amount” refers to an amount of the polypeptide that is effective for treating and/or limiting influenza infection.
- the polypeptides are typically formulated as a pharmaceutical composition, such as those disclosed above, and can be administered via any suitable route, including orally, parentally, by inhalation spray, rectally, or topically in dosage unit formulations containing conventional pharmaceutically acceptable carriers, adjuvants, and vehicles.
- parenteral as used herein includes, subcutaneous, intravenous, intra-arterial, intramuscular, intrasternal, intratendinous, intraspinal, intracranial, intrathoracic, infusion techniques or intraperitoneally.
- Dosage regimens can be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response).
- a suitable dosage range may, for instance, be 0.1 ug/kg-100 mg/kg body weight; alternatively, it may be 0.5 ug/kg to 50 mg/kg; 1 ug/kg to 25 mg/kg, or 5 ug/kg to 10 mg/kg body weight.
- the polypeptides can be delivered in a single bolus, or may be administered more than once (e.g., 2, 3, 4, 5, or more times) as determined by an attending physician.
- the polypeptides of the invention neutralize influenza virus infectivity. While not being limited by any mechanism of action, neutralizing activity may be achieved by inhibiting fusion of the influenza virus and the membrane of the targeted cell, including a membrane of an intracellular compartment, such as an endosome.
- the polypeptides of the invention were designed to target an HA epitope that is absent in HA post-conformational change. Since the HA protein conformational change leads to fusion of the viral and cell membrane, polypeptide binding to the HA protein in its pre-fusion form may prevent fusion.
- the polypeptides of the invention prevent influenza virus from infecting host cells by at least 99%, at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, at least 50%, at least 45%, at least 40%, at least 45%, at least 35%, at least 30%, at least 25%, at least 20%, or at least 10% relative to infection of host cells by influenza virus in the absence of the polypeptides.
- Neutralization can, for instance, be measured as described in "Laboratory techniques in influenza," edited by F. -X. Meslin, M. M. Kaplan and H. Koprowski (1996), 4th edition, Chapters 15-17, World Health Organization, Geneva.
- the polypeptides according to the invention can bind to the HA protein with any suitable affinity constant (J3 ⁇ 4 value) that provides therapeutic or prophylactic benefit.
- the Kd value is lower than 0.2* 10 "4 M, 1.0* 10 "5 M, 1.0* 10 "6 M, 1.0* 10 "7 M, 1.0* 10 " 8 M, 1.0* 10 "9 M, 1.0* 10 "10 M, 1.0* 10 ⁇ U M, or 1.0* 10 "12 M.
- Affinity constants can for instance be measured using surface plasmon resonance, i.e., an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example, using the BIACORE system (Pharmacia Biosensor AB, Uppsala, Sweden).
- surface plasmon resonance i.e., an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, for example, using the BIACORE system (Pharmacia Biosensor AB, Uppsala, Sweden).
- the present invention provides methods for diagnosing an influenza infection, or monitoring progression of an influenza infection, comprising
- binding complexes indicates that the subject has an influenza infection, or provides a measure progression of an influenza infection.
- the methods of this aspect of the invention can be used to more accurately identify patients that may be suffering from an influenza infection and to thus provide more informed determination of treatment options by an attending caregiver. Individuals at risk of an influenza infection are as described above.
- the methods can also be used to monitor progression of an influenza infection; in this embodiment, the subject is known to be infected, and the methods can be used, for example, as a data point for an attending caregiver to determine whether to initiate, modify, or continue a particular course of therapy, such as treatment with neuraminidase or M2 protein inhibitors.
- the biological sample may be any suitable biological sample including, but not limited to blood, serum, nasal secretions, tissue or other biological material from a subject at risk of infection.
- the sample may first be manipulated to make it more suitable for the method of detection.
- Manipulation includes, but is not limited to treating the the sample in such a way that any influenza virus in the sample will disintegrate into antigenic components such as proteins, polypeptides or other antigenic fragments.
- the polypeptides of the invention are contacted with the sample under conditions which allow the formation of an complex between the human polypeptides and influenza virus or antigenic components thereof that may be present in the sample.
- the formation of such complexes, if any, indicating the presence of influenza virus in the sample is then detected and measured by suitable means.
- Such methods include, but are not limited to homogeneous and heterogeneous binding immunoassays, such as
- Suitable conditions to promote binding of the test compounds to one or more polypeptide of the invention can be determined by those of skill in the art, based on the teachings herein.
- the polypeptides of the invention for use in this aspect may comprise a conjugate as disclosed above, to provide a tag useful for any detection technique suitable for a given assay.
- the tag used will depend on the specific detection/analysis/diagnosis techniques and/or methods used.
- the methods may be carried in solution, or the polypeptide(s) of the invention may be bound or attached to a carrier or substrate, e.g., microtiter plates (ex: for ELISA), membranes and beads, etc.
- Carriers or substrates may be made of glass, plastic (e.g., polystyrene), polysaccharides, nylon, nitrocellulose, or teflon, etc.
- the surface of such supports may be solid or porous and of any convenient shape.
- conditions are selected to identify test compounds that bind to the polypeptide of the invention with a Ka value lower than 0.2* 10 "4 M, 1.0* 10 "5 M, 1.0* 10 "6 M, 1.0* 10 ⁇ 7 M, 1.0* 10 "8 M, 1.0* 10 "9 M, 1.0* 10 "10 M, 1.0* 10 ⁇ U M, or 1.0* 10 " 12 M.
- the present invention provides methods for identifying candidate influenza vaccines, comprising
- test compounds that bind to the polypeptide of the invention, wherein such test compounds are candidate influenza vaccines.
- the polypeptides of the present invention were designed to target an HA epitope that is absent in HA post-conformational change.
- the polypeptides of the invention can be viewed as specific binders to an HA epitope, similar to antibody binding to a specific epitope.
- Vaccines can be produced, for example, by selecting small molecules (ie:
- the present methods involve substituting one or more polypeptides of the present invention for the antibody in such assay to identify candidate influenza vaccines.
- Suitable conditions to promote binding of the test compounds to one or more polypeptide of the invention can be determined by those of skill in the art, based on the teachings herein.
- the polypeptides of the invention for use in this aspect may comprise a conjugate as disclosed above, to provide a tag useful for any detection technique suitable for a given assay.
- the tag used will depend on the specific detection/analysis/diagnosis techniques and/or methods used, as discussed above.
- the methods may be carried in solution, or the polypeptide(s) of the invention may be bound or attached to a carrier or substrate, as discussed above. Based on the teachings herein, it is within the level of skill in the art to determine specific conditions for the various types of diagnostic assays disclosed in this aspect of the invention.
- conditions are selected to identify test compounds that bind to the polypeptide of the invention with a Kj value lower than 0.2* 10 ⁇ 4 M, 1.0* 10 ⁇ 5 M, 1.0* 10 ⁇ 6 M, 1.0* 10 ⁇ 7 M, 1.0* 10 ⁇ 8 M, 1.0* 10 ⁇ 9 M, 1.0* 10 ⁇ 10 M, 1.0* 10 ⁇ n M, or 1.0* 10 ⁇ 12 M.
- test compounds comprise polypeptide sequences
- polypeptides may be chemically synthesized or recombinantly expressed. Recombinant expression can be
- Such expression vectors can comprise bacterial or viral expression vectors, and such host cells can be prokaryotic or eukaryotic.
- Synthetic polypeptides prepared using the well-known techniques of solid phase, liquid phase, or peptide condensation techniques, or any combination thereof, can include natural and unnatural amino acids.
- Amino acids used for peptide synthesis may be standard Boc (Na- amino protected Na-t-butyloxycarbonyl) amino acid resin with standard deprotecting, neutralization, coupling and wash protocols, or standard base-labile Na-amino protected 9- fluorenylmethoxycarbonyl (Fmoc) amino acids.
- Both Fmoc and Boc Na-amino protected amino acids can be obtained from Sigma, Cambridge Research Biochemical, or other chemical companies familiar to those skilled in the art.
- the polypeptides can be synthesized with other Na-protecting groups that are familiar to those skilled in this art. Solid phase peptide synthesis may be accomplished by techniques familiar to those in the art and provided, such as by using automated synthesizers.
- test compounds comprise antibodies
- such antibodies can be polyclonal or monoclonal.
- the antibodies can be humanized, fully human, or murine forms of the antibodies.
- Such antibodies can be made by well-known methods, such as described in Harlow and Lane, Antibodies; A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y., (1988).
- nucleic acids may be produced by any suitable means, such as chemical synthesis.
- the nucleic acids may be DNA or RNA, and may be single stranded or double.
- such nucleic acids can be chemically or enzymatically synthesized by manual or automated reactions, using standard techniques in the art. If synthesized chemically or by in vitro enzymatic synthesis, the nucleic acid may be purified prior to introduction into the cell.
- the nucleic acids can be purified from a mixture by extraction with a solvent or resin, precipitation, electrophoresis, chromatography, or a combination thereof.
- the nucleic acids may be used with no or a minimum of purification to avoid losses due to sample processing.
- test compounds comprise compounds other than polypeptides, antibodies, or nucleic acids
- such compounds can be made by any of the variety of methods in the art for conducting organic chemical synthesis.
- the present invention provides methods for identifying candidate compounds for treating, limiting, and/or diagnosing influenza infection, comprising
- test compounds contacting an influenza HA protein with (i) test compounds and (ii) a polypeptide of the present invention, under conditions suitable for binding of the HA protein to the polypeptide of the present invention; and (b) identifying those test compounds that outcompete the polypeptide for binding to the HA protein, wherein such test compounds are candidate compounds for treating, limiting, and/or diagnosing influenza infection.
- the methods identify test compounds that compete with the polypeptides of the invention for binding to HA, and thus such candidate compounds may be useful in any of the other methods of the invention disclosed herein.
- Any suitable test compound can be used, as disclosed above in the eleventh aspect of the invention.
- competitive inhibition is measured by means of an assay, wherein an HA composition is admixed with the polypeptide(s) of the invention and the test compounds to be screened.
- the test compounds to be screened are present in excess. Protocols based upon ELISAs are suitable for use in such competition studies.
- the polypeptide(s) of the invention and varying amounts of test compounds to be screened are admixed during exposure to the HA composition. Any suitable detection means can be used binding.
- the polypeptide(s) of the invention are tagged for detection, as discussed above.
- the detectable label will decrease in the presence of competitive test compounds.
- the reactivity of the (labeled) polypeptide of the invention in the absence of test compound could serve as one suitable control.
- competitive test compounds will, when present in excess, inhibit specific binding of the polypeptide(s) of the invention to HA by at least 10%, preferably by at least 25%, more preferably by at least 50%, and most preferably by at least 75% to 90% or even greater.
- Example 1 Design of proteins for binding to influenza hemagglutinin
- Hemagglutinin (HA) is a prime candidate for drug development as it is the major player in viral invasion of cells lining the respiratory tract. While most antibodies bind to the rapidly varying head region of HA, recently two antibodies, CR6261 and F10, were structurally characterized (9, 10) that bind to a region on the HA stem, which is conserved among all group 1 influenza strains (11).
- a computational method for designing protein-protein interactions de novo, and use the method to design high-affinity binders to the conserved stem region on influenza HA.
- the surface on the stem of HA recognized by neutralizing antibodies consists of a hydrophobic groove that is flanked by two loops that place severe steric constraints on binding to the epitope (Fig. 2A-B) (14).
- Fig. 1 the disembodied residues found through computational docking cluster into three regions (HS 1 , HS2, and HS3; Fig. 1).
- HS 1 a Phe side chain forms an energetically favorable aromatic-stacking interaction with Trp21 on chain 2 of the HA (HA2) (HA residue numbering corresponds to the H3 subtype sequence-numbering convention).
- HS2 the nonpolar residues He, Leu, Met, Phe, and Val, make favorable van der Waals interactions with both the hydrophobic groove and HS 1 (Fig. 1 ).
- a Tyr side chain forms a hydrogen bond to Asp 18 on HA2 and van der Waals interactions with the A-helix on HA2.
- the Tyr in HS3 resembles the conformation of a Tyr residue observed on the antibody in the structure of the HA and CR6261 Fab complex ; the HS1 and HS2 interactions are not found in the antibody structures (9, 10, 15) .
- scaffold residues with backbone atoms within 4A of the hotspot residue were identified.
- the scaffold protein was placed to coincide with the backbone of the hotspot, the residue was modeled explicitly, and the rigid-body orientation was minimized. If no steric clashes were observed and the Phe was in contact with Trp21 and Thr41 of HA2 (Fig. 2B), the placement of the first hotspot was deemed successful; otherwise, another HS 1 Phe conformation was selected and the process was repeated.
- nonpolar residues were incorporated at positions in the scaffold protein, from which the HS2 interactions could be realized, and the remainder of the scaffold protein surface was then redesigned using RosettaDesignTM (19).
- HA Binder 36 used the two-residue hotspot, and bound to the HA with an apparent dissociation constant (K d ) of 200 nM(2J)(Fig. 2G, Fig. 6 .
- a second design, HB80 used the three-residue hotspot and bound HA only weakly (Fig. 2H).
- the scaffold from which this design was derived the MYB domain of the RAD transcription factor from A. Majus (PDB code: 2CJJ) (24), again did not bind the HA (Fig. 7 ).
- the hotspot residues are buttressed by a concentric arrangement of hydrophobic residues with an outer ring of polar and charged residues as often observed in native protein-protein interfaces.
- Both designs present a row of hydrophobic residues on a helix that fits into the HA hydrophobic groove.
- the complexes each bury approximately 1,55 ⁇ 2 surface area (total), close to the mean value for dissociable protein interactions (12) and slightly larger than the total surface area buried by each of the two neutralizing antibodies (9, 10).
- the helical binding modes in these designs are very different from the loop-based binding observed in the antibody-bound structures.
- Electrostatics In HB36, the substitution to Lys at position 64 places a complementary charge adjacent to an acidic pocket on HA near the conserved stem region (Fig. 3C); in HB80, an Asn36Lys substitution positions a positive charge 6.5 A from the negative Asp 18 on HA2 (Fig. 3D). These substitutions all enhance electrostatic complementarity in the complex.
- the lysines were not selected in the design calculations because the magnitudes of surface-electrostatic interactions between atoms outside of hydrogen-bonding range are largely reduced; improvement of the electrostatic model would evidently allow design of higher-affinity binders from the start.
- Table 6 Selected mutations at Asp47 of HB36 design that increased binding affinity > 10-fold relative to original design.
- the favorable substitutions were combined and the proteins were expressed with a His- tag in E. coli and purified by nickel affinity and size-exclusion chromatography.
- the HB36.4 variant which incorporates Asp47Ser, Ala60Val, and Asn64Lys, bound to SC1918/H1 HA with a dissociation constant measured by SPR of 22nM and an off-rate of 7- 10 ⁇ 3 s "1 (Table 7 ).
- Table 7 Affinity and kinetic binding constants for specified design variants. All measurements were recorded using surface plasmon resonance. Numbers in parentheses indicate error associated with the measurement.
- H B80.3 (D12G,A24S, M26T,N36K) 38 ⁇ 2 1.0 ⁇ 0.2 e6 3.9 ⁇ 0.8 e2
- Table 8 Summary of alanine scanning mutagenesis of key residues at the interface of HB36 and HA80. Binding was measured by yeast surface display titrations on two separate days. NB marks no binding at ⁇ HA. ⁇ was computed from the change in Ka relative to HB36.3 at the assay temperature of 294 K.
- the crystal structure of HB36.3 in complex with the SC1918 HA ectodomain was determined to 3.1 A resolution. After molecular replacement using only the 1918/H 1 HA structure as the search model (approximately 86% of the protein mass in the crystal asymmetric unit), clear electron density was observed for HB36.3 near the target surface in the HA stem region into which HB36.3 could be unambiguously placed.
- the orientation was essentially identical to the designed binding mode, with the modified surface of the main recognition helix packed in the hydrophobic groove on HA (Fig. 4A).
- HB36.3 The surface contacted by HB36.3 is accessible and highly conserved in the HAs of most group 1 influenza viruses, suggesting that it may be capable of binding not only other HI HAs, but also other HA subtypes. Indeed, binding of HB36.3 to A/South Carolina/l/1918(HlNl) and A/WSN/1933(H1N1) is readily detectable in solution by gel filtration (data not shown), as well as high-affinity binding of HB36.4 to A/Vietnam/ 1203/2004 H5 subtype by yeast display (Fig. 10 ).
- HB80 While a crystal structure of HB80 in complex with HA has not been obtained, the mutational data and the antibody-competition results suggest that HB80 also binds to the designed target surface, overlapping with HB36 and CR6261. Consequently, HB80.3 is also expected to be highly cross-reactive and binds with high affinity to A/Vietnam/ 1203/2004 H5 HA (Fig. 10 ), and to HI, H2, H5, and H6 subtypes by biolayer interferometry (Fig. 5 A,B). Overall, the pattern of HB80 binding mirrors that of CR6261 and binds most of the group 1 HAs tested, with no detectable binding to group 2 HAs.
- Antibody CR6261 inhibits influenza virus replication by blocking the pH-induced refolding of HA, which drives fusion of the viral envelope with the endosomal membrane of the host cell. Given extensive overlap between the HB80.3 and CR6261 binding sites and its high affinity for SC1918 HA, it seemed plausible that HB80.3 would also block this conformational change. Indeed, HB80.3 inhibits the pH-induced conformational changes in both HI and H5 HAs (Fig. 5C, Fig. 11 )(10), suggesting that this design may possess virus-neutralizing activity against multiple influenza subtypes (27).
- Group 1 includes 10 of the 16 HA subtypes: HI, H2, H5, H6, H8, H9, Hl l, H12, H13, and H16.
- Group 2 includes the remaining 6 subtypes: H3, H4, H7, H10, H14, and H15.
- the other hotspot residues differed from the sidechains observed in the crystal structures in their conformation or identity.
- Each hotspot residue was further diversified by constructing all conformations, the terminal atoms of which coincided with those modeled above. For instance, for HS3, these consisted of all Tyr conformations that matched the position of the aromatic ring and hydrogen bond. This diversification step produced a 'fan' of backbone positions for each residue in the hotspot libraries.
- Proteins in the scaffold set contained no disulfides, were expressed in E. coli, and were predicted to form monomers (see Supplemental Information).
- the alanine-scan mutations were as follows: for HB36.3, Phe49, Met53, and Trp57; for HB80.1 Phel3, Phe25, and Tyr40 (Table S4 and supplemental resutls).
- HB36.4 was not able to block the pH-induced conformational changes in the HI HA under identical assay conditions, even though HB36.4 and HB80.3 have very similar dissociation constants and kinetic off-rates at pH 7.5 (Fig. 11 ).
- FIG. 1 provides a flowchart overview of the approach.
- This method is a generalization of a recently described approach for two-sided design of pairs of interacting proteins (Si).
- Si pairs of interacting proteins
- Method surfaces of an ankyrin-repeat protein and a target protein were simultaneously mutated to introduce a hotspot region buttressed by a periphery of compatible interactions.
- the hotspot region in that method comprised aromatic residues that formed intermolecular hydrogen bonds.
- Our approach does not make any assumptions about the nature of the hotspot or the scaffold protein.
- the hotspot-residue libraries are used to identify configurations of the scaffold protein with respect to HA that may accommodate the placement of these hotspot residues.
- Each hotspot residue computed in the library implies an approximate location for a position on the scaffold protein and an orientation for the Ca-C and the C-N vectors.
- AG3 ⁇ 4 is the computed binding energy for hotspot residue A, is always negative and was chosen to be -3 in all design trajectories; 3 ⁇ 4 a, C, and N, are the coordinates of the Cfi, Ca, C, and N atoms; & (the spring constant) is arbitrarily set to 0.5; min is the minimum function ensuring that the restraint is negative or zero; the quantities within the square brackets are the dot
- This form of the restraint function reaches a minimum when the distance between the Cfi of the hotspot residue and a position on the scaffold is 0 and the Ca- ⁇ and C-N vectors are matched.
- a given restraint is best satisfied when a potential grafting position on the scaffold is perfectly aligned with a pre-computed hotspot residue. If the orientation of either of the two vectors of position i with respect to hotspot h is more than 90°, then Ri is set to 0.
- a library of n hotspot residues thus implies n restraints. Each residue i is then assigned the smallest of these n restraints:
- Equation 2 then assigns the minimal restraint to each amino-acid position i on the scaffold, so that each scaffold position is affected only by the most appropriate hotspot restraint at any given time during conformational search.
- the restraints can be computed efficiently during low-resolution Monte-Carlo based docking of the scaffold protein with respect to the HA surface. Importantly, the restraints can be used during minimization as Equation 1 is readily differentiable.
- Method 1 placement of the scaffold onto an idealized hotspot residue
- the residues within the hotspot-residue libraries define configurations that are optimal for realizing the hotspot interaction. For a given interfacial scaffold position, we iterate over each of the nearby hotspot residues in the library and rotate and translate the scaffold protein so as to align it perfectly with the rotamer of the hotspot residue. Scaffold positions, for which the Cfi atoms are farther than 4.0 A from the relevant hotspot residue or whose C-N ox Ca-C vectors are misaligned with the hotspot residues by more than 60°, are triaged to avoid compromising the initial, high shape complementary configuration of the two partners.
- Method 2 placement of a hotspot residue onto a scaffold position
- Method 3 simultaneous placement of multiple hotspot residues For each hotspot-residue library, we identify a position on the scaffold protein that produces the most favorable restraint score as defined by Equation 1 compared to the remainder of the hotspot-residue libraries. Each such scaffold position is then coupled to the appropriate hotspot-residue library. If not all hotspot-residue libraries are matched to different scaffold positions, the configuration of the scaffold with respect to the target is discarded. Upon success, we simultaneously redesign the identities of the relevant scaffold positions to those amino-acid identities contained in their matched hotspot-residue libraries.
- scaffold positions that are at most lOA from the target protein are redesigned using
- RosettaDesign 8
- the target protein side chains are allowed to repack.
- Gly Pro and disulfide-linked cysteines are left as in the wildtype sequence.
- Three iterations of redesign and minimization were used to increase the likelihood that higher-affinity interactions are found, starting with a soft-repulsive potential, and gradually increasing the repulsive terms.
- the last design step uses the default all-atom forcefield with high weights on the steric clashes and rotameric strain to ensure that the designed residues do not assume high-energy conformations.
- the side chains of the placed hotspot residues are biased towards the coordinates of the idealized hotspot residues as present in the hotspot-residue library (similar to the implementation in ref. (S9)).
- This bias is implemented as harmonic coordinate restraints, typically on three atoms that define the functional group of the side chain, in effect pulling the placed hotspot residue's functional group towards its idealized position with respect to the target protein.
- these atoms would be the three carbon atoms at the root of Tyr and Phe aromatic rings.
- the contribution of each amino- acid substitution at the interface is assessed by singly reverting residues to their wild-type identities and testing the effects of the reversion on the computed binding energy. If the difference in binding energy between the designed residue and the reverted one is less than 0.5R.e.u. in favor of the design, then the position is reverted to its wild-type identity.
- binding energy was defined as the difference between the total system energy in the bound and unbound states. In each state, interface residues were allowed to repack. For numerical stability, binding-energy calculations were repeated three times and the average taken.
- Shape complementarity was computed using the CCP4 package v.6.0.2 (Si J) using the sc program.
- E. coli biotin ligase (BirA enzyme) was expressed and purified in a manner similar to previous reports(Si ⁇ ), but with an N-terminal His tag.
- the birA gene was amplified from an E. coli colony (wild-type strain MG1655) using primers DE389 (5'- agtcactaggtcatatgcatcaccatcaccatcacaaggataacaccgtgccactg-3' (SEQ ID NO: 195)) and DE390 (5'-agtcactaggtaagcttttatttttctgcactacgcagggatatttc-3'(SEQ I D NO: 197)).
- PCR product was digested with Ndel and Hindlll and ligated into similarly digested pET21 a, yielding pDCE095.
- This vector was transformed into BL21(DE3) cells for protein expression.
- BL21(DE3)/pDCE095 cells were grown in shake flasks in low salt LB medium at 37°C to an OD (600nm) of -0.7, then shifted to 23°C and induced with the addition of IPTG
- BirA protein was approximately lOmg/L and >95% pure as assessed by SDS-PAGE.
- Purified BirA protein was concentrated to 5mg/mL in 50mM Tris, pH 7.5, 200mM potassium chloride, 5% glycerol, aliquoted, snap frozen in liquid nitrogen, and stored at -80°C.
- cDNAs corresponding to residues 1 1-329 (HA1) and 1-176 (HA2) of the influenza A hemagglutinin (HA) were fused to an N-terminal gp67 signal peptide (amino acid sequence: MVLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFA (SEQ ID NO: 212)) and to a C-terminal trimerization domain and His-tag by overlap PCR, essentially as previously described(S 3).
- the trimerization domain and His-tag were separated from the HA ectodomain by a thrombin cleavage site.
- a BirA target biotinylation site (amino-acid sequence: GGGLNDIFEAQKIEWHE (SEQ ID NO: 213)) was inserted between the HA and the thrombin site.
- the resulting PCR products were digested with Sfil, and inserted into a custom baculovirus transfer vector, pDCE198.
- Recombinant bacmids were generated using the Bac-to-Bac system (Invitrogen) and viruses were rescued by transfecting purified bacmid DNA into Sf9 cells using Cellfectin II (Invitrogen).
- HA proteins were produced by infecting suspension cultures of Hi5 cells (Invitrogen) with recombinant baculovirus at an MOI of 5-10 and incubating at 28°C shaking at 1 10 RPM. After 72 hours, the cultures were clarified by two rounds of centrifugation at 2000g and 10,000g at 4 °C. The supernatant, containing secreted, soluble HA was concentrated and buffer exchanged into lx PBS, pH 7.4. After metal affinity chromatography using Ni-NTA resin, HAs were modified and purified further as required for specific purposes (see following sections). At this stage, yields typically varied from 1-lOmg/L, depending upon the HA isolate.
- HAs with C-terminal biotinylation tags were concentrated down to ⁇ 2-5mg/mL total protein.
- the HAs were biotinylated by the addition of 25ug BirA enzyme/mg total protein, in a buffer of the following composition: lOOmM Tris pH 8.0, lOmM ATP, lOmM MgOAc, 50uM biotin, with less than 50mM NaCl.
- the biotinylation reactions were incubated at 37°C for 1-2 hours.
- HAs were digested with trypsin (New England Biolabs, 5mU trypsin per mg HA, 16 hours at 17°C) to generate the fusion competent HA1/HA2 form, while the majority were kept undigested as HA0.
- Biotinylated HAs were purified by size-exclusion chromatography, and concentrated down to -5-20 mg/mL.
- CR6261 Fab was further purified by protein G affinity chromatography (elution in glycine buffer, pH 2.7); cation exchange chromatography (MonoS resin, sodium acetate, pH 5.0, with a linear gradient from 0-500mM NaCl); and gel filtration (lOmM Tris, pH8.0, 150mM NaCl). The final yield was approximately 15mg/L.
- Yeast codon-optimized genes encoding designs were custom ordered from Genscript (Piscataway, NJ) and subcloned between Ndel/Xhol sites in an in-house yeast display plasmid named pETCONTM.
- pETCONTM is the original yeast display plasmid pCTCON(Si6) with the following modifications: (a) a frameshift mutation in the CD20 encoding region; (b) a Ndel restriction site immediately downstream of the Nhel site; and (c) a XhoI-Gly 2 spacer sequence immediately upstream of the BamHI restriction site. The full sequence is available upon request. Binding studies were done essentially as described (Si 5) using 1 ⁇ of a biotinylated
- Binding signal was quantified as the mean phycoerythrin fluorescence of the displaying population of cells using a 488 nm laser for excitation and a 575 nm band pass filter for emission (appropriately compensated) using either a Cytopeia inFlux Cell Sorter or an Accuri C6 flow cytometer.
- the positive control for binding was CR6261 scFv Phe54Ala.
- the CR6261 scFv was constructed by a (Gly 4 Ser) 3 linker joining the heavy to the light variable region using the DNA encoding CR6261 Fab (Si 7) as a template.
- the scFv was further amplified to include recombination sites for integration into pETCON between the Ndel/Xhol restriction sites.
- the Phe54Ala and all other point mutations were introduced by the method of Kunkel (SiS). Affinity Maturation
- HB 36 Round 1 First-generation libraries were constructed from the designed HB36 gene by error-prone PCR (epPCR) on the entire amino-acid coding segment or through single site- saturation mutagenesis at 22 out of the 27 residues that are modeled as being within ⁇ from HA. In this and other cases, epPCR was done using a Stratagene GeneMorphTM II random mutagenesis kit (Agilent, CA) and site- saturation mutagenesis by the method of Kunkel (SI 9). The total library size was 3e5. We carried these libraries through 2 sorts of yeast display selection, with cells labeled at 50 nM HA1-2 for sort 1 and 10 nM for sort 2. Asp47X and Ala60Val/Thr mutations were recovered that improved affinity > 10-fold. The best combination was used for the start of Round 2, and was HB36 Asp47Ser Ala60Val (HB36.3).
- HB36 Round 2 Second-generation libraries were constructed from HB36.3 gene using epPCR at 2 ⁇ 1 mutations per gene. A total of 4 yeast display sorts were taken on a library size of 5.4e6. For the I s sort, cells were labeled with 5 nM HAl-2 and gated to collect the top 5% of the population. For the second and third sorts, cells were labeled with 10 nM HAl-2 and then thoroughly washed with phosphate buffer saline with 1 mg/mL Fraction V bovine serum albumin (Sigma, St. Louis, Mo.). Cells were then incubated at 22°C with 1 ⁇ of soluble HB36.3 for 40 mm. A 4 th sort was taken with an off-rate incubation of 60 min. All clones selected from this round included the mutation Asn64Lys.
- HB80 Round 1 First-generation libraries were constructed from the designed HB80 gene by epPCR using a mutational load of 2 ⁇ 1 mutations per gene. A library of 1.6e6 transformants was subjected to selection using a labeling concentration of 1 ⁇ HAl-2 and three total sorts. We recovered mutations Met26Val/Thr and Asn36Lys, each of which improved affinity > 10- fold. A gene encoding a combination of these mutations HB80 Met26Thr Asn36Lys and a truncation after position 54 (named HB80.2) was the starting sequence for the next round of selection.
- HB80 Round 2 Starting with the HB80.2 gene, an epPCR library with a mutational load of 2 ⁇ 1 mutations per gene was transformed into yeast, yielding 2e4 transformants. Cells were labeled with HAl-2 at 3 nM (sort 1), and 5 nM (sorts 2&3) and gated to collect the top 4-5% of cells. All clones selected had a Aspl2Gly or a Ala24Ser mutation.
- EMD Gibbstown, NJ
- E. coli RosettaTM E. coli RosettaTM
- Protein expression was induced using the autoinduction method of Studier (S20). After expression for 24 h at 18°C, cells were pelleted, resuspended into buffer HBS (20 mM Hepes, 150 mM NaCl pH 7.4), and sonicated to release cell lysate. Following clarification by centrifugation, supernatant was applied to a Nickel column for purification. Proteins were eluted by step elution at 250 mM imidazole in HBS. Size exclusion chromatography on a Superdex75 column was used as a finishing purification step into HBS buffer.
- Biolayer interferometry is conceptually similar to surface plasmon resonance experiments in that a protein of interest is immobilized on a surface and then exposed to potential binding partners in solution. The binding of analytes to the immobilized protein changes the optical properties of the biosensors, leading to a shift in the wavelength of light reflected off the binding surface. This shift in wavelength can be measured in real-time, allowing the measurement of association and dissociation rates and, therefore, Kj. Biotinylated HAs, purified as described above, were used for these measurements.
- HAs at -10-50 ⁇ g/mL in lx kinetics buffer (lx PBS, pH 7.4, 0.01% BSA, and 0.002% Tween 20) were loaded onto streptavidin coated biosensors and incubated with varying concentrations of HB80.3 or CR6261 Fab in solution. All binding data were collected at 25°C.
- the experiments comprised 5 steps: 1. Baseline acquisition (60 s); 2. HA loading onto sensor (180 s); 3. Second baseline acquisition (180 s); 4. Association of the designed binder for the measurement of k on (180 s); and 5. Dissociation of the binder for the measurement of k 0ff (180 s). 4-6 concentrations of each binder were used, with the highest concentration being 100 nM. Baseline and dissociation steps were carried out in buffer only. The sequences of all proteins used in this work are available in FASTA format as Table 10 below. Expression and purification of HB36.3 for crystallization
- RosettaTM 2 (BL21/DE3) cells carrying the pET29a-HB36.3 construct were grown in shake flasks in low salt LB medium to an OD 6 oo of -0.7 at 37°C, then shifted to 18°C and induced by the addition of ImM IPTG. Cultures were incubated overnight at 18°C for protein expression, then harvested by centrifugation (3000g, 10 minutes).
- the pellet from a 1L culture was resuspended in 50-100mL of lysis buffer (50mM Tris pH 8.0, 300mM NaCl, lOmM imidazole pH 8.0, with Roche EDTA-free protease inhibitor cocktail tablet) and the cells were lysed and homogenized by two passes through an EmulsiFlexTM C-3 cell disruptor (15kPSI). After clearing the lysates by centrifugation (25,000g, ⁇ 1 hour), the supernatant was incubated with NiNTA resin (Qiagen), washed with excess lysis buffer, and bound proteins were eluted (with 50mM Tris pH 8.0, 300mM NaCl, 250mM imidazole pH 8.0).
- lysis buffer 50mM Tris pH 8.0, 300mM NaCl, lOmM imidazole pH 8.0, with Roche EDTA-free protease inhibitor cocktail tablet
- the eluted material was buffer exchanged into lOmM Tris pH8.0, 50mM NaCl, loaded onto a MonoQTM anion exchange column, and eluted with a linear gradient from 50-500mM NaCl. Peak fractions containing HB36.3 were pooled and subjected to gel filtration. HB36.3 eluted as an apparent dimer when loaded at high concentrations ( ⁇ 10mg/mL), but eluted as a monomer when loaded at lower concentrations ( ⁇ lmg/mL), and the two forms were in rapid equilibrium. Fractions containing HB36.3 were pooled and concentrated to ⁇ 5mg/mL.
- Biolabs 5mU trypsin per mg HA, 16 hours at 17°C) to produce uniformly cleaved (HA1/HA2), and to remove the trimerization domain and His-tag.
- the digested material was purified by anion exchange chromatography (lOmM Tris, pH 8.0, 50-1M NaCl) and size exclusion chromatography (lOmM Tris, pH 8.0, 150mM NaCl).
- HB36.3 (approximately 5 HB36.3 molecules per HA trimer) was mixed with purified SC1918 HA in lOmM Tris pH 8.0, 150mM NaCl at ⁇ 2mg/mL. The mixtures were incubated overnight at 4°C to allow complex formation. Saturated complexes were then purified from unbound HB36.3 by gel filtration. Crystallization and structure determination of the HB36.3-SC1918/H1 complex
- Rigid- body and restrained refinement (including TLS refinement, with one group for HA1 , one for HA2, and one for HB36.3) were carried out in PhenixTM (S22). Between rounds of refinement, the model was built and adjusted using CootTM (S23). The insect cells used for protein expression produce fully glycosylated HA, and additional electron density was observed for glycans at all 5 predicted glycosylation sites (NX(S/T) motifs) on the HA. A total of 5 sugar residues were built at 2 of these sites (at the remaining three sites, density was too weak or ambiguous to allow accurate model building).
- reaction contained ⁇ 2.5 ⁇ g HA or ⁇ 5 ⁇ g binder-HA complex and 1% dodecyl- maltoside (to prevent aggregation of the post- fusion HA). Reactions were set up at room temperature and the pH was lowered by adding 100 mM buffer to all samples except controls.
- yeast surface- display assay As our screen because the system allows rapid testing of many designs, there was minimal non-specific adsorption of the biotinylated hemagglutinin (at 1 ⁇ ) on the yeast surface (low background), and the screen could be readily reconfigured to select for higher-affinity variants. While it has been reported that binding dissociation constants are roughly equivalent between yeast display titrations and in vitro measurements (S30), we noted approximately 10-fold weaker affinity for in vitro SPR measurements as compared to the yeast surface display titrations. Although there may be many reasons for the discrepancies between measurements (e.g.
- PE mean phycoerythrin fluorescence
- our yeast display screen can recover from our design set all binders that surface display with an in vitro IQ ⁇ 25uM and a k 0ff ⁇ 10s _1 .
- Several designs showed weak binding activity in this screen; and include HB3, HB54, and HB78 (amino acid sequences are available in Table 9, below).
- post-fusion hemagglutinin (S 34) reveals a helix bound to the hydrophobic region in the stem in a manner that is reminiscent of the main recognition helices observed in HB36 and HB80 although different in crucial details.
- the post-fusion structure shows significant rearrangement of the target epitope compared to the pre-fusion form, with the two loops that flank the hydrophobic surface moving away, providing unimpeded access to it. against this surface, a helical segment from HA2 docks, burying the hydrophobic surface on the stem region.
- MSNAMDGQQLNRLLLEWIGAWDPFGLGKDAYDVEAEAVLQAVYETESAFDLAMRIM WIYAFAFNRPIPFPHAQKLARRLLELKQAASSPLPLE (SEQ ID NO: 270)
- HHHHH SEQ ID NO: 2736
- Yeast-displayed designs protect HA from undergoing pH-induced conformational change
- SC1918/H1 HA was produced according to previous reports and was confirmed to be cleaved to HA1 & HA2 using denaturing gel electrophoresis.
- HI HA was chemically biotinylated in PBS pH 7.4 at rt for 30 min using a 10-fold molar excess of sulfo-NHS-LC-biotin (Pierce), after which time the protein was desalted into 10 mM Tris, 150 mM NaCl, pH 8.0 using a desalting spin column (Thermo Scientific) and stored at 4°C.
- HI HA was incubated in a final volume of 100 uL at either buffer BBSF (20 mM BTP, 150 mM NaCl, 1 mg/mL Fraction V BSA, pH 7.4) or buffer pHBSF (100 mM sodium acetate, 150 mM NaCl, 1 mg/mL Fraction V BSA, pH 5.2) for 1 h at 37°C, after which the reactions were neutralized with 20 of 1 M Tris-HCl pH 8.0.
- buffer BBSF buffer BBSF (20 mM BTP, 150 mM NaCl, 1 mg/mL Fraction V BSA, pH 7.4
- buffer pHBSF 100 mM sodium acetate, 150 mM NaCl, 1 mg/mL Fraction V BSA, pH 5.2
- Reaction mixtures were vortexed, spun at 20,000 x g for 5 min, and the supernatant at 10-fold dilution was used to label yeast cells displayed with either CR6261 scFv or affinity-matured designs.
- Cells were labeled for 30 min at 22°C in buffer, washed, and secondary labeled for 10 min on ice with anti-cmyc FITC (Miltenyi Biotec, Auburn, CA) and streptavidin-phycoerythrin (Invitrogen, Carlsbad, CA). After washing, cells were re-suspended in BBSF buffer and fluorescence of 20,000 cells was quantified using an Accuri C6 flow cytometer.
- Both CR6261 scFv and the designed binders target an epitope on HA that is absent in the post-fusion conformational change.
- HI HA treated at pH 5.2 for 1 h had significantly lower fluorescence relative to controls for all three surface-displayed HA binders, indicating that the HI HA can undergo irreversible conformational change to the post-fusion state under these treatment conditions (data not shown).
- yeast-displayed designs can protect against HI HA pH-induced conformational changes
- 8 nM of HI HA was used to label yeast cells displayed with either CR6261 scFv or affinity-matured designs.
- 2e6 cells were labeled for 30 min at 22°C in 1 mL BBSF buffer, washed once, and resuspended in either BBSF or pHBSF buffer and incubated at 37°C for 1-24 h. Periodically, samples were withdrawn in 100 volume and neutralized with 20 uL of 1 M Tris-HCl pH 8.0. Cells were pelleted, washed, and processed exactly as above. Sequential timepoints up to 24 h of this process were assessed.
- yeast cells displaying either the CR6261 scFv or the HB80.3 design show no significant difference in binding signal between the cells incubated in low pH or neutral pH buffer, showing that these designs most likely protect against the low-pH induced conformational change of HI HA.
- yeast cells displaying the HB36.4 design show no difference in binding signal between the low pH buffer and neutral pH buffer incubation until the 24 h timepoint, when a slight decrease in binding signal at the low pH incubation was seen.
- Example 3 Profiling of the sequence-specific determinants of binding for designs using selections coupled to next generation DNA sequencing.
- Single site saturation mutagenesis libraries for HB36.4 and HB80.3 were constructed from synthetic DNA by Genewhiz. Parental sequences are listed in Table 1 1 with mutagenic region highlighted in red.
- Yeast EBY100 cells were transformed with library DNA and linearized pETCON (Science, 2011) using established protocols, yielding 1.4e6 and 3.3e6 transformants for the HB36.4 & HB80.3 ssm libraries, respectively. After transformation, cells were grown overnight in SDCAA media in 30 mL cultures at 30°C, passaged once, and stored in 20 mM HEPES 150 mM NaCl pH 7.5, 20% (w/v) glycerol in le7 aliquots at -80°C. Table 11. DNA sequences of the single site saturation mutagenesis libraries. Base in italics and enlarged font indicate start and end of design encoding sequence. Base pairs in bold font indicate region of single site saturation mutagenesis. >HB36.4
- plasmid was recovered using a zymo research yeast plasmid miniprep II kit (Zymo Research, Irvine, CA) into a final volume of 30 ⁇ 10 mM Tris-HCl pH 8.0.
- Contaminant genomic DNA was processed (per 20 ⁇ , rxn) using 2 ⁇ Exol exonuclease (NEB), 1 ⁇ lambda exonuclease (NEB), and 2 ⁇ lambda buffer at 30°C for 90 min followed by heat inactivation of the enzymes at 80°C for 20 min.
- NEB Exol exonuclease
- NEB 1 ⁇ lambda exonuclease
- 2 ⁇ lambda buffer at 30°C for 90 min followed by heat inactivation of the enzymes at 80°C for 20 min.
- Plasmid DNA was separated from the reaction mixture using a Qiagen PCR cleanup kit (Qiagen). Next, 18 cycles of PCR (98°C 10 s, 68°C 30s, 72°C 10 s) using Phusion high fidelity polymerase (NEB, Waltham, MA) was used to amplify the template and add the Illumina adaptor sections. Primers used were sample-specific and are listed in Table 13.
- PCR reaction was purified using an Agencourt AMPureTM XP kit (Agencourt, Danvers, MA) according to the manufacturer's specifications. Samples were quantified using Qubit dsDNA HS kit (Invitrogen) for a final yield of 1-4 ng/uL. Samples were combined in an equimolar ratio; from this pool, 0.4 fmol of total DNA was loaded on 2 separate lanes and sequenced using a Genome Analyzer IIx (Illumina) with appropriate sequencing primers (Table 13).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Virology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Gastroenterology & Hepatology (AREA)
- Analytical Chemistry (AREA)
- Microbiology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Tropical Medicine & Parasitology (AREA)
- Epidemiology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Pulmonology (AREA)
- Peptides Or Proteins (AREA)
Abstract
Description
Claims
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP11754773.7A EP2600884A2 (en) | 2010-08-03 | 2011-08-03 | Polypeptides for treating and/or limiting influenza infection |
| CA2807043A CA2807043A1 (en) | 2010-08-03 | 2011-08-03 | Polypeptides for treating and/or limiting influenza infection |
| SG2013007489A SG187251A1 (en) | 2010-08-03 | 2011-08-03 | Polypeptides for treating and/or limiting influenza infection |
| US13/813,356 US8765686B2 (en) | 2010-08-03 | 2011-08-03 | Polypeptides for treating and/or limiting influenza infection |
| JP2013523302A JP2013540425A (en) | 2010-08-03 | 2011-08-03 | Polypeptide for treating and / or limiting influenza infection |
| RU2013109273/10A RU2013109273A (en) | 2010-08-03 | 2011-08-03 | POLYEPEPTIDES USED FOR TREATING AND / OR INHIBITING INFECTIONS CAUSED BY INFLUENZA VIRUS |
| PH1/2013/500204A PH12013500204A1 (en) | 2010-08-03 | 2011-08-03 | Polypeptides for treating and/or limiting influenza infection |
| US14/221,346 US9181300B2 (en) | 2010-08-03 | 2014-03-21 | Polypeptides for treating and/or limiting influenza infection |
| US14/877,348 US20160024155A1 (en) | 2010-08-03 | 2015-10-07 | Polypeptides for treating and/or limiting influenza infection |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US37041010P | 2010-08-03 | 2010-08-03 | |
| US61/370,410 | 2010-08-03 | ||
| US201161436058P | 2011-01-25 | 2011-01-25 | |
| US61/436,058 | 2011-01-25 | ||
| US201161440771P | 2011-02-08 | 2011-02-08 | |
| US61/440,771 | 2011-02-08 | ||
| US201161485395P | 2011-05-12 | 2011-05-12 | |
| US61/485,395 | 2011-05-12 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/813,356 A-371-Of-International US8765686B2 (en) | 2010-08-03 | 2011-08-03 | Polypeptides for treating and/or limiting influenza infection |
| US14/221,346 Continuation US9181300B2 (en) | 2010-08-03 | 2014-03-21 | Polypeptides for treating and/or limiting influenza infection |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012018907A2 true WO2012018907A2 (en) | 2012-02-09 |
| WO2012018907A3 WO2012018907A3 (en) | 2012-05-10 |
Family
ID=45560051
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2011/046414 Ceased WO2012018907A2 (en) | 2010-08-03 | 2011-08-03 | Polypeptides for treating and/or limiting influenza infection |
Country Status (8)
| Country | Link |
|---|---|
| US (3) | US8765686B2 (en) |
| EP (1) | EP2600884A2 (en) |
| JP (1) | JP2013540425A (en) |
| CA (1) | CA2807043A1 (en) |
| PH (1) | PH12013500204A1 (en) |
| RU (1) | RU2013109273A (en) |
| SG (1) | SG187251A1 (en) |
| WO (1) | WO2012018907A2 (en) |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2013138259A3 (en) * | 2012-03-13 | 2013-12-19 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| WO2014152946A3 (en) * | 2013-03-14 | 2015-01-08 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| US9181300B2 (en) | 2010-08-03 | 2015-11-10 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| WO2015143339A3 (en) * | 2014-03-21 | 2015-11-19 | University Of Washington | Enhanced influenza hemagglutinin binders |
| WO2016170183A1 (en) * | 2015-04-24 | 2016-10-27 | Pharmadiagnostics Nv | Improved method of measuring an interaction between molecules |
| US9778261B2 (en) | 2015-09-22 | 2017-10-03 | University Of Washington | Porous membrane-binding peptides |
| JP2022119757A (en) * | 2013-10-02 | 2022-08-17 | メディミューン,エルエルシー | Neutralizing anti-influenza A antibodies and uses thereof |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10550427B2 (en) | 2013-11-11 | 2020-02-04 | The Translational Genomics Research Institute | Systems and methods for universal tail-based indexing strategies for amplicon sequencing |
| JP6647207B2 (en) * | 2014-10-24 | 2020-02-14 | ペプチドリーム株式会社 | Hemagglutinin binding peptide |
| US10766929B2 (en) | 2017-03-15 | 2020-09-08 | University Of Washington | De novo designed hemagglutinin binding proteins |
| WO2026044657A1 (en) * | 2024-08-30 | 2026-03-05 | Dow Global Technologies Llc | Sulfate free personal care rinse off composition |
Family Cites Families (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1167382A1 (en) | 1999-03-31 | 2002-01-02 | Otsuka Pharmaceutical Co., Ltd. | Influenza virus hemagglutinin-binding peptides |
| FI20031536A0 (en) | 2003-10-20 | 2003-10-20 | Biotie Therapies Oyj | High affinity ligands for influenza viruses and their production processes |
| GB0716992D0 (en) | 2007-08-31 | 2007-10-10 | Immune Targeting Systems Its L | Influenza antigen delivery vectors and constructs |
| EP2003198A2 (en) | 2006-03-13 | 2008-12-17 | Keio University | Peptide for inhibition of influenza infection, inhibitor of influenza infection, liposome, and prophylactic/therapeutic agent for influenza |
| RU2010127156A (en) * | 2007-12-06 | 2012-01-20 | Дана-Фарбер Кэнсер Инститьют, Инк. (Us) | ANTIBODIES AGAINST INFLUENZA VIRUS AND THEIR APPLICATION |
| MY160435A (en) | 2008-06-12 | 2017-03-15 | Univ Putra Malaysia | A novel antiviral peptide against avian influenza virus h9n2 |
| EP4071169A2 (en) * | 2008-08-25 | 2022-10-12 | Dana Farber Cancer Institute, Inc. | Conserved influenza hemagglutinin epitope and antibodies thereto |
| US20110152178A1 (en) | 2008-08-29 | 2011-06-23 | Keio University | Prophylactic or therapeutic agent for influenza virus infection |
| AU2008365616A1 (en) | 2008-12-24 | 2011-08-11 | Temasek Life Sciences Laboratory Limited | Monoclonal antibodies specific to the fusion peptide from hemagglutinin from influenza A viruses and uses thereof |
| CA2761648C (en) | 2009-05-11 | 2019-03-12 | Crucell Holland B.V. | Human binding molecules capable of neutralizing influenza virus h3n2 and uses thereof |
| PH12013500204A1 (en) | 2010-08-03 | 2013-04-01 | Univ Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| US8569255B2 (en) | 2011-02-02 | 2013-10-29 | Her Majesty The Queen In Right Of Canada, As Represented By The Minister Of National Defence | Post-exposure therapy of influenza A infections |
| WO2013082531A2 (en) | 2011-12-02 | 2013-06-06 | Reflexion Pharmaceuticals | Broad spectrum influenza a neutralizing vaccines and d-peptidic compounds, and methods for making and using the same |
| WO2013121442A2 (en) | 2012-02-15 | 2013-08-22 | Tribi Systems Private Limited, Company | A method and system for controlling a motor / multi-motor system |
| US9624272B2 (en) | 2013-03-14 | 2017-04-18 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
-
2011
- 2011-08-03 PH PH1/2013/500204A patent/PH12013500204A1/en unknown
- 2011-08-03 JP JP2013523302A patent/JP2013540425A/en not_active Withdrawn
- 2011-08-03 WO PCT/US2011/046414 patent/WO2012018907A2/en not_active Ceased
- 2011-08-03 CA CA2807043A patent/CA2807043A1/en not_active Abandoned
- 2011-08-03 EP EP11754773.7A patent/EP2600884A2/en not_active Withdrawn
- 2011-08-03 SG SG2013007489A patent/SG187251A1/en unknown
- 2011-08-03 US US13/813,356 patent/US8765686B2/en not_active Expired - Fee Related
- 2011-08-03 RU RU2013109273/10A patent/RU2013109273A/en not_active Application Discontinuation
-
2014
- 2014-03-21 US US14/221,346 patent/US9181300B2/en not_active Expired - Fee Related
-
2015
- 2015-10-07 US US14/877,348 patent/US20160024155A1/en not_active Abandoned
Non-Patent Citations (59)
| Title |
|---|
| "Culture of Animal Cells: A Manual of Basic Technique", 1987, LISS, INC. |
| "Culture ofAnimal Cells: A Manual ofBasic Technique", 1987, LISS, INC. |
| "Gene Transfer and Expression Protocols", THE HUMANA PRESS INC., pages: 109 - 128 |
| "Laboratory techniques in influenza", 1996, WORLD HEALTH ORGANIZATION |
| "Methods in Enzymology", 1990, ACADEMIC PRESS, INC., article "Guide to Protein Purificatio" |
| "Methods in Enzymology", vol. 185, 1991, ACADEMIC PRESS |
| A. J. MCCOY ET AL., J APPL CRYSTALLOGR, vol. 40, 2007, pages 658 |
| ACTA CRYSTALLOGR D BIOL CRVSTALLOGR, vol. 50, 1994, pages 760 |
| B. KUHLMAN ET AL., SCIENCE, vol. 302, 2003, pages 1364 |
| C. A. SMITH, T. KORTEMME, JMOL BIOL, vol. 380, 2008, pages 742 |
| C. E. STEBBINS, J. E. GALAN, NATURE, vol. 412, 2001, pages 701 |
| C. E. STEVENSON ET AL., PROTEINS, vol. 65, 2006, pages 1041 |
| C. P. GRAFF, K. CHESTER, R. BEGENT, K. D. WITTRUP, PROTEIN ENG DES SEL, vol. 17, 2004, pages 293 |
| D. C. EKIERT ET AL., SCIENCE, vol. 324, 2009, pages 246 |
| D. SCHNEIDMAN-DUHOVNY, Y. INBAR, R. NUSSINOV, H. J. WOLFSON, NUCLEIC ACIDS RES, vol. 33, 2005, pages W363 |
| E. BAUTISTA ET AL., N ENGL J MED, vol. 362, 2010, pages 1708 |
| E. T. BODER, K. S. MIDELFORT, K. D. WITTRUP, PROC NATL ACAD SCI US A, vol. 97, 2000, pages 10701 |
| F. W. STUDIER, PROTEIN EXPR PURIF, vol. 41, 2005, pages 207 |
| G. CHAO ET AL., NAT PROTOC, vol. 1, 2006, pages 755 |
| H. LEDFORD, NATURE, vol. 455, 2008, pages 437 |
| HARLOW, LANE: "Antibodies; A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY |
| I. K. MCDONALD, J. M. THORNTON, J. MOL. BIOL., vol. 238, 1994, pages 777 |
| INNIS ET AL.: "PCR Protocols: A Guide to Methods and Applications", 1990, ACADEMIC PRESS |
| J. CHEN, J. J. SKEHEL, D. C. WILEY, PROC NATL ACAD SCI USA, vol. 96, 1999, pages 8967 |
| J. J. GRAY ET AL., JMOL BIOL, vol. 331, 2003, pages 281 |
| J. J. HAVRANEK, D. BAKER, PROTEIN SCI, vol. 18, 2009, pages 1293 |
| J. KARANICOLAS ET AL., MOL. CELL, 2011 |
| J. M. CHANDONIA, S. E. BRENNER, SCIENCE, vol. 311, 2006, pages 347 |
| J. SUI ET AL., NAT STRUCT MOL BIOL, vol. 16, 2009, pages 265 |
| K. HENRICK, J. M. THORNTON, TRENDS BIOCHEM SCI, vol. 23, 1998, pages 358 |
| L. LO CONTE, C. CHOTHIA, J. JANIN, J MOL BIOL, vol. 285, 1999, pages 2177 |
| L. M. KUNKEL, A. P. MONACO, W. MIDDLESWORTH, H. D. OCHS, S. A. LATT, PROC NATL ACAD SCI USA, vol. 82, 1985, pages 4778 |
| M. C. LAWRENCE, P. M. COLMAN, J MOL BIOL, vol. 234, 1993, pages 946 |
| M. G. ROSSMANN, JBIOL CHEM, vol. 264, 1989, pages 14587 |
| M. THROSBY ET AL., PLOS ONE, vol. 3, 2008, pages E3942 |
| P. D. ADAMS ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 213 |
| P. EMSLEY, B. LOHKAMP, W. G. SCOTT, K. COWTAN, ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 486 |
| P. H. BROWN, J. E. CRONAN, M. GROTLI, D. BECKETT, JMOL BIOL, vol. 337, 2004, pages 857 |
| P. S. HUANG, J. J. LOVE, S. L. MAYO, PROTEIN SCI, vol. 16, 2007, pages 2770 |
| R. A. LERNER, ANGEW CHEM INT ED ENGL, vol. 45, 2006, pages 8106 |
| R. DAS, D. BAKER, ANNU REV BIOCHEM, vol. 77, 2008, pages 363 |
| R. K. JHA ET AL., JMOL BIOL, vol. 400, 2010, pages 257 |
| R. L. DUNBRACK, JR., M. KARPLUS, NAT STRUCT BIOL, vol. 1, 1994, pages 334 |
| S. HENIKOFF, J. G. HENIKOFF, PROTEINS, vol. 17, 1993, pages 49 |
| S. K. BURLEY, A. JOACHIMIAK, G. T. MONTELIONE, I. A. WILSON, STRUCTURE, vol. 16, 2008, pages 5 |
| S. LIU ET AL., PROC NATL ACAD SCI US A, vol. 104, 2007, pages 5330 |
| S. SHERIFF, W. A. HENDRICKSON, J. L. SMITH, JMOL BIOL, vol. 197, 1987, pages 273 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SAMBROOK, FRITSCH, MANIATIS: "Molecular Cloning, A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SCIENCE, 2011 |
| See also references of EP2600884A2 |
| T. A. KUNKEL, PROC NATL ACAD SCI USA, vol. 82, 1985, pages 488 |
| T. A. STEITZ, STRUCTURE, vol. 15, 2007, pages 1523 |
| T. CLACKSON, J. A. WELLS, SCIENCE, vol. 267, 1995, pages 383 |
| T. KORTEMME ET AL., NAT. STRUCT. MOL. BIOL., vol. 11, 2004, pages 371 |
| T. KORTEMME, D. BAKER, PROC. NATL. ACAD. SCI. USA, vol. 99, 2002, pages 14116 |
| V. B. CHEN ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 66, 2010, pages 12 |
| W. L. DELANO, DELANO SCIENTIFIC, PALO ALTO, CA, USA, 2002 |
| Z. DAUTER, ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 55, 1999, pages 1703 |
Cited By (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9181300B2 (en) | 2010-08-03 | 2015-11-10 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| WO2013138259A3 (en) * | 2012-03-13 | 2013-12-19 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| US9388217B2 (en) | 2012-03-13 | 2016-07-12 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| WO2014152946A3 (en) * | 2013-03-14 | 2015-01-08 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| US9624272B2 (en) | 2013-03-14 | 2017-04-18 | University Of Washington Through Its Center For Commercialization | Polypeptides for treating and/or limiting influenza infection |
| JP2022119757A (en) * | 2013-10-02 | 2022-08-17 | メディミューン,エルエルシー | Neutralizing anti-influenza A antibodies and uses thereof |
| JP2024119930A (en) * | 2013-10-02 | 2024-09-03 | メディミューン,エルエルシー | Neutralization of anti-influenza A antibodies and uses thereof |
| JP7602508B2 (en) | 2013-10-02 | 2024-12-18 | メディミューン,エルエルシー | Neutralization of anti-influenza A antibodies and uses thereof |
| WO2015143339A3 (en) * | 2014-03-21 | 2015-11-19 | University Of Washington | Enhanced influenza hemagglutinin binders |
| US9771395B2 (en) | 2014-03-21 | 2017-09-26 | University Of Washington | Enhanced influenza hemagglutinin binders |
| WO2016170183A1 (en) * | 2015-04-24 | 2016-10-27 | Pharmadiagnostics Nv | Improved method of measuring an interaction between molecules |
| US9778261B2 (en) | 2015-09-22 | 2017-10-03 | University Of Washington | Porous membrane-binding peptides |
Also Published As
| Publication number | Publication date |
|---|---|
| US20140206628A1 (en) | 2014-07-24 |
| US9181300B2 (en) | 2015-11-10 |
| US20160024155A1 (en) | 2016-01-28 |
| PH12013500204A1 (en) | 2013-04-01 |
| US20130143794A1 (en) | 2013-06-06 |
| CA2807043A1 (en) | 2012-02-09 |
| RU2013109273A (en) | 2014-09-10 |
| SG187251A1 (en) | 2013-02-28 |
| JP2013540425A (en) | 2013-11-07 |
| US8765686B2 (en) | 2014-07-01 |
| EP2600884A2 (en) | 2013-06-12 |
| WO2012018907A3 (en) | 2012-05-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9181300B2 (en) | Polypeptides for treating and/or limiting influenza infection | |
| KR101297784B1 (en) | Human monoclonal antibody generated from human B-cells able to neutralize influenza A viruses | |
| Thornburg et al. | H7N9 influenza virus neutralizing antibodies that possess few somatic mutations | |
| JP6072348B2 (en) | A composition comprising two or more influenza A virus neutralizing binding molecules | |
| Zhu et al. | A unique and conserved neutralization epitope in H5N1 influenza viruses identified by an antibody against the A/Goose/Guangdong/1/96 hemagglutinin | |
| JP6979875B2 (en) | Antibody-mediated neutralization of chikungunya virus | |
| US9388217B2 (en) | Polypeptides for treating and/or limiting influenza infection | |
| WO2014016358A1 (en) | Inhibition of hiv-1 infection by inhibition of binding of cpsf to viral capsid | |
| US20250130231A1 (en) | Compositions and methods for detection and treatment of coronavirus infection | |
| US9624272B2 (en) | Polypeptides for treating and/or limiting influenza infection | |
| Cao et al. | The epitope and neutralization mechanism of AVFluIgG01, a broad-reactive human monoclonal antibody against H5N1 influenza virus | |
| US20100278853A1 (en) | Constrained hiv v3 loop peptides as novel immunogens and receptor antagonists | |
| CA2717142A1 (en) | Method for identifying inhibitors against viruses that use a class i fusion protein | |
| CN101287988A (en) | Methods and compositions for the diagnosis and treatment of influenza | |
| WO2013082531A2 (en) | Broad spectrum influenza a neutralizing vaccines and d-peptidic compounds, and methods for making and using the same | |
| KR20130059721A (en) | Human monoclonal antibody generated from human b-cells able to neutralize influenza a viruses | |
| US20170198014A1 (en) | Polypeptides and their use for treating influenza | |
| US20120108492A1 (en) | Ligand-specific non-antibody compounds that inhibit cr2 activation and methods of use thereof | |
| Yang et al. | Rational Design and Bioactive Screening of Peptide Inhibitors Targeting Host–Pathogen Interactions in Severe Fever with Thrombocytopenia Syndrome Virus | |
| Däumer et al. | Characterisation of the epitope for a herpes simplex virus glycoprotein B-specific monoclonal antibody with high protective capacity | |
| WO2022210830A1 (en) | Anti-sars-cov-2 antibody | |
| Xue et al. | Rapid discovery of repurposed drugs targeting SARS-CoV-2 spike HR1 by DNA-encoded library screening | |
| US10766929B2 (en) | De novo designed hemagglutinin binding proteins | |
| US20260055143A1 (en) | High affinity variants of sh2 domains | |
| Iaculli et al. | Discovery of bioactive peptides through peptide scanning |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11754773 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2807043 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011754773 Country of ref document: EP Ref document number: 12013500204 Country of ref document: PH |
|
| ENP | Entry into the national phase |
Ref document number: 2013523302 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 13813356 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: 2013109273 Country of ref document: RU Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020137005537 Country of ref document: KR |









